[ Home  |  FAQ-Related Q&As  |  General Q&As  |  Answered Questions ]


    Search the Q&A Archives


...biggest word in the english language

<< Back to: sci.lang FAQ (Frequently Asked Questions)

Question by tj
Submitted on 6/1/2004
Related FAQ: sci.lang FAQ (Frequently Asked Questions)
Rating: Rate this question: Vote
what is the biggest word in the english language


Answer by Poo Poo Kitty Do
Submitted on 6/16/2004
Rating:  Rate this answer: Vote
Antidisestablishmentarianisim

 

Answer by Anon
Submitted on 6/22/2004
Rating:  Rate this answer: Vote
Hippopotomonstrosesquippedaliophobia

 

Answer by waddle_67
Submitted on 6/23/2004
Rating:  Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by draon
Submitted on 6/29/2004
Rating:  Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by karl
Submitted on 7/4/2004
Rating:  Rate this answer: Vote
thsiisthelongetswordbecauseithasthemostlettersinit.

 

Answer by amitjain
Submitted on 7/5/2004
Rating:  Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by Alastor
Submitted on 8/7/2004
Rating: Not yet rated Rate this answer: Vote
Smiles...theres a mile between the "s"'s

 

Answer by Someone
Submitted on 8/10/2004
Rating: Not yet rated Rate this answer: Vote
metholclhoroisothiasinone

 

Answer by bon
Submitted on 8/17/2004
Rating: Not yet rated Rate this answer: Vote
supermagafragalisticexpiallidocious

 

Answer by t
Submitted on 8/27/2004
Rating: Not yet rated Rate this answer: Vote
supercalifragilistiexpeallydoshis

 

Answer by The Boys
Submitted on 9/6/2004
Rating: Not yet rated Rate this answer: Vote
methylchloroisothiazolinone

 

Answer by Boo wacka poo
Submitted on 9/9/2004
Rating: Not yet rated Rate this answer: Vote
interaloctobalvolcanicrockfortiyinginsisionablitityas-is

 

Answer by deepai
Submitted on 9/10/2004
Rating: Not yet rated Rate this answer: Vote
frfgyrhgtfdrddh

 

Answer by dude
Submitted on 9/12/2004
Rating: Not yet rated Rate this answer: Vote
thisisabigarsewordandyouareallabunchofstupidknobs

 

Answer by P4N7YH0
Submitted on 9/16/2004
Rating: Not yet rated Rate this answer: Vote
ur all gay

 

Answer by kiesha
Submitted on 9/18/2004
Rating: Not yet rated Rate this answer: Vote
ha ha karl...

 

Answer by frankfert
Submitted on 9/23/2004
Rating: Not yet rated Rate this answer: Vote
propseudocontraneoantidisestablishmentarianistically

 

Answer by prabhu
Submitted on 9/26/2004
Rating: Not yet rated Rate this answer: Vote
Hippopotomonstrosesquippedaliophobia

 

Answer by saved by grace
Submitted on 9/26/2004
Rating: Not yet rated Rate this answer: Vote
pneumononoultramicroscopicsilicovolcanoconiosis
(i can pronounce it too!)

 

Answer by JoeMoeBo
Submitted on 9/27/2004
Rating: Not yet rated Rate this answer: Vote
Shteve

 

Answer by billy
Submitted on 9/27/2004
Rating: Not yet rated Rate this answer: Vote
encyclopedia

 

Answer by gene
Submitted on 10/4/2004
Rating: Not yet rated Rate this answer: Vote
ACETYL­SERYL­TYROSYL­SERYL­ISO­LEUCYL­THREONYL­SERYL­PROLYL­SERYL­GLUTAMINYL­PHENYL­ALANYL­VALYL­PHENYL­ALANYL­LEUCYL­SERYL­SERYL­VALYL­TRYPTOPHYL­ALANYL­ASPARTYL­PROLYL­ISOLEUCYL­GLUTAMYL­LEUCYL­LEUCYL­ASPARAGINYL­VALYL­CYSTEINYL­THREONYL­SERYL­SERYL­LEUCYL­GLYCYL­ASPARAGINYL­GLUTAMINYL­PHENYL­ALANYL­GLUTAMINYL­THREONYL­GLUTAMINYL­GLUTAMINYL­ALANYL­ARGINYL­THREONYL­THREONYL­GLUTAMINYL­VALYL­GLUTAMINYL­GLUTAMINYL­PHENYL­ALANYL­SERYL­GLUTAMINYL­VALYL­TRYPTOPHYL­LYSYL­PROLYL­PHENYL­ALANYL­PROLYL­GLUTAMINYL­SERYL­THREONYL­VALYL­ARGINYL­PHENYL­ALANYL­PROLYL­GLYCYL­ASPARTYL­VALYL­TYROSYL­LYSYL­VALYL­TYROSYL­ARGINYL­TYROSYL­ASPARAGINYL­ALANYL­VALYL­LEUCYL­ASPARTYL­PROLYL­LEUCYL­ISOLEUCYL­THREONYL­ALANYL­LEUCYL­LEUCYL­GLYCYL­THREONYL­PHENYL­ALANYL­ASPARTYL­THREONYL­ARGINYL­ASPARAGINYL­ARGINYL­ISOLEUCYL­ISOLEUCYL­GLUTAMYL­VALYL­GLUTAMYL­ASPARAGINYL­GLUTAMINYL­GLUTAMINYL­SERYL­PROLYL­THREONYL­THREONYL­ALANYL­GLUTAMYL­THREONYL­LEUCYL­ASPARTYL­ALANYL­THREONYL­ARGINYL­ARGINYL­VALYL­ASPARTYL­ASPARTYL­ALANYL­THREONYL­VALYL­ALANYL­ISOLEUCYL­ARGINYL­SERYL­ALANYL­ASPARAGINYL­ISOLEUCYL­ASPARAGINYL­LEUCYL­VALYL­ASPARAGINYL­GLUTAMYL­LEUCYL­VALYL­ARGINYL­GLYCYL­THREONYL­GLYCYL­LEUCYL­TYROSYL­ASPARAGINYL­GLUTAMINYL­ASPARAGINYL­THREONYL­PHENYL­ALANYL­GLUTAMYL­SERYL­METHIONYL­SERYL­GLYCYL­LEUCYL­VALYL­TRYPTOPHYL­THREONYL­SERYL­ALANYL­PROLYL­ALANYL­SERINE

 

Answer by apocalypsedemon
Submitted on 10/12/2004
Rating: Not yet rated Rate this answer: Vote
the biggest word in the english language is 1900+ letters long. I am not kidding it is a word for a scientific term that describes a process.

 

Answer by WHOOBIE
Submitted on 10/14/2004
Rating: Not yet rated Rate this answer: Vote
postpneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by jason
Submitted on 10/18/2004
Rating: Not yet rated Rate this answer: Vote
domilliamilliacentsexmilliaoctingentoctotillion

 

Answer by chris mccomas
Submitted on 10/19/2004
Rating: Not yet rated Rate this answer: Vote
kinkaidalertationalismeriezeranarialsubsequentologists

 

Answer by Derek
Submitted on 10/26/2004
Rating: Not yet rated Rate this answer: Vote
Thebiggestwordisnotarealwaorsoburnburnburnpunkface




 

Answer by beeboo
Submitted on 10/30/2004
Rating: Not yet rated Rate this answer: Vote
methylarangitiosisnucleiosmosisoxygeneiousioscalibrachiosisnumericosis

 

Answer by can_we_get_along@hotmail.com
Submitted on 10/30/2004
Rating: Not yet rated Rate this answer: Vote
ACETYL­SERYL­TYROSYL­SERYL­ISO­LEUCYL­THREONYL­SERYL­PROLYL­SERYL­GLUTAMINYL­PHENYL­ALANYL­VALYL­PHENYL­ALANYL­LEUCYL­SERYL­SERYL­VALYL­TRYPTOPHYL­ALANYL­ASPARTYL­PROLYL­ISOLEUCYL­GLUTAMYL­LEUCYL­LEUCYL­ASPARAGINYL­VALYL­CYSTEINYL­THREONYL­SERYL­SERYL­LEUCYL­GLYCYL­ASPARAGINYL­GLUTAMINYL­PHENYL­ALANYL­GLUTAMINYL­THREONYL­GLUTAMINYL­GLUTAMINYL­ALANYL­ARGINYL­THREONYL­THREONYL­GLUTAMINYL­VALYL­GLUTAMINYL­GLUTAMINYL­PHENYL­ALANYL­SERYL­GLUTAMINYL­VALYL­TRYPTOPHYL­LYSYL­PROLYL­PHENYL­ALANYL­PROLYL­GLUTAMINYL­SERYL­THREONYL­VALYL­ARGINYL­PHENYL­ALANYL­PROLYL­GLYCYL­ASPARTYL­VALYL­TYROSYL­LYSYL­VALYL­TYROSYL­ARGINYL­TYROSYL­ASPARAGINYL­ALANYL­VALYL­LEUCYL­ASPARTYL­PROLYL­LEUCYL­ISOLEUCYL­THREONYL­ALANYL­LEUCYL­LEUCYL­GLYCYL­THREONYL­PHENYL­ALANYL­ASPARTYL­THREONYL­ARGINYL­ASPARAGINYL­ARGINYL­ISOLEUCYL­ISOLEUCYL­GLUTAMYL­VALYL­GLUTAMYL­ASPARAGINYL­GLUTAMINYL­GLUTAMINYL­SERYL­PROLYL­THREONYL­THREONYL­ALANYL­GLUTAMYL­THREONYL­LEUCYL­ASPARTYL­ALANYL­THREONYL­ARGINYL­ARGINYL­VALYL­ASPARTYL­ASPARTYL­ALANYL­THREONYL­VALYL­ALANYL­ISOLEUCYL­ARGINYL­SERYL­ALANYL­ASPARAGINYL­ISOLEUCYL­ASPARAGINYL­LEUCYL­VALYL­ASPARAGINYL­GLUTAMYL­LEUCYL­VALYL­ARGINYL­GLYCYL­THREONYL­GLYCYL­LEUCYL­TYROSYL­ASPARAGINYL­GLUTAMINYL­ASPARAGINYL­THREONYL­PHENYL­ALANYL­GLUTAMYL­SERYL­METHIONYL­SERYL­GLYCYL­LEUCYL­VALYL­TRYPTOPHYL­THREONYL­SERYL­ALANYL­PROLYL­ALANYL­SERINE

 

Answer by TommyBoi123a@yahoo.com
Submitted on 11/1/2004
Rating: Not yet rated Rate this answer: Vote
LLANFAIRPWLLGWYNGYLLGOGERYCHWYRNDROBWLLLLANTYSILIOGOGOGOCH........it has four "L's" and it is an old English town i believe...if you do a google search it will come up as an AOL.members website with other funny words! :-)

 

Answer by B
Submitted on 11/3/2004
Rating: Not yet rated Rate this answer: Vote
THISWORDISMUCHLONGERTHANTHEOTHERWORDSCUZIHASWAYMORELETTERS

 

Answer by Crazy_in_love
Submitted on 11/3/2004
Rating: Not yet rated Rate this answer: Vote
smile    b/c theres a mile between the begining to end:)

 

Answer by jae
Submitted on 11/8/2004
Rating: Not yet rated Rate this answer: Vote
jakeiscoolismishtitasssomethingspamsapmmmmmlmabhjoasdfoijihavetoomuchtimeonmyhands

 

Answer by Dane
Submitted on 11/8/2004
Rating: Not yet rated Rate this answer: Vote
Polymethacrylamidopropyltrimonium chloride

 

Answer by grayeagle
Submitted on 11/8/2004
Rating: Not yet rated Rate this answer: Vote
as a nurse i am familiar with all of the words that r in the english language that r much longer than antidisestablishmentarianism but they r what u call cheating words because the doctors and sientist couldn't think of a way to break the problem down to a smaller name at the moment and the bigger the name the more important it sounded and more confusing to the patients it gets.
  the bad problem though is it's the nurse that has to explain the illness to the family and break the stupid long name down to a simpler name so they can understand what the doctor is talking about.
this usually is when the name gets smaller because the nurse figures out how to put it into an easier to understand language for civilians then the doctors get the message as what to call it.
but i agree that when it comes to the longest word in the english language should be one that about every one uses the only reason i knew that antidisestablishmentarianism was the longest word in the dictionary was when i was nine years old kids in school got to arguing about it so i looked it up learned to spell it and at that time the second longest word was antidisestadlishmentarian which means someone who is a member of an antidisestablishmentarianism group or supporter of such group or ogoranizisation.

 

Answer by grayeagle
Submitted on 11/8/2004
Rating: Not yet rated Rate this answer: Vote
as a nurse i am familiar with all of the words that r in the english language that r much longer than antidisestablishmentarianism but they r what u call cheating words because the doctors and sientist couldn't think of a way to break the problem down to a smaller name at the moment and the bigger the name the more important it sounded and more confusing to the patients it gets.
  the bad problem though is it's the nurse that has to explain the illness to the family and break the stupid long name down to a simpler name so they can understand what the doctor is talking about.
this usually is when the name gets smaller because the nurse figures out how to put it into an easier to understand language for civilians then the doctors get the message as what to call it.
but i agree that when it comes to the longest word in the english language should be one that about every one uses the only reason i knew that antidisestablishmentarianism was the longest word in the dictionary was when i was nine years old kids in school got to arguing about it so i looked it up learned to spell it and at that time the second longest word was antidisestadlishmentarian which means someone who is a member of an antidisestablishmentarianism group or supporter of such group or ogoranizisation.

 

Answer by g unit
Submitted on 11/10/2004
Rating: Not yet rated Rate this answer: Vote
supercandonomarkonolohisticnanomicrofardestantenoplousinkeriopolistic      thats the biggest word in u.s lang.

 

Answer by ]
Submitted on 11/11/2004
Rating: Not yet rated Rate this answer: Vote
Or maybe smiles, theres a mile between the first and last letter

 

Answer by Jason
Submitted on 11/14/2004
Rating: Not yet rated Rate this answer: Vote
Shown below is a 1,185-letter chemical term for "Tobacco Mosaic Virus, Dahlemense Stain."
ACETYLSERYLTYROSYLSERYLISOLEUCYL-
THREONYLSERYLPROLYLSERYLGLUTAMINYL-
PHENYLALANYLVALYLPHENYLALANYLLEUCYL-
SERYLSERYLVALYLTRYPTOPHYLALANYL-
ASPARTYLPROLYLISOLEUCYLGLUTAMYLLEUCYL-
LEUCYLASPARAGINYLVALYLCYSTEINYL-
THREONYLSERYLSERYLLEUCYLGLYCYL-
ASPARAGINYLGLUTAMINYLPHENYLALANYL-
GLUTAMINYLTHREONYLGLUTAMINYLGLUTAMINYL-
ALANYLARGINYLTHREONYLTHREONYL-
GLUTAMINYLVALYLGLUTAMINYLGLUTAMINYL-
PHENYLALANYLSERYLGLUTAMINYLVALYL-
TRYPTOPHYLLYSYLPROLYLPHENYLALANYL-
PROLYLGLUTAMINYLSERYLTHREONYLVALYL-
ARGINYLPHENYLALANYLPROLYLGLYCYL-
ASPARTYLVALYLTYROSYLLYSYLVALYLTYROSYL-
ARGINYLTYROSYLASPARAGINYLALANYLVALYL-
LEUCYLASPARTYLPROLYLLEUCYLISOLEUCYL-
THREONYLALANYLLEUCYLLEUCYLGLYCYL-
THREONYLPHENYLALANYLASPARTYLTHREONYL-
ARGINYLASPARAGINYLARGINYLISOLEUCYL-
ISOLEUCYLGLUTAMYLVALYLGLUTAMYL-
ASPARAGINYLGLUTAMINYLGLUTAMINYLSERYL-
PROLYLTHREONYLTHREONYLALANYLGLUTAMYL-
THREONYLLEUCYLASPARTYLALANYLTHREONYL-
ARGINYLARGINYLVALYLASPARTYLASPARTYL-
ALANYLTHREONYLVALYLALANYLISOLEUCYL-
ARGINYLSERYLALANYLASPARAGINYLISOLEUCYL-
ASPARAGINYLLEUCYLVALYLASPARAGINYL-
GLUTAMYLLEUCYLVALYLARGINYLGLYCYL-
THREONYLGLYCYLLEUCYLTYROSYLASPARAGINYL-
GLUTAMINYLASPARAGINYLTHREONYL-
PHENYLALANYLGLUTAMYLSERYLMETHIONYL-
SERYLGLYCYLLEUCYLVALYLTRYPTOPHYL-
THREONYLSERYLALANYLPROLYLALANYLSERINE

 

Answer by cheesecake
Submitted on 11/21/2004
Rating: Not yet rated Rate this answer: Vote
polytetrafluoroethylene

 

Answer by cheesecake
Submitted on 11/21/2004
Rating: Not yet rated Rate this answer: Vote
youguysaresostupidifyouthinkthisisarealanswerbecauseitisnotbutitlookslikeitisanditisgonnagetthehighestratingbecauseitisthelongestwordevereventhoughitisntreallyword

 

Answer by crip
Submitted on 11/22/2004
Rating: Not yet rated Rate this answer: Vote
gfhwehgrqwhegroiuawdfguhaufghqkjhwerfquhwfeuihqwkefukqfgkqweuyfgkwefgkrfkwehrgfkwegrfkgerfkhgekfhgweakrufhgwekufghkwegfkqwefghkwhfkwagfkjhagwefkjhgawekjhfgjahwefgajhdfgajhdgjhagsdjhfgaskjhgdfjakhsgdfjhgasdfhjgashjdgfjahsdgfjhasgdjhasgdfhjgsadfjhgfsadhjfjhsdagfjhasdgfhjasdfghjsadgjahsdkfgasjkhgjkhasgkjshgdkhjgasfhjdgfhjasdgfkhjasdgfjkhasgjahsdgfjkhasgdfjkhgaskjdhfgaskjhdgfjashdgfjsahkdgfjakshdgfjakshdfggg

 

Answer by Psycho
Submitted on 11/24/2004
Rating: Not yet rated Rate this answer: Vote
You never said it had to be in the dictionary...

Supercalifragilisticexpealidocious :D

 

Answer by JR
Submitted on 12/2/2004
Rating: Not yet rated Rate this answer: Vote
antidishasimnotdoingthemcosicantbearsed

 

Answer by RObyN * KYlEe
Submitted on 12/4/2004
Rating: Not yet rated Rate this answer: Vote
wethinkyouallarecompletelyabsolutelynerdgeeksidiotssmartypantsloserandwhateveryouwannabecalled

 

Answer by i'm a nerd like you to be doing this
Submitted on 12/7/2004
Rating: Not yet rated Rate this answer: Vote
icantbelievesomeonewouldbesostupidtoactuallyattempttowritethelongestwordandlooklikeadorkjustlikeallofyouwhohavedonethisbeforemereallytheonlyreasonisbecauseimatschoolandhavenolifeanddontfellikedoingwhateveritisyoudoatschoolsogetalifeloserscinosis

 

Answer by Naomi Mikamura
Submitted on 12/10/2004
Rating: Not yet rated Rate this answer: Vote
heyiknowtthebigestworditsthisonecauseitisobviouslynotreal

 

Answer by Fealiks
Submitted on 12/14/2004
Rating: Not yet rated Rate this answer: Vote
heylokkyourallwrongbecauseihavejustpostedthelongestwordbecauseitsobviousasithasthemostlettersyoufools

 

Answer by George W. Bush
Submitted on 12/15/2004
Rating: Not yet rated Rate this answer: Vote
From George Bush's Speech in 2002:
"They Mis-underestematedment Me!"
"They Mis-understanderment Me!"

 

Answer by Greg
Submitted on 12/21/2004
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by Caleb loves Chelsea
Submitted on 12/21/2004
Rating: Not yet rated Rate this answer: Vote
methionylglutaminylarginyltyrosylglutamylserylleuc ylphenylalanylalanyl-
glutaminylleucyllysylglutamylarginyllysylglutamylg lycylalanylphenylalanyl-
valylprolylphenylalanylvalylthreonylleucylglycylas partylprolylglycyl-
isoleucylglutamylglutaminylserylleucyllysylisoleuc ylaspartylthreonylleucyl-
isoleucylglutamylalanylglycylalanylaspartylalanyll eucylglutamylleucyl-
glycylisoleucylprolylphenylalanylserylaspartylprol ylleucylalanylaspartyl-
glycylprolylthreonylisoleucylglutaminylasparaginyl alanylthreonylleucyl-
arginylalanylphenylalanylalanylalanylglycylvalylth reonylprolylalanyl-
glutaminylcysteinylphenylalanylglutamylmethionylle ucylalanylleucyl-
isoleucylarginylglutaminyllysylhistidylprolylthreo nylisoleucylprolyl-
isoleucylglycylleucylleucylmethionyltyrosylalanyla sparaginylleucylvalyl-
phenylalanylasparaginyllysylglycylisoleucylasparty lglutamylphenylalanyl-
tyrosylalanylglutaminylcysteinylglutamyllysylvalyl glycylvalylaspartylseryl-
valylleucylvalylalanylaspartylvalylprolylvalylglut aminylglutamylseryl-
alanylprolylphenylalanylarginylglutaminylalanylala nylleucylarginylhistidyl-
asparaginylvalylalanylprolylisoleucylphenylalanyli soleucylcysteinylprolyl-
prolylaspartylalanylaspartylaspartylaspartylleucyl leucylarginylglutaminyl-
isoleucylalanylseryltyrosylglycylarginylglycyltyro sylthreonyltyrosylleucyl-
leucylserylarginylalanylglycylvalylthreonylglycyla lanylglutamylasparaginyl-
arginylalanylalanylleucylprolylleucylasparaginylhi stidylleucylvalylalanyl-
lysylleucyllysylglutamyltyrosylasparaginylalanylal anylprolylprolylleucyl-
glutaminylglycylphenylalanylglycylisoleucylserylal anylprolylaspartyl-
glutaminylvalyllysylalanylalanylisoleucylaspartyla lanylglycylalanylalanyl-
glycylalanylisoleucylserylglycylserylalanylisoleuc ylvalyllysylisoleucyl-
isoleucylglutamylglutaminylhistidylasparaginylisol eucylglutamylprolyl-
glutamyllysylmethionylleucylalanylalanylleucyllysy lvalylphenylalanylvalyl-
glutaminylprolylmethionyllysylalanylalanylthreonyl arginylserine........it's A protein, an enzyme that has 267 amino acids, and makes a record of 1,909 letters.

 

Answer by quagmire512
Submitted on 12/24/2004
Rating: Not yet rated Rate this answer: Vote
Methionylglutaminylarginyltyrosylglutamylserylleucylphenylalanylalanylglutaminylleucyllysylgl
utamylarginyllysyglutamylgycylalanylphenylalanylvalylprolylphenylalanylvalylthreonylleucylgl
ycylaspartylprolylglycyllisoleucylglutamylglutaminylserylleucyllysylisoleucylaspartylthreonylleu
cylisoleucylglutamylalanylglycylalanylaspartylalanylleucylglutamylleucylglycylisoleucylprolylph
enylalanylserylaspartylprolylleucylalanylaspartylglycylprolylthreonylisoleucylglutaminylaspara
ginylalanylthreonylleucylarginylalanylphenylalanylalanylalanylglycylvalylthreonylprolylalanylgl
utaminylcysteinylphenylalanylglutamylmethionylleucylalanylleucylisoleucylarginylglutaminyllys
ylhistidylprolylthreonylisoleucylprolylisoleucylglycylleucylleucylmethionyltyrosylalanlylasparagi
nylleucylvalylphenylalanylasparaginyllysylglycylisoleucylaspartylglutamylphenylalanyltyrosylal
anylglutaminylcysteinylglutamyllysylvalylglycylvalylaspartylsrylvalylleucylvalylalanylaspartylv
alylprolylvalylglutaminylglutamylserylalanylprolylphenylalanylarginylglutaminylalanylalanylleu
cylarginylhistidylasparaginylvalylalanylprolylisoleucylphenylalanylisoleucylcysteinylprolylprolyl
aspartylalanylaspartylaspartylaspartylleucylleucylarginylglutaminylisoleucylalanylseryltyrosylg
lycylarginylglycyltyrosylthreonyltyrosylleucylleucylserylarginylalanylglycylvalylthreonylglycylal
anylglutamylasparaginylarginylalanylalanylleucylleucyllysylglutamyltyrosylasparaginylalanylal
anylprolylprolylleucylglutaminylglycylphenylalanylglysylisoleucylserylalanylprolylaspartylgluta
minylvalyllysylalanylalanylisoleucylaspartylalanylglycylalanylalanylglycylalanylisoleucylserylgl
ycylserylalanylisoleucylvalyllysylisoleucylisoleucylglutamylglutaminylhistidylasparaginylisoleuc
ylglutamylprolylglutamyllysylmethionylleucylalanylalanylleucyllysylvalylphenylalanylvalylgluta
minylprolylmethionyllysylalanylalanylthreonylarginylserine

 

Answer by donjuan
Submitted on 12/25/2004
Rating: Not yet rated Rate this answer: Vote
Ithinkthiswouldhavetobethelongestwordbecauseihavesurpassedallofyouandyouallcantcomeupwithawordthatsthislongevenifyourlifedependedonit

 

Answer by Sephiroth
Submitted on 12/28/2004
Rating: Not yet rated Rate this answer: Vote
Supercalifragilisticexpialadocious

 

Answer by MArio
Submitted on 1/1/2005
Rating: Not yet rated Rate this answer: Vote
methionylglutaminylarginyltyrosylglutamylserylleucylphenylalanylalanylglutaminylleucyllysylgluamylarginyllysylglutamylglycylalanylphenylalanylvalylprolylphenylalanylvalylthreonylleucylglycylaspartylprolylglycylisoleucylglutamylglutaminylserylleucyllysylisoleucylaspartythreonylleucylisoleucylglutamylalanylglycylalnylaspartylalanylleucylglutamylleucylglycylisoleucylprolylphenylalanylserylaspartylprolylleucylalanylaspartylglycylprolylthreonylisoleucylglutaminylasparaginylalanylthreonylleucylarginylalanylphenylalanylalanylalanylglycylvallthreonylprolylalanylglutaminylcysteinylphenyalanylglutamylmethionylleucylalanylleucylisoleucylarginylglutaminyllysylhistidylprolylthreonylisoleucylprolylisoleucylglycylleucylleucylmethionyltyrosylalanylasparaginylleucylvalylphenylalanylasparaginyllysylglycylisoleucylaspartylglutamylphenylalanyltyrosylalanylglutaminylcysteinylglutamyllysylvalylglycylvalylaspartylserylvalylleucylvalylalanylaspartylvalylprolylvalylglutaminylglutamylserylalanylprolylphenylalanylarginylglutaminyalanylalanylleucylarginylhistidylasparaginylvalylalanylprolylisoleucylphenylalanylisoleucylcysteinylprolylprolylaspartylalanylaspartylaspartylaspartylleucylleucylarginylglutaminylisoleucylalanylseryltyrosylglycylarginylglycyltyrosylthreonyltyrosylleucylleucylserylarginylalanylglycylvalylthreonylglycylalanylglutamylasparaginylarginylalanylalanylleucylprolylleucylasparaginylhistidylleucylvalylalanyllysylleucyllysylglutamyltyrosylasparaginylalanylalanylprolylprolylleucylglutaminylglycylphenylalanylglycylisoleucylserylalanylprolylaspartylglutaminylvalyllysylalanylalanylisoleucylaspartylalanylglycylalanylalanylglycylalanylisoleucylserylglycylserylalanylisoleucylvalyllysylisoleucylisoleucylglutamylglutaminylhistidylasparaginylisoleucylglutamylprolylglutamyllysylmethionylleucylalanylalanylleucyllysylvalylphenylalanylvalylglutaminylprolylmethionyllysylalanylalanylthreonyla rginylserine

 

Answer by MArio
Submitted on 1/1/2005
Rating: Not yet rated Rate this answer: Vote
methionylglutaminylarginyltyrosylglutamylserylleucylphenylalanylalanylglutaminylleucyllysylgluamylarginyllysylglutamylglycylalanylphenylalanylvalylprolylphenylalanylvalylthreonylleucylglycylaspartylprolylglycylisoleucylglutamylglutaminylserylleucyllysylisoleucylaspartythreonylleucylisoleucylglutamylalanylglycylalnylaspartylalanylleucylglutamylleucylglycylisoleucylprolylphenylalanylserylaspartylprolylleucylalanylaspartylglycylprolylthreonylisoleucylglutaminylasparaginylalanylthreonylleucylarginylalanylphenylalanylalanylalanylglycylvallthreonylprolylalanylglutaminylcysteinylphenyalanylglutamylmethionylleucylalanylleucylisoleucylarginylglutaminyllysylhistidylprolylthreonylisoleucylprolylisoleucylglycylleucylleucylmethionyltyrosylalanylasparaginylleucylvalylphenylalanylasparaginyllysylglycylisoleucylaspartylglutamylphenylalanyltyrosylalanylglutaminylcysteinylglutamyllysylvalylglycylvalylaspartylserylvalylleucylvalylalanylaspartylvalylprolylvalylglutaminylglutamylserylalanylprolylphenylalanylarginylglutaminyalanylalanylleucylarginylhistidylasparaginylvalylalanylprolylisoleucylphenylalanylisoleucylcysteinylprolylprolylaspartylalanylaspartylaspartylaspartylleucylleucylarginylglutaminylisoleucylalanylseryltyrosylglycylarginylglycyltyrosylthreonyltyrosylleucylleucylserylarginylalanylglycylvalylthreonylglycylalanylglutamylasparaginylarginylalanylalanylleucylprolylleucylasparaginylhistidylleucylvalylalanyllysylleucyllysylglutamyltyrosylasparaginylalanylalanylprolylprolylleucylglutaminylglycylphenylalanylglycylisoleucylserylalanylprolylaspartylglutaminylvalyllysylalanylalanylisoleucylaspartylalanylglycylalanylalanylglycylalanylisoleucylserylglycylserylalanylisoleucylvalyllysylisoleucylisoleucylglutamylglutaminylhistidylasparaginylisoleucylglutamylprolylglutamyllysylmethionylleucylalanylalanylleucyllysylvalylphenylalanylvalylglutaminylprolylmethionyllysylalanylalanylthreonyla rginylserine

 

Answer by sdgASDgd
Submitted on 1/4/2005
Rating: Not yet rated Rate this answer: Vote
asgdgagsdgasgasgsdgawefhhdfsyyyseeyrqyaeryaadfyyse5wyefghreyqrey3563ytfhdf

 

Answer by Shane
Submitted on 1/12/2005
Rating: Not yet rated Rate this answer: Vote
Hepaticocholangiocholecystentersotomies

 

Answer by WTF mate
Submitted on 1/15/2005
Rating: Not yet rated Rate this answer: Vote
PNEUMONOULTRAMICROSCOPICSILICOVOLCANOCONIOSIS

 

Answer by josh
Submitted on 1/19/2005
Rating: Not yet rated Rate this answer: Vote
methionylglutaminylarginyltyrosylglutamylserylleuc ylphenylalanylalanyl-
glutaminylleucyllysylglutamylarginyllysylglutamylg lycylalanylphenylalanyl-
valylprolylphenylalanylvalylthreonylleucylglycylas partylprolylglycyl-
isoleucylglutamylglutaminylserylleucyllysylisoleuc ylaspartylthreonylleucyl-
isoleucylglutamylalanylglycylalanylaspartylalanyll eucylglutamylleucyl-
glycylisoleucylprolylphenylalanylserylaspartylprol ylleucylalanylaspartyl-
glycylprolylthreonylisoleucylglutaminylasparaginyl alanylthreonylleucyl-
arginylalanylphenylalanylalanylalanylglycylvalylth reonylprolylalanyl-
glutaminylcysteinylphenylalanylglutamylmethionylle ucylalanylleucyl-
isoleucylarginylglutaminyllysylhistidylprolylthreo nylisoleucylprolyl-
isoleucylglycylleucylleucylmethionyltyrosylalanyla sparaginylleucylvalyl-
phenylalanylasparaginyllysylglycylisoleucylasparty lglutamylphenylalanyl-
tyrosylalanylglutaminylcysteinylglutamyllysylvalyl glycylvalylaspartylseryl-
valylleucylvalylalanylaspartylvalylprolylvalylglut aminylglutamylseryl-
alanylprolylphenylalanylarginylglutaminylalanylala nylleucylarginylhistidyl-
asparaginylvalylalanylprolylisoleucylphenylalanyli soleucylcysteinylprolyl-
prolylaspartylalanylaspartylaspartylaspartylleucyl leucylarginylglutaminyl-
isoleucylalanylseryltyrosylglycylarginylglycyltyro sylthreonyltyrosylleucyl-
leucylserylarginylalanylglycylvalylthreonylglycyla lanylglutamylasparaginyl-
arginylalanylalanylleucylprolylleucylasparaginylhi stidylleucylvalylalanyl-
lysylleucyllysylglutamyltyrosylasparaginylalanylal anylprolylprolylleucyl-
glutaminylglycylphenylalanylglycylisoleucylserylal anylprolylaspartyl-
glutaminylvalyllysylalanylalanylisoleucylaspartyla lanylglycylalanylalanyl-
glycylalanylisoleucylserylglycylserylalanylisoleuc ylvalyllysylisoleucyl-
isoleucylglutamylglutaminylhistidylasparaginylisol eucylglutamylprolyl-
glutamyllysylmethionylleucylalanylalanylleucyllysy lvalylphenylalanylvalyl-
glutaminylprolylmethionyllysylalanylalanylthreonyl arginylserine.

 

Answer by josh
Submitted on 1/19/2005
Rating: Not yet rated Rate this answer: Vote
methionylglutaminylarginyltyrosylglutamylserylleuc ylphenylalanylalanyl-
glutaminylleucyllysylglutamylarginyllysylglutamylg lycylalanylphenylalanyl-
valylprolylphenylalanylvalylthreonylleucylglycylas partylprolylglycyl-
isoleucylglutamylglutaminylserylleucyllysylisoleuc ylaspartylthreonylleucyl-
isoleucylglutamylalanylglycylalanylaspartylalanyll eucylglutamylleucyl-
glycylisoleucylprolylphenylalanylserylaspartylprol ylleucylalanylaspartyl-
glycylprolylthreonylisoleucylglutaminylasparaginyl alanylthreonylleucyl-
arginylalanylphenylalanylalanylalanylglycylvalylth reonylprolylalanyl-
glutaminylcysteinylphenylalanylglutamylmethionylle ucylalanylleucyl-
isoleucylarginylglutaminyllysylhistidylprolylthreo nylisoleucylprolyl-
isoleucylglycylleucylleucylmethionyltyrosylalanyla sparaginylleucylvalyl-
phenylalanylasparaginyllysylglycylisoleucylasparty lglutamylphenylalanyl-
tyrosylalanylglutaminylcysteinylglutamyllysylvalyl glycylvalylaspartylseryl-
valylleucylvalylalanylaspartylvalylprolylvalylglut aminylglutamylseryl-
alanylprolylphenylalanylarginylglutaminylalanylala nylleucylarginylhistidyl-
asparaginylvalylalanylprolylisoleucylphenylalanyli soleucylcysteinylprolyl-
prolylaspartylalanylaspartylaspartylaspartylleucyl leucylarginylglutaminyl-
isoleucylalanylseryltyrosylglycylarginylglycyltyro sylthreonyltyrosylleucyl-
leucylserylarginylalanylglycylvalylthreonylglycyla lanylglutamylasparaginyl-
arginylalanylalanylleucylprolylleucylasparaginylhi stidylleucylvalylalanyl-
lysylleucyllysylglutamyltyrosylasparaginylalanylal anylprolylprolylleucyl-
glutaminylglycylphenylalanylglycylisoleucylserylal anylprolylaspartyl-
glutaminylvalyllysylalanylalanylisoleucylaspartyla lanylglycylalanylalanyl-
glycylalanylisoleucylserylglycylserylalanylisoleuc ylvalyllysylisoleucyl-
isoleucylglutamylglutaminylhistidylasparaginylisol eucylglutamylprolyl-
glutamyllysylmethionylleucylalanylalanylleucyllysy lvalylphenylalanylvalyl-
glutaminylprolylmethionyllysylalanylalanylthreonyl arginylserine.

 

Answer by vjkumar007
Submitted on 1/19/2005
Rating: Not yet rated Rate this answer: Vote
supercalifragilistishmentariamistically

 

Answer by Cronin
Submitted on 1/31/2005
Rating: Not yet rated Rate this answer: Vote
Tryptophan synthetase A protein, an enzyme that has 267 amino acids, and makes a record of 1,909 letters. The chemical notation is C1289 H2051N343O375S8. As ya can see, it's very big. It's name is . . . :

methionylglutaminylarginyltyrosylglutamylserylleuc ylphenylalanylalanyl-
glutaminylleucyllysylglutamylarginyllysylglutamylg lycylalanylphenylalanyl-
valylprolylphenylalanylvalylthreonylleucylglycylas partylprolylglycyl-
isoleucylglutamylglutaminylserylleucyllysylisoleuc ylaspartylthreonylleucyl-
isoleucylglutamylalanylglycylalanylaspartylalanyll eucylglutamylleucyl-
glycylisoleucylprolylphenylalanylserylaspartylprol ylleucylalanylaspartyl-
glycylprolylthreonylisoleucylglutaminylasparaginyl alanylthreonylleucyl-
arginylalanylphenylalanylalanylalanylglycylvalylth reonylprolylalanyl-
glutaminylcysteinylphenylalanylglutamylmethionylle ucylalanylleucyl-
isoleucylarginylglutaminyllysylhistidylprolylthreo nylisoleucylprolyl-
isoleucylglycylleucylleucylmethionyltyrosylalanyla sparaginylleucylvalyl-
phenylalanylasparaginyllysylglycylisoleucylasparty lglutamylphenylalanyl-
tyrosylalanylglutaminylcysteinylglutamyllysylvalyl glycylvalylaspartylseryl-
valylleucylvalylalanylaspartylvalylprolylvalylglut aminylglutamylseryl-
alanylprolylphenylalanylarginylglutaminylalanylala nylleucylarginylhistidyl-
asparaginylvalylalanylprolylisoleucylphenylalanyli soleucylcysteinylprolyl-
prolylaspartylalanylaspartylaspartylaspartylleucyl leucylarginylglutaminyl-
isoleucylalanylseryltyrosylglycylarginylglycyltyro sylthreonyltyrosylleucyl-
leucylserylarginylalanylglycylvalylthreonylglycyla lanylglutamylasparaginyl-
arginylalanylalanylleucylprolylleucylasparaginylhi stidylleucylvalylalanyl-
lysylleucyllysylglutamyltyrosylasparaginylalanylal anylprolylprolylleucyl-
glutaminylglycylphenylalanylglycylisoleucylserylal anylprolylaspartyl-
glutaminylvalyllysylalanylalanylisoleucylaspartyla lanylglycylalanylalanyl-
glycylalanylisoleucylserylglycylserylalanylisoleuc ylvalyllysylisoleucyl-
isoleucylglutamylglutaminylhistidylasparaginylisol eucylglutamylprolyl-
glutamyllysylmethionylleucylalanylalanylleucyllysy lvalylphenylalanylvalyl-
glutaminylprolylmethionyllysylalanylalanylthreonyl arginylserine.

 

Answer by brownturdz
Submitted on 2/3/2005
Rating: Not yet rated Rate this answer: Vote
supersciliousactobibliousundularatiousantimeriamism

 

Answer by ho fung poo
Submitted on 2/4/2005
Rating: Not yet rated Rate this answer: Vote
antidisestablishmentarianismpneumonoultramicroscopeicsilicovolcanoconiosisHippopotomonstrosesquippedaliophobiathsiisthelongetswordbecauseithasthemostlettersinis

 

Answer by boyuan
Submitted on 2/5/2005
Rating: Not yet rated Rate this answer: Vote
methionylglutaminylarginyltyrosylglutamylserylleuc ylphenylalanylalanylglutaminylleucyllysylglutamyla rginyllysylglutamylglycylalanylphenylalanylvalylpr olylphenylalanylvalylthreonylleucylglycylaspartylp rolylglycylisoleucylglutamylglutaminylserylleucyll ysylisoleucylaspartylthreonylleucylisoleucylglutam ylalanylglycylalanylaspartylalanylleucylglutamylle ucylglycylisoleucylprolylphenylalanylserylaspartyl prolylleucylalanylaspartylglycylprolylthreonylisol eucylglutaminylasparaginylalanylthreonylleucylargi nylalanylphenylalanylalanylalanylglycylvalylthreon ylprolylalanylglutaminylcysteinylphenylalanylgluta mylmethionylleucylalanylleucylisoleucylarginylglut aminyllysylhistidylprolylthreonylisoleucylprolylis oleucylglycylleucylleucylmethionyltyrosylalanylasp araginylleucylvalylphenylalanylasparaginyllysylgly cylisoleucylaspartylglutamylphenylalanyltyrosylala nylglutaminylcysteinylglutamyllysylvalylglycylvaly laspartylserylvalylleucylvalylalanylaspartylvalylp rolylvalylglutaminylglutamylserylalanylprolylpheny lalanylarginylglutaminyalanylalanylleucylarginylhi stidylasparaginylvalylalanylprolylisoleucylphenyla lanylisoleucylcysteinylprolylprolylaspartylalanyla spartylaspartylaspartylleucylleucylarginylglutamin ylisoleucylalanylseryltyrosylglycylarginylglycylty rosylthreonyltyrosylleucylleucylserylarginylalanyl glycylvalylthreonylglycylalanylglutamylasparaginyl arginylalanylalanylleucylprolylleucylasparaginylhi stidylleucylvalylalanyllysylleucyllysylglutamyltyr osylasparaginylalanylalanylprolylprolylleucylgluta minylglycylphenylalanylglycylisoleucylserylalanylp rolylaspartylglutaminylvalyllysylalanylalanylisole ucylaspartylalanylglycylalanylalanylglycylalanylis oleucylserylglycylserylalanylisoleucylvalyllysylis oleucylisoleucylglutamylglutaminylhistidylasparagi nylisoleucylglutamylprolylglutamyllysylmethionylle ucylalanylalanylleucyllysylvalylphenylalanylvalylg lutaminylprolylmethionyllysylalanylalanylthreonyla rginylserine

 

Answer by The Zombie
Submitted on 2/7/2005
Rating: Not yet rated Rate this answer: Vote
thisislongerthanthelongestmutantguineapigandthebiggestbrainputtogether

 

Answer by mickaroodle
Submitted on 2/7/2005
Rating: Not yet rated Rate this answer: Vote
antidisestablishmentarianism

 

Answer by sammo
Submitted on 2/14/2005
Rating: Not yet rated Rate this answer: Vote
supercalafragelisticexpealidocious

 

Answer by sammo
Submitted on 2/14/2005
Rating: Not yet rated Rate this answer: Vote
oddparentsfairlyoddparentswandandwigsandcrownsandthingsoddparentsfairlyoddparentswhatwouldudoifuhadfairlyoddpairents

 

Answer by bob
Submitted on 2/15/2005
Rating: Not yet rated Rate this answer: Vote
thefijhfhgfgdfgdsspsgfgghsf9gage9dfggfdrfufdieicbnvndcifjvjtivdoifivjdiicfidsfdhhgkljklhgdjukhk,jghgjkkdggfgjygsdhtyjdgtjtyhdsfdfhj7IE

 

Answer by ritzbitz
Submitted on 2/15/2005
Rating: Not yet rated Rate this answer: Vote
supercalafrgalistticspeladoscious

 

Answer by Lee
Submitted on 2/17/2005
Rating: Not yet rated Rate this answer: Vote
l;h;sdfnvsdjf;sdbjfjsdbfasblbh

 

Answer by sammo
Submitted on 2/18/2005
Rating: Not yet rated Rate this answer: Vote
ahhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh

 

Answer by SAMMO
Submitted on 2/18/2005
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosisisthebiggestword


 

Answer by SAMMO
Submitted on 2/20/2005
Rating: Not yet rated Rate this answer: Vote
AAAAAAAAAAAAAAAAAAAAAHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH

 

Answer by moo moo
Submitted on 2/23/2005
Rating: Not yet rated Rate this answer: Vote
supercalafragalisticexpeelaladossish

 

Answer by james
Submitted on 2/23/2005
Rating: Not yet rated Rate this answer: Vote
neumoniapotasichloritlymonophitsiseministiculmakononophite

 

Answer by asderferasssderferas
Submitted on 2/24/2005
Rating: Not yet rated Rate this answer: Vote
there is no answer. chemical names, which are still expanding, can hav millions of letters in them.

therefore, diseases and chemicals and the like shouldn't really count.

antidisestablishmentarianism is ok, but i think that pnueo thing is a disease or disorder or the like.

biggest one i know is:
flouccinaucinihilipilification
looks small cuz theres so many i's and l's, which r thin

 

Answer by supremeworderman
Submitted on 2/24/2005
Rating: Not yet rated Rate this answer: Vote
ANTIDISESTABLISHMENTARIANISM IS A LOT BIGGER THAN FLOCCINAUCINIHILIPILIFICATION!!!

 

Answer by Hottie
Submitted on 2/24/2005
Rating: Not yet rated Rate this answer: Vote
Loveislikeaflowerthatyouseeeveryhourandifyouhavealoverthenyouweredefinitelymeantforeachotherandifyoukissthemthenyoureallylovethem

 

Answer by Shawnte
Submitted on 2/24/2005
Rating: Not yet rated Rate this answer: Vote
einszweidreivierfunfsechssiebenachtneunzehnelfzwolfdreizehnvierzehnfunfzehnsechszehnziebzehnachtzehnneunzehnzwanzigeinundzwanzigzweiundzwanzigdreiundzwanzigvierundzwanzigfunfundzwanzigsechsundzwanzigsiebenundzwanzigachtundzwanzigneunundzwanzigdreissigeinunddreizigzweiunddreizzigvierunddreissigvierunddreizzigvierunddreizzigfunfunddreizzigsechsunddreizzigsiebenunddreissigachtunddreissigneununddreissigvierzigeinundvierzigzweiundvierzigdreiundvierzigvierundvierzigfunfundvierzigsechsundvierzigsiebenundvierzigachtundvierzigneunundvierzigfunfzigeinundfunfzigzweiundfunfzigdreiundfunfzigvierundfunfzigfunfundfunfzigsechsundfunfzigsiebenundfunfzigachtundfunfzigneunundfunfzigsechzigeinundsechzigzweiundsechzigdreiundsechzigvierundsechzig

 

Answer by sam
Submitted on 3/1/2005
Rating: Not yet rated Rate this answer: Vote
Antidisestablishmentarianisim
Hippopotomonstrosesquippedaliophobia

 

Answer by sam
Submitted on 3/1/2005
Rating: Not yet rated Rate this answer: Vote
Antidisestablishmentarianisim
Hippopotomonstrosesquippedaliophobia

 

Answer by jlorde34
Submitted on 3/10/2005
Rating: Not yet rated Rate this answer: Vote
Antihippopotomonstrosesquippedaliophobia

 

Answer by scientist
Submitted on 3/11/2005
Rating: Not yet rated Rate this answer: Vote
thelongestwordisthiswordbecauseitypedabunchoflettersanddidnothitthespacebarhahaiwinnowyouunscientificpeople

 

Answer by Natasha
Submitted on 3/19/2005
Rating: Not yet rated Rate this answer: Vote
youarethegayestpersonintheuniversebecauseitssadthatyouwouldlookupsomecraplikethis!

 

Answer by Nickname
Submitted on 3/21/2005
Rating: Not yet rated Rate this answer: Vote
Floccinaucinihilipilification

 

Answer by itzy bitxy
Submitted on 3/22/2005
Rating: Not yet rated Rate this answer: Vote
nothisisthelongestwordintheenglishdictionarybecauseitsreallylong

 

Answer by BIg d
Submitted on 3/25/2005
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosisphotopeutrothisithishipatthetireplacebecauseidunne

 

Answer by joe
Submitted on 3/25/2005
Rating: Not yet rated Rate this answer: Vote
nnnnnnnnnnnnnntgderrtgfgfgfgf

 

Answer by sfgsg
Submitted on 3/25/2005
Rating: Not yet rated Rate this answer: Vote
Zealotrytotalitarianaquaticdeprivationantidisestablishmentarianism

 

Answer by Hope Lindemann
Submitted on 3/27/2005
Rating: Not yet rated Rate this answer: Vote
antidisastablishmentarianism

 

Answer by Rob
Submitted on 3/27/2005
Rating: Not yet rated Rate this answer: Vote
Methylchloroisothiazolinone

 

Answer by fred
Submitted on 3/31/2005
Rating: Not yet rated Rate this answer: Vote
methionylglutaminylarginyltyrosylglutamylserylleucylphenylalanylalanylglutaminylleucyllysylglutamylarginyllysylglutamylglycylalanylphenylalanylvalylprolylphenylalanylvalylthreonylleucylglycylaspartylprolylglycylisoleucylglutamylglutaminylserylleucyllysylisoleucylaspartylthreonylleucylisoleucylglutamylalanylglycylalanylaspartylalanylleucylglutamylleucylglycylisoleucylprolylphenyl alanylserylaspartylprolylleucylalanylaspartylglycylprolylthreonylisoleucylglutaminylasparaginylalanylthreonylleucylarginylalanylphenylalanylalanylalanylglycylvalylthreonylprolylalanylglutaminylcysteinylphenylalanylglutamylmethionylleucylalanylleucylisoleucylarginylglutaminyllysylhistidylprolylthreonylisoleucylprolylisoleucylglycylleucylleucylmethionyltyrosylalanylasparaginylleucylvalylphenylalanylasparaginyllysylglycylisoleucylaspartylglutamylphenylalanyltyrosylalanylglutaminylcysteinylglutamyllysylvalylglycylvalylaspartylserylvalylleucylvalylalanylaspartylvalylprolylvalylglutaminylglutamylserylalanylprolylphenylalanylarginylglutaminylalanylalanylleucylarginylhistidylasparaginylvalylalanylprolylisoleucylphenylalanylisoleucylcysteinylprolylprolylaspartylalanylaspartylaspartylaspartylleucylleucylarginylglutaminylisoleucylalanylseryltyrosylglycylarginylglycyltyrosylthreonyltyrosylleucylleucylserylarginylalanylglycylvalylthreonylglycylalanylglutamylasparaginylarginylalanylalanylleucylprolylleucylasparaginylhistidylleucylvalylalanyllysylleucyllysylglutamyltyrosylasparaginylalanylalanylprolylprolylleucylglutaminylglycylphenylalanylglycylisoleucylserylalanylprolylaspartylglutaminylvalyllysylalanylalanylisoleucylaspartylalanylglycylalanylalanylglycylalanylisoleucylserylglycylserylalanylisoleucylvalyllysylisoleucylisoleucylglutamylglutaminylhistidylasparaginylisoleucylglutamylprolylglutamyllysylmethionylleucylalanylalanylleucyllysylvalylphenylalanylvalylglutaminylprolylmethionyllysylalanylalanylthreonylarginylserine.    
    That is a chemical name, it has 1913 letters in it.

 

Answer by fred
Submitted on 3/31/2005
Rating: Not yet rated Rate this answer: Vote
methionylglutaminylarginyltyrosylglutamylserylleucylphenylalanylalanylglutaminylleucyllysylglutamylarginyllysylglutamylglycylalanylphenylalanylvalylprolylphenylalanylvalylthreonylleucylglycylaspartylprolylglycylisoleucylglutamylglutaminylserylleucyllysylisoleucylaspartylthreonylleucylisoleucylglutamylalanylglycylalanylaspartylalanylleucylglutamylleucylglycylisoleucylprolylphenylalanylserylaspartylprolylleucylalanylaspartylglycylprolylthreonylisoleucylglutaminylasparaginylalanylthreonylleucylarginylalanylphenylalanylalanylalanylglycylvalylthreonylprolylalanylglutaminylcysteinylphenylalanylglutamylmethionylleucylalanylleucylisoleucylarginylglutaminyllysylhistidylprolylthreonylisoleucylprolylisoleucylglycylleucylleucylmethionyltyrosylalanylasparaginylleucylvalylphenylalanylasparaginyllysylglycylisoleucylaspartylglutamylphenylalanyltyrosylalanylglutaminylcysteinylglutamyllysylvalylglycylvalylaspartylserylvalylleucylvalylalanylaspartylvalylprolylvalylglutaminylglutamylserylalanylprolylphenylalanylarginylglutaminylalanylalanylleucylarginylhistidylasparaginylvalylalanylprolylisoleucylphenylalanylisoleucylcysteinylprolylprolylaspartylalanylaspartylaspartylaspartylleucylleucylarginylglutaminylisoleucylalanylseryltyrosylglycylarginylglycyltyrosylthreonyltyrosylleucylleucylserylarginylalanylglycylvalylthreonylglycylalanylglutamylasparaginylarginylalanylalanylleucylprolylleucylasparaginylhistidylleucylvalylalanyllysylleucyllysylglutamyltyrosylasparaginylalanylalanylprolylprolylleucylglutaminylglycylphenylalanylglycylisoleucylserylalanylprolylaspartylglutaminylvalyllysylalanylalanylisoleucylaspartylalanylglycylalanylalanylglycylalanylisoleucylserylglycylserylalanylisoleucylvalyllysylisoleucylisoleucylglutamylglutaminylhistidylasparaginylisoleucylglutamylprolylglutamyllysylmethionylleucylalanylalanylleucyllysylvalylphenylalanylvalylglutaminylprolylmethionyllysylalanylalanylthreonylarginylserine.                           That is a protein name, it has 1913 letters in it.

 

Answer by im joking
Submitted on 4/2/2005
Rating: Not yet rated Rate this answer: Vote
ithinkthatthewordthatiamtypingisthebiggestonebecauseyoucanreaditveryeasilyandyoucanundersatnditinmanywaysthankyougoodbye

 

Answer by ok_guy
Submitted on 4/3/2005
Rating: Not yet rated Rate this answer: Vote
supercalafragalisticespialadocious

 

Answer by fred (yes, it's me again, this word is slightly longer than the last, 64060 letters)
Submitted on 4/4/2005
Rating: Not yet rated Rate this answer: Vote
Methionylalanylthreonylserylarginylglycylalanylserylarginylcysteinylproly-
larginylaspartylisoleucylalanylasparaginylvalylmethionylglutaminylarginyl-
leucylglutaminylaspartylglutamylglutaminylglutamylisoleucylvalylglutaminy-
llysylarginylthreonylphenylalanylthreonyllysyltryptophylisoleucylasparagi-
nylserylhistidylleucylalanyllysylarginyllysylprolylprolylmethionylvalylva-
lylaspartylaspartylleucylphenylalanylglutamylaspartylmethionyllysylaspart-
ylglycylvalyllysylleucylleucylalanylleucylleucylglutamylvalylleucylserylg-
lycylglutaminyllysylleucylprolylcysteinylglutamylglutaminylglycylarginyla-
rginylmethionyllysylarginylisoleucylhistidylalanylvalylalanylasparaginyli-
soleucylglycylthreonylalanylleucyllysylphenylalanylleucylglutamylglycylar-
ginyllysylisoleucyllysylleucylvalylasparaginylisoleucylasparaginylserylth-
reonylaspartylisoleucylalanylaspartylglycylarginylprolylserylisoleucylval-
ylleucylglycylleucylmethionyltryptophylthreonylisoleucylisoleucylleucylty-
rosylphenylalanylglutaminylisoleucylglutamylglutamylleucylthreonylserylas-
paraginylleucylprolylglutaminylleucylglutaminylserylleucylserylserylseryl-
alanylserylserylvalylaspartylserylisoleucylvalylserylserylglutamylthreony-
lprolylserylprolylprolylseryllysylarginyllysylvalylthreonylthreonyllysyli-
soleucylglutaminylglycylasparaginylalanyllysyllysylalanylleucylleucyllysy-
ltryptophylvalylglutaminyltyrosylthreonylalanylglycyllysylglutaminylthreo-
nylglycylisoleucylglutamylvalyllysylaspartylphenylalanylglycyllysylserylt-
ryptophylarginylserylglycylvalylalanylphenylalanylhistidylserylvalylisole-
ucylhistidylalanylisoleucylarginylprolylglutamylleucylvalylaspartylleucyl-
glutamylthreonylvalyllysylglycylarginylserylasparaginylarginylglutamylasp-
araginylleucylglutamylaspartylalanylphenylalanylthreonylisoleucylalanylgl-
utamylthreonylglutamylleucylglycylisoleucylprolylarginylleucylleucylaspar-
tylprolylglutamylaspartylvalylaspartylvalylaspartyllysylprolylaspartylglu-
tamyllysylserylisoleucylmethionylthreonyltyrosylvalylalanylglutaminylphen-
ylalanylleucyllysylhistidyltyrosylprolylaspartylisoleucylhistidylasparagi-
nylalanylserylthreonylaspartylglycylglutaminylglutamylaspartylaspartylglu-
tamylisoleucylleucylprolylglycylphenylalanylprolylserylphenylalanylalanyl-
asparaginylserylvalylglutaminylasparaginylphenylalanyllysylarginylglutamy-
laspartylarginylvalylisoleucylphenylalanyllysylglutamylmethionyllysylvaly-
ltryptophylisoleucylglutamylglutaminylphenylalanylglutamylarginylaspartyl-
leucylthreonylarginylalanylglutaminylmethionylvalylglutamylserylasparagin-
ylleucylglutaminylaspartyllysyltyrosylglutaminylserylphenylalanyllysylhis-
tidylphenylalanylarginylvalylglutaminyltyrosylglutamylmethionyllysylargin-
yllysylglutaminylisoleucylglutamylhistidylleucylisoleucylglutaminylprolyl-
leucylhistidylarginylaspartylglycyllysylleucylserylleucylaspartylglutamin-
ylalanylleucylvalyllysylglutaminylseryltryptophylaspartylarginylvalylthre-
onylserylarginylleucylphenylalanylaspartyltryptophylhistidylisoleucylglut-
aminylleucylaspartyllysylserylleucylprolylalanylprolylleucylglycylthreony-
lisoleucylglycylalanyltryptophylleucyltyrosylarginylalanylglutamylvalylal-
anylleucylarginylglutamylglutamylisoleucylthreonylvalylglutaminylglutamin-
ylvalylhistidylglutamylglutamylthreonylalanylasparaginylthreonylisoleucyl-
glutaminylarginyllysylleucylglutamylglutaminylhistidyllysylaspartylleucyl-
leucylglutaminylasparaginylthreonylaspartylalanylhistidyllysylarginylalan-
ylphenylalanylhistidylglutamylisoleucyltyrosylarginylthreonylarginylseryl-
valylasparaginylglycylisoleucylprolylvalylprolylprolylaspartylglutaminyll-
eucylglutamylaspartylmethionylalanylglutamylarginylphenylalanylhistidylph-
enylalanylvalylserylserylthreonylserylglutamylleucylhistidylleucylmethion-
yllysylmethionylglutamylphenylalanylleucylglutamylleucyllysyltyrosylargin-
ylleucylleucylserylleucylleucylvalylleucylalanylglutamylseryllysylleucyll-
ysylseryltryptophylisoleucylisoleucyllysyltyrosylglycylarginylarginylglut-
amylserylvalylglutamylglutaminylleucylleucylglutaminylasparaginyltyrosylv-
alylserylphenylalanylisoleucylglutamylasparaginylseryllysylphenylalanylph-
enylalanylglutamylglutaminyltyrosylglutamylvalylthreonyltyrosylglutaminyl-
isoleucylleucyllysylglutaminylthreonylalanylglutamylmethionyltyrosylvalyl-
lysylalanylaspartylglycylserylvalylglutamylglutamylalanylglutamylasparagi-
nylvalylmethionyllysylphenylalanylmethionylasparaginylglutamylthreonylthr-
eonylalanylglutaminyltryptophylarginylasparaginylleucylserylvalylglutamyl-
valylarginylserylvalylarginylserylmethionylleucylglutamylglutamylvalyliso-
leucylserylasparaginyltryptophylaspartylarginyltyrosylglycylasparaginylth-
reonylvalylalanylserylleucylglutaminylalanyltryptophylleucylglutamylaspar-
tylalanylglutamyllysylmethionylleucylasparaginylglutaminylserylglutamylas-
paraginylalanyllysyllysylaspartylphenylalanylphenylalanylarginylasparagin-
ylleucylprolylhistidyltryptophylisoleucylglutaminylglutaminylhistidylthre-
onylalanylmethionylasparaginylaspartylalanylglycylasparaginylphenylalanyl-
leucylisoleucylglutamylthreonylcysteinylaspartylglutamylmethionylvalylser-
ylarginylaspartylleucyllysylglutaminylglutaminylleucylleucylleucylleucyla-
sparaginylglycylarginyltryptophylarginylglutamylleucylphenylalanylmethion-
ylglutamylvalyllysylglutaminyltyrosylalanylglutaminylalanylaspartylglutam-
ylmethionylaspartylarginylmethionyllysyllysylglutamyltyrosylthreonylaspar-
tylcysteinylvalylvalylthreonylleucylserylalanylphenylalanylalanylthreonyl-
glutamylalanylhistidyllysyllysylleucylserylglutamylprolylleucylglutamylva-
lylserylphenylalanylmethionylasparaginylvalyllysylleucylleucylisoleucylgl-
utaminylaspartylleucylglutamylaspartylisoleucylglutamylglutaminylarginylv-
alylprolylvalylmethionylaspartylalanylglutaminyltyrosyllysylisoleucylisol-
eucylthreonyllysylthreonylalanylhistidylleucylisoleucylthreonyllysylgluta-
mylserylprolylglutaminylglutamylglutamylglycyllysylglutamylmethionylpheny-
lalanylalanylthreonylmethionylseryllysylleucyllysylglutamylglutaminylleuc-
ylthreonyllysylvalyllysylglutamylcysteinyltyrosylserylprolylleucylleucylt-
yrosylglutamylserylglutaminylglutaminylleucylleucylisoleucylprolylleucylg-
lutamylglutamylleucylglutamyllysylglutaminylmethionylthreonylserylphenyla-
lanyltyrosylaspartylserylleucylglycyllysylisoleucylasparaginylglutamyliso-
leucylisoleucylthreonylvalylleucylglutamylarginylglutamylalanylglutaminyl-
serylserylalanylleucylphenylalanyllysylglutaminyllysylhistidylglutaminylg-
lutamylleucylleucylalanylcysteinylglutaminylglutamylasparaginylcysteinyll-
ysyllysylthreonylleucylthreonylleucylisoleucylglutamyllysylglycylserylglu-
taminylserylvalylglutaminyllysylphenylalanylvalylthreonylleucylserylaspar-
aginylvalylleucyllysylhistidylphenylalanylaspartylglutaminylthreonylargin-
ylleucylglutaminylarginylglutaminylisoleucylalanylaspartylisoleucylhistid-
ylvalylalanylphenylalanylglutaminylserylmethionylvalyllysyllysylthreonylg-
lycylaspartyltryptophyllysyllysylhistidylvalylglutamylthreonylasparaginyl-
serylarginylleucylmethionyllysyllysylphenylalanylglutamylglutamylserylarg-
inylalanylglutamylleucylglutamyllysylvalylleucylarginylisoleucylalanylglu-
taminylglutamylglycylleucylglutamylglutamyllysylglycylaspartylprolylgluta-
mylglutamylleucylleucylarginylarginylhistidylthreonylglutamylphenylalanyl-
phenylalanylserylglutaminylleucylaspartylglutaminylarginylvalylleucylaspa-
raginylalanylphenylalanylleucyllysylalanylcysteinylaspartylglutamylleucyl-
threonylaspartylisoleucylleucylprolylglutamylglutaminylglutamylglutaminyl-
glutaminylglycylleucylglutaminylglutamylalanylvalylarginyllysylleucylhist-
idyllysylglutaminyltryptophyllysylaspartylleucylglutaminylglycylglutamyla-
lanylprolyltyrosylhistidylleucylleucylhistidylleucyllysylisoleucylasparty-
lvalylglutamyllysylasparaginylarginylphenylalanylleucylalanylserylvalylgl-
utamylglutamylcysteinylarginylthreonylglutamylleucylaspartylarginylglutam-
ylthreonyllysylleucylmethionylprolylglutaminylglutamylglycylserylglutamyl-
lysylisoleucylisoleucyllysylglutamylhistidylarginylvalylphenylalanylpheny-
lalanylserylaspartyllysylglycylprolylhistidylhistidylleucylcysteinylgluta-
myllysylarginylleucylglutaminylleucylisoleucylglutamylglutamylleucylcyste-
inylvalyllysylleucylprolylvalylarginylaspartylprolylvalylarginylaspartylt-
hreonylprolylglycylthreonylcysteinylhistidylvalylthreonylleucyllysylgluta-
mylleucylarginylalanylalanylisoleucylaspartylserylthreonyltyrosylarginyll-
ysylleucylmethionylglutamylaspartylprolylaspartyllysyltryptophyllysylaspa-
rtyltyrosylthreonylserylarginylphenylalanylserylglutamylphenylalanylseryl-
seryltryptophylisoleucylserylthreonylasparaginylglutamylthreonylglutaminy-
lleucyllysylglycylisoleucyllysylglycylglutamylalanylisoleucylaspartylthre-
onylalanylasparaginylhistidylglycylglutamylvalyllysylarginylalanylvalylgl-
utamylglutamylisoleucylarginylasparaginylglycylvalylthreonyllysylarginylg-
lycylglutamylthreonylleucylseryltryptophylleucyllysylserylarginylleucylly-
sylvalylleucylthreonylglutamylvalylserylserylglutamylasparaginylglutamyla-
lanylglutaminyllysylglutaminylglycylaspartylglutamylleucylalanyllysylleuc-
ylserylserylserylphenylalanyllysylalanylleucylvalylthreonylleucylleucylse-
rylglutamylvalylglutamyllysylmethionylleucylserylasparaginylphenylalanylg-
lycylaspartylcysteinylvalylglutaminyltyrosyllysylglutamylisoleucylvalylly-
sylasparaginylserylleucylglutamylglutamylleucylisoleucylserylglycylseryll-
ysylglutamylvalylglutaminylglutamylglutaminylalanylglutamyllysylisoleucyl-
leucylaspartylthreonylglutamylasparaginylleucylphenylalanylglutamylalanyl-
glutaminylglutaminylleucylleucylleucylhistidylhistidylglutaminylglutaminy-
llysylthreonyllysylarginylisoleucylserylalanyllysyllysylarginylaspartylva-
lylglutaminylglutaminylglutaminylisoleucylalanylglutaminylalanylglutaminy-
lglutaminylglycylglutamylglycylglycylleucylprolylaspartylarginylglycylhis-
tidylglutamylglutamylleucylarginyllysylleucylglutamylserylthreonylleucyla-
spartylglycylleucylglutamylarginylserylarginylglutamylarginylglutaminylgl-
utamylarginylarginylisoleucylglutaminylvalylthreonylleucylarginyllysyltry-
ptophylglutamylarginylphenylalanylglutamylthreonylasparaginyllysylglutamy-
lthreonylvalylvalylarginyltyrosylleucylphenylalanylglutaminylthreonylglyc-
ylserylserylhistidylglutamylarginylphenylalanylleucylserylphenylalanylser-
ylserylleucylglutamylserylleucylserylserylglutamylleucylglutamylglutaminy-
lthreonyllysylglutamylphenylalanylseryllysylarginylthreonylglutamylseryli-
soleucylalanylvalylglutaminylalanylglutamylasparaginylleucylvalyllysylglu-
tamylalanylserylglutamylisoleucylprolylleucylglycylprolylglutaminylaspara-
ginyllysylglutaminylleucylleucylglutaminylglutaminylglutaminylalanyllysyl-
serylisoleucyllysylglutamylglutaminylvalyllysyllysylleucylglutamylasparty-
lthreonylleucylglutamylglutamylaspartylisoleucyllysylthreonylmethionylglu-
tamylmethionylvalyllysylthreonyllysyltryptophylaspartylhistidylphenylalan-
ylglycylserylasparaginylphenylalanylglutamylthreonylleucylserylvalyltrypt-
ophylisoleucylthreonylglutamyllysylglutamyllysylglutamylleucylasparaginyl-
alanylleucylglutamylthreonylserylserylserylalanylmethionylaspartylmethion-
ylglutaminylisoleucylserylglutaminylisoleucyllysylvalylthreonylisoleucylg-
lutaminylglutamylisoleucylglutamylseryllysylleucylserylserylisoleucylvaly-
lglycylleucylglutamylglutamylglutamylalanylglutaminylserylphenylalanylala-
nylglutaminylphenylalanylvalylthreonylthreonylglycylglutamylserylalanylar-
ginylisoleucyllysylalanyllysylleucylthreonylglutaminylisoleucylarginylarg-
inyltyrosylglycylglutamylglutamylleucylarginylglutamylhistidylalanylgluta-
minylcysteinylleucylglutamylglycylthreonylisoleucylleucylglycylhistidylle-
ucylserylglutaminylglutaminylglutaminyllysylphenylalanylglutamylglutamyla-
sparaginylleucylarginyllysylisoleucylglutaminylglutaminylserylvalylserylg-
lutamylphenylalanylglutamylaspartyllysylleucylalanylvalylprolylisoleucyll-
ysylisoleucylcysteinylserylserylalanylthreonylglutamylthreonyltyrosyllysy-
lvalylleucylglutaminylglutamylhistidylmethionylaspartylleucylcysteinylglu-
taminylalanylleucylglutamylserylleucylserylserylalanylisoleucylthreonylal-
anylphenylalanylserylalanylserylalanylarginyllysylvalylvalylasparaginylar-
ginylaspartylserylcysteinylvalylglutaminylglutamylalanylalanylalanylleucy-
lglutaminylglutaminylglutaminyltyrosylglutamylaspartylisoleucylleucylargi-
nylarginylalanyllysylglutamylarginylglutaminylthreonylalanylleucylglutamy-
lasparaginylleucylleucylalanylhistidyltryptophylglutaminylarginylleucylgl-
utamyllysylglutamylleucylserylserylphenylalanylleucylthreonyltryptophylle-
ucylglutamylarginylglycylglutamylalanyllysylalanylserylserylprolylglutamy-
lmethionylaspartylisoleucylserylalanylaspartylarginylvalyllysylvalylgluta-
mylglycylglutamylleucylglutaminylleucylisoleucylglutaminylalanylleucylglu-
taminylasparaginylglutamylvalylvalylserylglutaminylalanylserylphenylalany-
ltyrosylseryllysylleucylleucylglutaminylleucyllysylglutamylserylleucylphe-
nylalanylserylvalylalanylseryllysylaspartylaspartylvalyllysylmethionylmet-
hionyllysylleucylhistidylleucylglutamylglutaminylleucylaspartylglutamylar-
ginyltryptophylarginylaspartylleucylprolylglutaminylisoleucylisoleucylasp-
araginyllysylarginylisoleucylasparaginylphenylalanylleucylglutaminylseryl-
valylvalylalanylglutamylhistidylglutaminylglutaminylphenylalanylaspartylg-
lutamylleucylleucylleucylserylphenylalanylserylvalyltryptophylisoleucylly-
sylleucylphenylalanylleucylserylglutamylleucylglutaminylthreonylthreonyls-
erylglutamylisoleucylserylisoleucylmethionylaspartylhistidylglutaminylval-
ylalanylleucylthreonylarginylhistidyllysylaspartylhistidylalanylalanylglu-
tamylvalylglutamylseryllysyllysylglycylglutamylleucylglutaminylserylleucy-
lglutaminylglycylhistidylleucylalanyllysylleucylglycylserylleucylglycylar-
ginylalanylglutamylaspartylleucylhistidylleucylleucylglutaminylglycyllysy-
lalanylglutamylaspartylcysteinylphenylalanylglutaminylleucylphenylalanylg-
lutamylglutamylalanylserylglutaminylvalylvalylglutamylarginylarginylgluta-
minylleucylalanylleucylserylhistidylleucylalanylglutamylphenylalanylleucy-
lglutaminylserylhistidylalanylserylleucylserylglycylisoleucylleucylarginy-
lglutaminylleucylarginylglutaminylthreonylvalylglutamylalanylthreonylaspa-
raginylserylmethionylasparaginyllysylasparaginylglutamylserylaspartylleuc-
ylisoleucylglutamyllysylaspartylleucylasparaginylaspartylalanylleucylglut-
aminylasparaginylalanyllysylalanylleucylglutamylserylalanylalanylvalylser-
ylleucylaspartylglycylisoleucylleucylseryllysylalanylglutaminyltyrosylhis-
tidylleucyllysylisoleucylglycylserylserylglutamylglutaminylarginylthreony-
lserylcysteinylarginylalanylthreonylalanylaspartylglutaminylleucylcystein-
ylglycylglutamylvalylglutamylarginylisoleucylglutaminylasparaginylleucyll-
eucylglycylthreonyllysylglutaminylserylglutamylalanylaspartylalanylleucyl-
alanylvalylleucyllysyllysylalanylphenylalanylglutaminylaspartylglutaminyl-
lysylglutamylglutamylleucylleucyllysylserylisoleucylglutamylaspartylisole-
ucylglutamylglutamylarginylthreonylaspartyllysylglutamylarginylleucyllysy-
lglutamylprolylthreonylarginylglutaminylalanylleucylglutaminylglutaminyla-
rginylleucylarginylvalylphenylalanylasparaginylglutaminylleucylglutamylas-
partylglutamylleucylasparaginylserylhistidylglutamylhistidylglutamylleucy-
lcysteinyltryptophylleucyllysylaspartyllysylalanyllysylglutaminylisoleucy-
lalanylglutaminyllysylaspartylvalylalanylphenylalanylalanylprolylglutamyl-
valylaspartylarginylglutamylisoleucylasparaginylarginylleucylglutamylvaly-
lthreonyltryptophylaspartylaspartylthreonyllysylarginylleucylisoleucylhis-
tidylglutamylasparaginylglutaminylglycylglutaminylcysteinylcysteinylglycy-
lleucylisoleucylaspartylleucylmethionylarginylglutamyltyrosylglutaminylas-
paraginylleucyllysylserylalanylvalylseryllysylvalylleucylglutamylasparagi-
nylalanylserylserylvalylisoleucylvalylthreonylarginylthreonylthreonylisol-
eucyllysylaspartylglutaminylglutamylaspartylleucyllysyltryptophylalanylph-
enylalanylseryllysylhistidylglutamylthreonylalanyllysylasparaginyllysylme-
thionylasparaginyltyrosyllysylglutaminyllysylaspartylleucylaspartylaspara-
ginylphenylalanylthreonylseryllysylglycyllysylhistidylleucylleucylserylgl-
utamylleucyllysyllysylisoleucylhistidylserylserylaspartylphenylalanylsery-
lleucylvalyllysylthreonylaspartylmethionylglutamylserylthreonylvalylaspar-
tyllysyltryptophylleucylaspartylvalylserylglutamyllysylleucylglutamylglut-
amylasparaginylmethionylaspartylarginylleucylarginylvalylserylleucylseryl-
isoleucyltryptophylaspartylaspartylvalylleucylserylthreonylarginylasparty-
lglutamylisoleucylglutamylglycyltryptophylserylasparaginylasparaginylcyst-
einylvalylprolylglutaminylmethionylalanylglutamylasparaginylisoleucylsery-
lasparaginylleucylaspartylasparaginylhistidylleucylarginylalanylglutamylg-
lutamylleucylleucyllysylglutamylphenylalanylglutamylserylglutamylvalyllys-
ylasparaginyllysylalanylleucylarginylleucylglutamylglutamylleucylhistidyl-
seryllysylvalylasparaginylaspartylleucyllysylglutamylleucylthreonyllysyla-
sparaginylleucylglutamylthreonylprolylprolylaspartylleucylglutaminylpheny-
lalanylisoleucylglutamylalanylaspartylleucylmethionylglutaminyllysylleucy-
lglutamylhistidylalanyllysylglutamylisoleucylthreonylglutamylvalylalanyll-
ysylglycylthreonylleucyllysylaspartylphenylalanylthreonylalanylglutaminyl-
serylthreonylglutaminylvalylglutamyllysylphenylalanylisoleucylasparaginyl-
aspartylisoleucylthreonylthreonyltryptophylphenylalanylthreonyllysylvalyl-
glutamylglutamylserylleucylmethionylasparaginylcysteinylalanylglutaminyla-
sparaginylglutamylthreonylcysteinylglutamylalanylleucyllysyllysylvalyllys-
ylaspartylisoleucylglutaminyllysylglutamylleucylglutaminylserylglutaminyl-
glutaminylserylasparaginylisoleucylserylserylthreonylglutaminylglutamylas-
paraginylleucylasparaginylserylleucylcysteinylarginyllysyltyrosylhistidyl-
serylalanylglutamylleucylglutamylserylleucylglycylarginylalanylmethionylt-
hreonylglycylleucylisoleucyllysyllysylhistidylglutamylalanylvalylserylglu-
taminylleucylcysteinylseryllysylthreonylglutaminylalanylserylleucylglutam-
inylglutamylserylleucylglutamyllysylhistidylphenylalanylserylglutamylsery-
lmethionylglutaminylglutamylphenylalanylglutaminylglutamyltryptophylpheny-
lalanylleucylglycylalanyllysylalanylalanylalanyllysylglutamylserylserylas-
partylarginylthreonylglycylaspartylseryllysylvalylleucylglutamylalanyllys-
ylleucylhistidylaspartylleucylglutaminylasparaginylisoleucylleucylasparty-
lserylvalylserylaspartylglycylglutaminylseryllysylleucylaspartylalanylval-
ylthreonylglutaminylglutamylglycylglutaminylthreonylleucyltyrosylalanylhi-
stidylleucylseryllysylglutaminylisoleucylvalylserylserylisoleucylglutamin-
ylglutamylglutaminylisoleucylthreonyllysylalanylasparaginylglutamylglutam-
ylphenylalanylglutaminylalanylphenylalanylleucyllysylglutaminylcysteinyll-
eucyllysylaspartyllysylglutaminylalanylleucylglutaminylaspartylcysteinyla-
lanylserylglutamylleucylglycylserylphenylalanylglutamylaspartylglutaminyl-
histidylarginyllysylleucylasparaginylleucyltryptophylisoleucylhistidylglu-
tamylmethionylglutamylglutamylarginylphenylalanylasparaginylthreonylgluta-
mylasparaginylleucylglycylglutamylseryllysylglutaminylhistidylisoleucylpr-
olylglutamyllysyllysylasparaginylglutamylvalylhistidyllysylvalylglutamylm-
ethionylphenylalanylleucylglycylglutamylleucylleucylalanylalanylarginylgl-
utamylserylleucylaspartyllysylleucylserylglutaminylarginylglycylglutaminy-
lleucylleucylserylglutamylglutamylglycylhistidylglycylalanylglycylglutami-
nylglutamylglycylarginylleucylcysteinylserylglutaminylleucylleucylthreony-
lserylhistidylglutaminylasparaginylleucylleucylarginylmethionylthreonylly-
sylglutamyllysylleucylarginylserylcysteinylglutaminylvalylalanylleucylglu-
taminylglutamylhistidylglutamylalanylleucylglutamylglutamylalanylleucylgl-
utaminylserylmethionyltryptophylphenylalanyltryptophylvalyllysylalanyliso-
leucylglutaminylaspartylarginylleucylalanylcysteinylalanylglutamylserylth-
reonylleucylglycylseryllysylaspartylthreonylleucylglutamyllysylarginylleu-
cylserylglutaminylisoleucylglutaminylaspartylisoleucylleucylleucylmethion-
yllysylglycylglutamylglycylglutamylvalyllysylleucylasparaginylmethionylal-
anylisoleucylglycyllysylglycylglutamylglutaminylalanylleucylarginylseryls-
erylasparaginyllysylglutamylglycylglutaminylarginylvalylisoleucylglutamin-
ylthreonylglutaminylleucylglutamylthreonylleucyllysylglutamylvalyltryptop-
hylalanylaspartylisoleucylmethionylserylserylserylvalylhistidylalanylglut-
aminylserylthreonylleucylglutamylserylvalylisoleucylserylglutaminyltrypto-
phylasparaginylaspartyltyrosylvalylglutamylarginyllysylasparaginylglutami-
nylleucylglutamylglutaminyltryptophylmethionylglutamylserylvalylaspartylg-
lutaminyllysylisoleucylglutamylhistidylprolylleucylglutaminylprolylglutam-
inylprolylglycylleucyllysylglutamyllysylphenylalanylvalylleucylleucylaspa-
rtylhistidylleucylglutaminylserylisoleucylleucylserylglutamylalanylglutam-
ylaspartylhistidylthreonylarginylalanylleucylhistidylarginylleucylisoleuc-
ylalanyllysylserylarginylglutamylleucyltyrosylglutamyllysylthreonylglutam-
ylaspartylglutamylserylphenylalanyllysylaspartylthreonylalanylglutaminylg-
lutamylglutamylleucyllysylthreonylglutaminylphenylalanylasparaginylaspart-
ylisoleucylmethionylthreonylvalylalanyllysylglutamyllysylmethionylarginyl-
lysylvalylglutamylglutamylisoleucylvalyllysylaspartylhistidylleucylmethio-
nyltyrosylleucylaspartylalanylvalylhistidylglutamylphenylalanylthreonylas-
partyltryptophylleucylhistidylserylalanyllysylglutamylglutamylleucylhisti-
dylarginyltryptophylserylaspartylmethionylserylglycylaspartylserylserylal-
anylthreonylglutaminyllysyllysylleucylseryllysylisoleucyllysylglutamylleu-
cylisoleucylaspartylserylarginylglutamylisoleucylglycylalanylserylarginyl-
leucylserylarginylvalylglutamylserylleucylalanylprolylglutamylvalyllysylg-
lutaminylasparaginylthreonylthreonylalanylserylglycylcysteinylglutamylleu-
cylmethionylhistidylthreonylglutamylmethionylglutaminylalanylleucylarginy-
lalanylaspartyltryptophyllysylglutaminyltryptophylglutamylaspartylserylva-
lylphenylalanylglutaminylthreonylglutaminylserylcysteinylleucylglutamylas-
paraginylleucylvalylserylglutaminylmethionylalanylleucylserylglutamylglut-
aminylglutamylphenylalanylserylglycylglutaminylvalylalanylglutaminylleucy-
lglutamylglutaminylalanylleucylglutamylglutaminylphenylalanylserylalanyll-
eucylleucyllysylthreonyltryptophylalanylglutaminylglutaminylleucylthreony-
lleucylleucylglutamylglycyllysylasparaginylthreonylaspartylglutamylglutam-
ylisoleucylvalylglutamylcysteinyltryptophylhistidyllysylglycylglutaminylg-
lutamylisoleucylleucylaspartylalanylleucylglutaminyllysylalanylglutamylpr-
olylarginylthreonylglutamylaspartylleucyllysylserylglutaminylleucylaspara-
ginylglutamylleucylcysteinylarginylphenylalanylserylarginylaspartylleucyl-
serylthreonyltyrosylserylglycyllysylvalylserylglycylleucylisoleucyllysylg-
lutamyltyrosylasparaginylcysteinylleucylcysteinylleucylglutaminylalanylse-
ryllysylglycylcysteinylglutaminylasparaginyllysylglutamylglutaminylisoleu-
cylleucylglutaminylglutaminylarginylphenylalanylarginyllysylalanylphenyla-
lanylarginylaspartylphenylalanylglutaminylglutaminyltryptophylleucylvalyl-
asparaginylalanyllysylisoleucylthreonylthreonylalanyllysylcysteinylphenyl-
alanylaspartylisoleucylprolylglutaminylasparaginylisoleucylserylglutamylv-
alylserylthreonylserylleucylglutaminyllysylisoleucylglutaminylglutamylphe-
nylalanylleucylserylglutamylserylglutamylasparaginylglycylglutaminylhisti-
dyllysylleucylasparaginylmethionylmethionylleucylseryllysylglycylglutamyl-
leucylleucylserylthreonylleucylleucylthreonyllysylglutamyllysylalanyllysy-
lglycylisoleucylglutaminylalanyllysylvalylthreonylalanylalanyllysylglutam-
ylaspartyltryptophyllysylasparaginylphenylalanylhistidylserylasparaginyll-
eucylhistidylglutaminyllysylglutamylserylalanylleucylglutamylasparaginyll-
eucyllysylisoleucylglutaminylmethionyllysylaspartylphenylalanylglutamylva-
lylserylalanylglutamylprolylisoleucylglutaminylaspartyltryptophylleucylse-
ryllysylthreonylglutamyllysylmethionylvalylhistidylglutamylserylserylaspa-
raginylarginylleucyltyrosylaspartylleucylprolylalanyllysylarginylarginylg-
lutamylglutaminylglutaminyllysylleucylglutaminylserylvalylleucylglutamylg-
lutamylisoleucylhistidylcysteinyltyrosylglutamylprolylglutaminylleucylasp-
araginylarginylleucyllysylglutamyllysylalanylglutaminylglutaminylleucyltr-
yptophylglutamylglycylglutaminylalanylalanylseryllysylserylphenylalanylar-
ginylhistidylarginylvalylserylglutaminylleucylserylserylglutaminyltyrosyl-
leucylalanylleucylserylasparaginylleucylthreonyllysylglutamyllysylvalylse-
rylarginylleucylaspartylarginylisoleucylvalylalanylglutamylhistidylaspara-
ginylglutaminylphenylalanylserylleucylglycylisoleucyllysylglutamylleucylg-
lutaminylaspartyltryptophylmethionylthreonylaspartylalanylisoleucylhistid-
ylmethionylleucylaspartylseryltyrosylcysteinylhistidylprolylthreonylseryl-
aspartyllysylserylvalylleucylaspartylserylarginylthreonylleucyllysylleucy-
lglutamylalanylleucylleucylserylvalyllysylglutaminylglutamyllysylglutamyl-
isoleucylglutaminylmethionyllysylmethionylisoleucylvalylthreonylarginylgl-
ycylglutamylserylvalylleucylglutaminylasparaginylthreonylserylprolylgluta-
mylglycylisoleucylprolylthreonylisoleucylglutaminylglutaminylglutaminylle-
ucylglutaminylserylvalyllysylaspartylmethionyltryptophylalanylserylleucyl-
leucylserylalanylglycylisoleucylarginylcysteinyllysylserylglutaminylleucy-
lglutamylglycylalanylleucylseryllysyltryptophylthreonylseryltyrosylglutam-
inylaspartylglycylvalylarginylglutaminylphenylalanylserylglycyltryptophyl-
methionylaspartylserylmethionylglutamylalanylasparaginylleucylasparaginyl-
glutamylserylglutamylarginylglutaminylhistidylalanylglutamylleucylarginyl-
aspartyllysylthreonylthreonylmethionylleucylglycyllysylalanyllysylleucyll-
eucylasparaginylglutamylglutamylvalylleucylseryltyrosylserylserylleucylle-
ucylglutamylthreonylisoleucylglutamylvalyllysylglycylalanylglycylmethiony-
lthreonylglutamylhistidyltyrosylvalylthreonylglutaminylleucylglutamylleuc-
ylglutaminylaspartylleucylglutaminylglutamylarginyltyrosylarginylalanylis-
oleucylglutaminylglutamylarginylalanyllysylglutamylalanylvalylthreonyllys-
ylserylglutamyllysylleucylvalylarginylleucylhistidylglutaminylglutamyltyr-
osylglutaminylarginylaspartylleucyllysylalanylphenylalanylglutamylvalyltr-
yptophylleucylglycylglutaminylglutamylglutaminylglutamyllysylleucylaspart-
ylglutaminyltyrosylserylvalylleucylglutamylglycylaspartylalanylhistidylth-
reonylhistidylglutamylthreonylthreonylleucylarginylaspartylleucylglutamin-
ylglutamylleucylglutaminylvalylhistidylcysteinylalanylglutamylglycylgluta-
minylalanylleucylleucylasparaginylserylvalylleucylhistidylthreonylarginyl-
glutamylaspartylvalylisoleucylprolylserylglycylisoleucylprolylglutaminyla-
lanylglutamylaspartylarginylalanylleucylglutamylserylleucylarginylglutami-
nylaspartyltryptophylglutaminylalanyltyrosylglutaminylhistidylarginylleuc-
ylserylglutamylthreonylarginylthreonylglutaminylphenylalanylasparaginylas-
paraginylvalylvalylasparaginyllysylleucylarginylleucylmethionylglutamylgl-
utaminyllysylphenylalanylglutaminylglutaminylvalylaspartylglutamyltryptop-
hylleucyllysylthreonylalanylglutamylglutamyllysylvalylserylprolylarginylt-
hreonylarginylarginylglutaminylserylasparaginylarginylalanylthreonyllysyl-
glutamylisoleucylglutaminylleucylhistidylglutaminylmethionyllysyllysyltry-
ptophylhistidylglutamylglutamylvalylthreonylalanyltyrosylarginylaspartylg-
lutamylvalylglutamylglutamylvalylglycylalanylarginylalanylglutaminylgluta-
mylisoleucylleucylaspartylglutamylserylhistidylvalylasparaginylserylargin-
ylmethionylglycylcysteinylglutaminylalanylthreonylglutaminylleucylthreony-
lserylarginyltyrosylglutaminylalanylleucylleucylleucylglutaminylvalylleuc-
ylglutamylglutaminylisoleucyllysylphenylalanylleucylglutamylglutamylgluta-
mylisoleucylglutaminylserylleucylglutamylglutamylserylglutamylserylseryll-
eucylserylseryltyrosylserylaspartyltryptophyltyrosylglycylserylthreonylhi-
stidyllysylasparaginylphenylalanyllysylasparaginylvalylalanylthreonyllysy-
lisoleucylaspartyllysylvalylaspartylthreonylvalylmethionylmethionylglycyl-
lysyllysylleucyllysylthreonylleucylglutamylvalylleucylleucyllysylaspartyl-
methionylglutamyllysylglycylhistidylserylleucylleucyllysylserylalanylargi-
nylglutamyllysylglycylglutamylarginylalanylvalyllysyltyrosylleucylglutamy-
lglutamylglycylglutamylalanylglutamylarginylleucylarginyllysylglutamyliso-
leucylhistidylaspartylhistidylmethionylglutamylglutaminylleucyllysylgluta-
mylleucylthreonylserylthreonylvalylarginyllysylglutamylhistidylmethionylt-
hreonylleucylglutamyllysylglycylleucylhistidylleucylalanyllysylglutamylph-
enylalanylserylaspartyllysylcysteinyllysylalanylleucylthreonylglutaminylt-
ryptophylisoleucylalanylglutamyltyrosylglutaminylglutamylisoleucylleucylh-
istidylvalylprolylglutamylglutamylprolyllysylmethionylglutamylleucyltyros-
ylglutamyllysyllysylalanylglutaminylleucylseryllysyltyrosyllysylserylleuc-
ylglutaminylglutaminylthreonylvalylleucylserylhistidylglutamylprolylseryl-
valyllysylserylvalylarginylglutamyllysylglycylglutamylalanylleucylleucylg-
lutamylleucylvalylglutaminylaspartylvalylthreonylleucyllysylaspartyllysyl-
isoleucylaspartylglutaminylleucylglutaminylserylaspartyltyrosylglutaminyl-
aspartylleucylcysteinylserylisoleucylglycyllysylglutamylhistidylvalylphen-
ylalanylserylleucylglutamylalanyllysylvalyllysylaspartylhistidylglutamyla-
spartyltyrosylasparaginylserylglutamylleucylglutaminylglutamylvalylglutam-
yllysyltryptophylleucylleucylglutaminylmethionylserylglycylarginylleucylv-
alylalanylprolylaspartylleucylleucylglutamylthreonylserylserylleucylgluta-
mylthreonylisoleucylthreonylglutaminylglutaminylleucylalanylhistidylhisti-
dyllysylalanylmethionylmethionylglutamylglutamylisoleucylalanylglycylphen-
ylalanylglutamylaspartylarginylleucylasparaginylasparaginylleucylglutamin-
ylmethionyllysylglycylaspartylthreonylleucylisoleucylglycylglutaminylcyst-
einylalanylaspartylhistidylleucylglutaminylalanyllysylleucyllysylglutamin-
ylasparaginylvalylhistidylalanylhistidylleucylglutaminylglycylthreonyllys-
ylaspartylseryltyrosylserylalanylisoleucylcysteinylserylthreonylalanylglu-
taminylarginylmethionyltyrosylglutaminylserylleucylglutamylhistidylglutam-
ylleucylglutaminyllysylhistidylvalylserylarginylglutaminylaspartylthreony-
lleucylglutaminylglutaminylcysteinylglutaminylalanyltryptophylleucylseryl-
alanylvalylglutaminylprolylaspartylleucylglutamylprolylserylprolylglutami-
nylprolylprolylleucylserylarginylalanylglutamylalanylisoleucyllysylglutam-
inylvalyllysylhistidylphenylalanylarginylalanylleucylglutaminylglutamylgl-
utaminylalanylarginylthreonyltyrosylleucylaspartylleucylleucylcysteinylse-
rylmethionylcysteinylaspartylleucylserylasparaginylalanylserylvalyllysylt-
hreonylthreonylalanyllysylaspartylisoleucylglutaminylglutaminylthreonylgl-
utamylglutaminylthreonylisoleucylglutamylglutaminyllysylleucylvalylglutam-
inylalanylglutaminylasparaginylleucylthreonylglutaminylglycyltryptophylgl-
utamylglutamylisoleucyllysylhistidylleucyllysylserylglutamylleucyltryptop-
hylisoleucyltyrosylleucylglutaminylaspartylalanylaspartylglutaminylglutam-
inylleucylglutaminylasparaginylmethionyllysylarginylarginylhistidylserylg-
lutamylleucylglutamylleucylasparaginylisoleucylalanylglutaminylasparaginy-
lmethionylvalylserylglutaminylvalyllysylaspartylphenylalanylvalyllysyllys-
ylleucylglutaminylseryllysylglutaminylalanylserylvalylasparaginylthreonyl-
isoleucylisoleucylglutamyllysylvalylasparaginyllysylleucylthreonyllysylly-
sylglutamylglutamylserylprolylglutamylhistidyllysylglutamylisoleucylaspar-
aginylhistidylleucylasparaginylaspartylglutaminyltryptophylleucylaspartyl-
leucylcysteinylarginylglutaminylserylasparaginylasparaginylleucylcysteiny-
lleucylglutaminylarginylglutamylglutamylaspartylleucylglutaminylarginylth-
reonylarginylaspartyltyrosylhistidylaspartylcysteinylmethionylasparaginyl-
valylvalylglutamylvalylphenylalanylleucylglutamyllysylphenylalanylthreony-
lthreonylglutamyltryptophylaspartylasparaginylleucylalanylarginylserylasp-
artylalanylglutamylserylthreonylalanylvalylhistidylleucylglutamylalanylle-
ucyllysyllysylleucylalanylleucylalanylleucylglutaminylglutamylarginyllysy-
ltyrosylalanylisoleucylglutamylaspartylleucyllysylaspartylglutaminyllysyl-
glutaminyllysylmethionylisoleucylglutamylhistidylleucylasparaginylleucyla-
spartylaspartyllysylglutamylleucylvalyllysylglutamylglutaminylthreonylser-
ylhistidylleucylglutamylglutaminylarginyltryptophylphenylalanylglutaminyl-
leucylglutamylaspartylleucylisoleucyllysylarginyllysylisoleucylglutaminyl-
valylserylvalylthreonylasparaginylleucylglutamylglutamylleucylasparaginyl-
valylvalylglutaminylserylarginylphenylalanylglutaminylglutamylleucylmethi-
onylglutamyltryptophylalanylglutamylglutamylglutaminylglutaminylprolylasp-
araginylisoleucylalanylglutamylalanylleucyllysylglutaminylserylprolylprol-
ylprolylaspartylmethionylalanylglutaminylasparaginylleucylleucylmethionyl-
aspartylhistidylleucylalanylisoleucylcysteinylserylglutamylleucylglutamyl-
alanyllysylglutaminylmethionylleucylleucyllysylserylleucylisoleucyllysyla-
spartylalanylaspartylarginylvalylmethionylalanylaspartylleucylglycylleucy-
lasparaginylglutamylarginylglutaminylvalylisoleucylglutaminyllysylalanyll-
eucylserylaspartylalanylglutaminylserylhistidylvalylasparaginylcysteinyll-
eucylserylaspartylleucylvalylglycylglutaminylarginylarginyllysyltyrosylle-
ucylasparaginyllysylalanylleucylserylglutamyllysylthreonylglutaminylpheny-
lalanylleucylmethionylalanylvalylphenylalanylglutaminylalanylthreonylsery-
lglutaminylisoleucylglutaminylglutaminylhistidylglutamylarginyllysylisole-
ucylmethionylphenylalanylarginylglutamylhistidylisoleucylcysteinylleucyll-
eucylprolylaspartylaspartylvalylseryllysylglutaminylvalyllysylthreonylcys-
teinyllysylserylalanylglutaminylalanylserylleucyllysylthreonyltyrosylglut-
aminylasparaginylglutamylvalylthreonylglycylleucyltryptophylalanylglutami-
nylglycylarginylglutamylleucylmethionyllysylglutamylvalylthreonylglutamyl-
glutaminylglutamyllysylserylglutamylvalylleucylglycyllysylleucylglutaminy-
lglutamylleucylglutaminylserylvalyltyrosylaspartylserylvalylleucylglutami-
nyllysylcysteinylserylhistidylarginylleucylglutaminylglutamylleucylglutam-
yllysylasparaginylleucylvalylserylarginyllysylhistidylphenylalanyllysylgl-
utamylaspartylphenylalanylaspartyllysylalanylcysteinylhistidyltryptophyll-
eucyllysylglutaminylalanylaspartylisoleucylvalylthreonylphenylalanylproly-
lglutamylisoleucylasparaginylleucylmethionylasparaginylglutamylserylseryl-
glutamylleucylhistidylthreonylglutaminylleucylalanyllysyltyrosylglutaminy-
lasparaginylisoleucylleucylglutamylglutaminylserylprolylglutamyltyrosylgl-
utamylasparaginylleucylleucylleucylthreonylleucylglutaminylarginylthreony-
lglycylglutaminylthreonylisoleucylleucylprolylserylleucylasparaginylgluta-
mylvalylaspartylhistidylseryltyrosylleucylserylglutamyllysylleucylasparag-
inylalanylleucylprolylarginylglutaminylphenylalanylasparaginylvalylisoleu-
cylvalylalanylleucylalanyllysylaspartyllysylphenylalanyltyrosyllysylvalyl-
glutaminylglutamylalanylisoleucylleucylalanylarginyllysylglutamyltyrosyla-
lanylserylleucylisoleucylglutamylleucylthreonylthreonylglutaminylserylleu-
cylserylglutamylleucylglutamylalanylglutaminylphenylalanylleucylarginylme-
thionylseryllysylvalylprolylthreonylaspartylleucylalanylvalylglutamylglut-
amylalanylleucylserylleucylglutaminylaspartylglycylcysteinylarginylalanyl-
isoleucylleucylaspartylglutamylvalylalanylglycylleucylglycylglutamylalany-
lvalylaspartylglutamylleucylasparaginylglutaminyllysyllysylglutamylglycyl-
phenylalanylarginylserylthreonylglycylglutaminylprolyltryptophylglutaminy-
lprolylaspartyllysylmethionylleucylhistidylleucylvalylthreonylleucyltyros-
ylhistidylarginylleucyllysylarginylglutaminylthreonylglutamylglutaminylar-
ginylvalylserylleucylleucylglutamylaspartylthreonylthreonylserylalanyltyr-
osylglutaminylglutamylhistidylglutamyllysylmethionylcysteinylglutaminylgl-
utaminylleucylglutamylarginylglutaminylleucyllysylserylvalyllysylglutamyl-
glutamylglutaminylseryllysylvalylasparaginylglutamylglutamylthreonylleucy-
lprolylalanylglutamylglutamyllysylleucyllysylmethionyltyrosylhistidylsery-
lleucylalanylglycylserylleucylglutaminylaspartylserylglycylisoleucylvalyl-
leucyllysylarginylvalylthreonylisoleucylhistidylleucylglutamylaspartylleu-
cylalanylprolylhistidylleucylaspartylprolylleucylalanyltyrosylglutamyllys-
ylalanylarginylhistidylglutaminylisoleucylglutaminylseryltryptophylglutam-
inylglycylglutamylleucyllysylleucylleucylthreonylserylalanylisoleucylglyc-
ylglutamylthreonylvalylthreonylglutamylcysteinylglutamylserylarginylmethi-
onylvalylglutaminylserylisoleucylaspartylphenylalanylglutaminylthreonylgl-
utamylmethionylserylarginylserylleucylaspartyltryptophylleucylarginylargi-
nylvalyllysylalanylglutamylleucylserylglycylprolylvalyltyrosylleucylaspar-
tylleucylasparaginylleucylglutaminylaspartylisoleucylglutaminylglutamylgl-
utamylisoleucylarginyllysylisoleucylglutaminylisoleucylhistidylglutaminyl-
glutamylglutamylvalylglutaminylserylserylleucylarginylisoleucylmethionyla-
sparaginylalanylleucylserylhistidyllysylglutamyllysylglutamyllysylphenyla-
lanylthreonyllysylalanyllysylglutamylleucylisoleucylserylalanylaspartylle-
ucylglutamylhistidylserylleucylalanylglutamylleucylserylglutamylleucylasp-
artylglycylaspartylisoleucylglutaminylglutamylalanylleucylarginylthreonyl-
arginylglutaminylalanylthreonylleucylthreonylglutamylisoleucyltyrosylsery-
lglutaminylcysteinylglutaminylarginyltyrosyltyrosylglutaminylvalylphenyla-
lanylglutaminylalanylalanylasparaginylaspartyltryptophylleucylglutamylasp-
artylalanylglutaminylglutamylleucylleucylglutaminylleucylalanylglycylaspa-
raginylglycylleucylaspartylvalylglutamylserylalanylglutamylglutamylaspara-
ginylleucyllysylserylhistidylmethionylglutamylphenylalanylphenylalanylser-
ylthreonylglutamylaspartylglutaminylphenylalanylhistidylserylasparaginyll-
eucylglutamylglutamylleucylhistidylserylleucylvalylalanylthreonylleucylas-
partylprolylleucylisoleucyllysylprolylthreonylglycyllysylglutamylaspartyl-
leucylglutamylglutaminyllysylvalylalanylserylleucylglutamylleucylarginyls-
erylglutaminylarginylmethionylserylarginylaspartylserylglycylalanylglutam-
inylvalylaspartylleucylleucylglutaminylarginylcysteinylthreonylalanylglut-
aminyltryptophylhistidylaspartyltyrosylglutaminyllysylalanylarginylglutam-
ylglutamylvalylisoleucylglutamylleucylmethionylasparaginylaspartylthreony-
lglutamyllysyllysylleucylserylglutamylphenylalanylserylleucylleucyllysylt-
hreonylserylserylserylhistidylglutamylalanylglutamylglutamyllysylleucylse-
rylglutamylhistidyllysylalanylleucylvalylserylvalylvalylasparaginylserylp-
henylalanylhistidylglutamyllysylisoleucylvalylalanylleucylglutamylglutamy-
llysylalanylserylglutaminylleucylglutamyllysylthreonylglycylasparaginylas-
partylalanylseryllysylalanylthreonylleucylserylarginylserylmethionylthreo-
nylthreonylvalyltryptophylglutaminylarginyltryptophylthreonylarginylleucy-
larginylalanylvalylalanylglutaminylaspartylglutaminylglutamyllysylisoleuc-
ylleucylglutamylaspartylalanylvalylaspartylglutamyltryptophylthreonylglyc-
ylphenylalanylasparaginylasparaginyllysylvalyllysyllysylalanylthreonylglu-
tamylmethionylisoleucylaspartylglutaminylleucylglutaminylaspartyllysylleu-
cylprolylglycylserylserylalanylglutamyllysylalanylseryllysylalanylglutamy-
lleucylleucylthreonylleucylleucylglutamyltyrosylhistidylaspartylthreonylp-
henylalanylvalylleucylglutamylleucylglutamylglutaminylglutaminylglutaminy-
lserylalanylleucylglycylmethionylleucylarginylglutaminylglutaminylthreony-
lleucylserylmethionylleucylglutaminylaspartylglycylalanylalanylprolylthre-
onylprolylglycylglutamylglutamylprolylprolylleucylmethionylglutaminylglut-
amylisoleucylthreonylalanylmethionylglutaminylaspartylarginylcysteinylleu-
cylasparaginylmethionylglutaminylglutamyllysylvalyllysylthreonylasparagin-
ylglycyllysylleucylvalyllysylglutaminylglutamylleucyllysylaspartylarginyl-
glutamylmethionylvalylglutamylthreonylglutaminylisoleucylasparaginylseryl-
valyllysylcysteinyltryptophylvalylglutaminylglutamylthreonyllysylglutamyl-
tyrosylleucylglycylasparaginylprolylthreonylisoleucylglutamylisoleucylasp-
artylalanylglutaminylleucylglutamylglutamylleucylglutaminylisoleucylleucy-
lleucylthreonylglutamylalanylthreonylasparaginylhistidylarginylglutaminyl-
asparaginylisoleucylglutamyllysylmethionylalanylglutamylglutamylglutaminy-
llysylglutamyllysyltyrosylleucylglycylleucyltyrosylthreonylisoleucylleucy-
lprolylserylglutamylleucylserylleucylglutaminylleucylalanylglutamylvalyla-
lanylleucylaspartylleucyllysylisoleucylarginylaspartylglutaminylisoleucyl-
glutaminylaspartyllysylisoleucyllysylglutamylvalylglutamylglutaminylseryl-
lysylalanylthreonylserylglutaminylglutamylleucylserylarginylglutaminyliso-
leucylglutaminyllysylleucylalanyllysylaspartylleucylthreonylthreonylisole-
ucylleucylthreonyllysylleucyllysylalanyllysylthreonylaspartylasparaginylv-
alylvalylglutaminylalanyllysylthreonylaspartylglutaminyllysylvalylleucylg-
lycylglutamylglutamylleucylaspartylglycylcysteinylasparaginylseryllysylle-
ucylmethionylglutamylleucylaspartylalanylalanylvalylglutaminyllysylphenyl-
alanylleucylglutamylglutaminylasparaginylglycylglutaminylleucylglycyllysy-
lprolylleucylalanyllysyllysylisoleucylglycyllysylleucylthreonylglutamylle-
ucylhistidylglutaminylglutaminylthreonylisoleucylarginylglutaminylalanylg-
lutamylasparaginylarginylleucylseryllysylleucylasparaginylglutaminylalany-
lalanylserylhistidylleucylglutamylglutamyltyrosylasparaginylglutamylmethi-
onylleucylglutamylleucylisoleucylleucyllysyltryptophylisoleucylglutamylly-
sylalanyllysylvalylleucylalanylhistidylglycylthreonylisoleucylalanyltrypt-
ophylasparaginylserylalanylserylglutaminylleucylarginylglutamylglutaminyl-
tyrosylisoleucylleucylhistidylglutaminylthreonylleucylleucylglutamylgluta-
mylseryllysylglutamylisoleucylaspartylserylglutamylleucylglutamylalanylme-
thionylthreonylglutamyllysylleucylglutaminyltyrosylleucylthreonylserylval-
yltyrosylcysteinylthreonylglutamyllysylmethionylserylglutaminylglutaminyl-
valylalanylglutamylleucylglycylarginylglutamylthreonylglutamylglutamylleu-
cylarginylglutaminylmethionylisoleucyllysylisoleucylarginylleucylglutamin-
ylasparaginylleucylglutaminylaspartylalanylalanyllysylaspartylmethionylly-
syllysylphenylalanylglutamylalanylglutamylleucyllysyllysylleucylglutaminy-
lalanylalanylleucylglutamylglutaminylalanylglutaminylalanylthreonylleucyl-
threonylserylprolylglutamylvalylglycylarginylleucylserylleucyllysylglutam-
ylglutaminylleucylserylhistidylarginylglutaminylhistidylleucylleucylseryl-
glutamylmethionylglutamylserylleucyllysylprolyllysylvalylglutaminylalanyl-
valylglutaminylleucylcysteinylglutaminylserylalanylleucylarginylisoleucyl-
prolylglutamylaspartylvalylvalylalanylserylleucylprolylleucylcysteinylhis-
tidylalanylalanylleucylarginylleucylglutaminylglutamylglutamylalanylseryl-
arginylleucylglutaminylhistidylthreonylalanylisoleucylglutaminylglutaminy-
lcysteinylasparaginylisoleucylmethionylglutaminylalanylalanylvalylvalylgl-
utaminyltyrosylglutamylglutaminyltyrosylglutamylglutaminylglutamylmethion-
yllysylhistidylleucylglutaminylglutaminylleucylisoleucylglutamylglycylala-
nylhistidylarginylglutamylisoleucylglutamylaspartyllysylprolylvalylalanyl-
threonylserylasparaginylisoleucylglutaminylglutamylleucylglutaminylalanyl-
glutaminylisoleucylserylarginylhistidylglutamylglutamylleucylalanylglutam-
inyllysylisoleucyllysylglycyltyrosylglutaminylglutamylglutaminylisoleucyl-
alanylserylleucylasparaginylseryllysylcysteinyllysylmethionylleucylthreon-
ylmethionyllysylalanyllysylhistidylalanylthreonylmethionylleucylleucylthr-
eonylvalylthreonylglutamylvalylglutamylglycylleucylalanylglutamylglycylth-
reonylglutamylaspartylleucylaspartylglycylglutamylleucylleucylprolylthreo-
nylprolylserylalanylhistidylprolylserylvalylvalylmethionylmethionylthreon-
ylalanylglycylarginylcysteinylhistidylthreonylleucylleucylserylprolylvaly-
lthreonylglutamylglutamylserylglycylglutamylglutamylglycylthreonylasparag-
inylserylglutamylisoleucylserylserylprolylprolylalanylcysteinylarginylser-
ylprolylserylprolylvalylalanylasparaginylthreonylaspartylalanylserylvalyl-
asparaginylglutaminylaspartylisoleucylalanyltyrosyltyrosylglutaminylalany-
lleucylserylalanylglutamylarginylleucylglutaminylthreonylaspartylalanylal-
anyllysylisoleucylhistidylprolylserylthreonylserylalanylserylglutaminylgl-
utamylphenylalanyltyrosylglutamylprolylglycylleucylglutamylprolylserylala-
nylthreonylalanyllysylleucylglycylaspartylleucylglutaminylarginylseryltry-
ptophylglutamylthreonylleucyllysylasparaginylvalylisoleucylserylglutamyll-
ysylglutaminylarginylthreonylleucyltyrosylglutamylalanylleucylglutamylarg-
inylglutaminylglutaminyllysyltyrosylglutaminylaspartylserylleucylglutamin-
ylserylisoleucylserylthreonyllysylmethionylglutamylalanylisoleucylglutamy-
lleucyllysylleucylserylglutamylserylprolylglutamylprolylglycylarginylsery-
lprolylglutamylserylglutaminylmethionylalanylglutamylhistidylglutaminylal-
anylleucylmethionylaspartylglutamylisoleucylleucylmethionylleucylglutamin-
ylaspartylglutamylisoleucylasparaginylglutamylleucylglutaminylserylseryll-
eucylalanylglutamylglutamylleucylvalylserylglutamylserylcysteinylglutamyl-
alanylaspartylprolylalanylglutamylglutaminylleucylalanylleucylglutaminyls-
erylthreonylleucylthreonylvalylleucylalanylglutamylarginylmethionylserylt-
hreonylisoleucylarginylmethionyllysylalanylserylglycyllysylarginylglutami-
nylleucylleucylglutamylglutamyllysylleucylasparaginylaspartylglutaminylle-
ucylglutamylglutamylglutaminylarginylglutaminylglutamylglutaminylalanylle-
ucylglutaminylarginyltyrosylarginylcysteinylglutamylalanylaspartylglutamy-
lleucylaspartylseryltryptophylleucylleucylserylthreonyllysylalanylthreony-
lleucylaspartylthreonylalanylleucylserylprolylprolyllysylglutamylprolylme-
thionylaspartylmethionylglutamylalanylglutaminylleucylmethionylaspartylcy-
steinylglutaminylasparaginylmethionylleucylvalylglutamylisoleucylglutamyl-
glutaminyllysylvalylvalylalanylleucylserylglutamylleucylserylvalylhistidy-
lasparaginylglutamylasparaginylleucylleucylleucylglutamylglycyllysylalany-
lhistidylthreonyllysylaspartylglutamylalanylglutamylglutaminylleucylalany-
lglycyllysylleucylarginylarginylleucyllysylglycylserylleucylleucylglutamy-
lleucylglutaminylarginylalanylleucylhistidylaspartyllysylglutaminylleucyl-
asparaginylmethionylglutaminylglycylthreonylalanylglutaminylglutamyllysyl-
glutamylglutamylserylaspartylvalylaspartylleucylthreonylalanylthreonylglu-
taminylserylprolylglycylvalylglutaminylglutamyltryptophylleucylalanylglut-
aminylalanylarginylthreonylthreonyltryptophylthreonylglutaminylglutaminyl-
arginylglutaminylserylserylleucylglutaminylglutaminylglutaminyllysylgluta-
mylleucylglutamylglutaminylglutamylleucylalanylglutamylglutaminyllysylser-
ylleucylleucylarginylserylvalylalanylserylarginylglycylglutamylglutamylis-
oleucylleucylisoleucylglutaminylhistidylserylalanylalanylglutamylthreonyl-
serylglycylaspartylalanylglycylglutamyllysylprolylaspartylvalylleucylsery-
lglutaminylglutamylleucylglycylmethionylglutamylglycylglutamyllysylseryls-
erylalanylglutamylaspartylglutaminylmethionylarginylmethionyllysyltryptop-
hylglutamylserylleucylhistidylglutaminylglutamylphenylalanylserylthreonyl-
lysylglutaminyllysylleucylleucylglutaminylasparaginylvalylleucylglutamylg-
lutaminylglutamylglutaminylglutamylglutaminylvalylleucyltyrosylserylargin-
ylprolylasparaginylarginylleucylleucylserylglycylvalylprolylleucyltyrosyl-
lysylglycylaspartylvalylprolylthreonylglutaminylaspartyllysylserylalanylv-
alylthreonylserylleucylleucylaspartylglycylleucylasparaginylglutaminylala-
nylphenylalanylglutamylglutamylvalylserylserylglutaminylserylglycylglycyl-
alanyllysylarginylglutaminylserylisoleucylhistidylleucylglutamylglutaminy-
llysylleucyltyrosylaspartylglycylvalylserylalanylthreonylserylthreonyltry-
ptophylleucylaspartylaspartylvalylglutamylglutamylarginylleucylphenylalan-
ylvalylalanylthreonylalanylleucylleucylprolylglutamylglutamylthreonylglut-
amylthreonylcysteinylleucylphenylalanylasparaginylglutaminylglutamylisole-
ucylleucylalanyllysylaspartylisoleucyllysylglutamylmethionylserylglutamyl-
glutamylmethionylaspartyllysylasparaginyllysylasparaginylleucylphenylalan-
ylserylglutaminylalanylphenylalanylprolylglutamylasparaginylglycylasparty-
lasparaginylarginylaspartylvalylisoleucylglutamylaspartylthreonylleucylgl-
ycylcysteinylleucylleucylglycylarginylleucylserylleucylleucylaspartylsery-
lvalylvalylasparaginylglutaminylarginylcysteinylhistidylglutaminylmethion-
yllysylglutamylarginylleucylglutaminylglutaminylisoleucylleucylasparaginy-
lphenylalanylglutaminylasparaginylaspartylleucyllysylvalylleucylphenylala-
nylthreonylserylleucylalanylaspartylasparaginyllysyltyrosylisoleucylisole-
ucylleucylglutaminyllysylleucylalanylasparaginylvalylphenylalanylglutamyl-
glutaminylprolylvalylalanylglutamylglutaminylisoleucylglutamylalanylisole-
ucylglutaminylglutaminylalanylglutamylaspartylglycylleucyllysylglutamylph-
enylalanylaspartylalanylglycylisoleucylisoleucylglutamylleucyllysylarginy-
larginylglycylaspartyllysylleucylglutaminylvalylglutamylglutaminylprolyls-
erylmethionylglutaminylglutamylleucylseryllysylleucylglutaminylaspartylme-
thionyltyrosylaspartylglutamylleucylmethionylmethionylisoleucylisoleucylg-
lycylserylarginylarginylserylglycylleucylasparaginylglutaminylasparaginyl-
leucylthreonylleucyllysylserylglutaminyltyrosylglutamylarginylalanylleucy-
lglutaminylaspartylleucylalanylaspartylleucylleucylglutamylthreonylglycyl-
glutaminylglutamyllysylmethionylalanylglycylaspartylglutaminyllysylisoleu-
cylisoleucylvalylserylseryllysylglutamylglutamylisoleucylglutaminylglutam-
inylleucylleucylaspartyllysylhistidyllysylglutamyltyrosylphenylalanylglut-
aminylglycylleucylglutamylserylhistidylmethionylisoleucylleucylthreonylgl-
utamylthreonylleucylphenylalanylarginyllysylisoleucylisoleucylserylphenyl-
alanylalanylvalylglutaminyllysylglutamylthreonylglutaminylphenylalanylhis-
tidylthreonylglutamylleucylmethionylalanylglutaminylalanylserylalanylvaly-
lleucyllysylarginylalanylhistidyllysylarginylglycylvalylglutamylleucylglu-
tamyltyrosylisoleucylleucylglutamylthreonyltryptophylserylhistidylleucyla-
spartylglutamylaspartylglutaminylglutaminylglutamylleucylserylarginylglut-
aminylleucylglutamylvalylvalylglutamylserylserylisoleucylprolylserylvalyl-
glycylleucylvalylglutamylglutamylasparaginylglutamylaspartylarginylleucyl-
isoleucylaspartylarginylisoleucylthreonylleucyltyrosylglutaminylhistidyll-
eucyllysylserylserylleucylasparaginylglutamyltyrosylglutaminylprolyllysyl-
leucyltyrosylglutaminylvalylleucylaspartylaspartylglycyllysylarginylleucy-
lleucylisoleucylserylisoleucylserylcysteinylserylaspartylleucylglutamylse-
rylglutaminylleucylasparaginylglutaminylleucylglycylglutamylcysteinyltryp-
tophylleucylserylasparaginylthreonylasparaginyllysylmethionylseryllysylgl-
utamylleucylhistidylarginylleucylglutamylthreonylisoleucylleucyllysylhist-
idyltryptophylthreonylarginyltyrosylglutaminylserylglutamylserylalanylasp-
artylleucylisoleucylhistidyltryptophylleucylglutaminylserylalanyllysylasp-
artylarginylleucylglutamylphenylalanyltryptophylthreonylglutaminylglutami-
nylserylvalylthreonylvalylprolylglutaminylglutamylleucylglutamylmethionyl-
valylarginylaspartylhistidylleucylasparaginylalanylphenylalanylleucylglut-
amylphenylalanylseryllysylglutamylvalylaspartylalanylglutaminylserylseryl-
leucyllysylserylserylvalylleucylserylthreonylglycylasparaginylglutaminyll-
eucylleucylarginylleucyllysyllysylvalylaspartylthreonylalanylthreonylleuc-
ylarginylserylglutamylleucylserylarginylisoleucylaspartylserylglutaminylt-
ryptophylthreonylaspartylleucylleucylthreonylasparaginylisoleucylprolylal-
anylvalylglutaminylglutamyllysylleucylhistidylglutaminylleucylglutaminylm-
ethionylaspartyllysylleucylprolylserylarginylhistidylalanylisoleucylseryl-
glutamylvalylmethionylseryltryptophylisoleucylserylleucylmethionylglutamy-
lasparaginylvalylisoleucylglutaminyllysylaspartylglutamylaspartylasparagi-
nylisoleucyllysylasparaginylserylisoleucylglycyltyrosyllysylalanylisoleuc-
ylhistidylglutamyltyrosylleucylglutaminyllysyltyrosyllysylglycylphenylala-
nyllysylisoleucylaspartylisoleucylasparaginylcysteinyllysylglutaminylleuc-
ylthreonylvalylaspartylphenylalanylvalylasparaginylglutaminylserylvalylle-
ucylglutaminylisoleucylserylserylglutaminylaspartylvalylglutamylseryllysy-
larginylserylaspartyllysylthreonylaspartylphenylalanylalanylglutamylgluta-
minylleucylglycylalanylmethionylasparaginyllysylseryltryptophylglutaminyl-
isoleucylleucylglutaminylglycylleucylvalylthreonylglutamyllysylisoleucylg-
lutaminylleucylleucylglutamylglycylleucylleucylglutamylseryltryptophylser-
ylglutamyltyrosylglutamylasparaginylasparaginylvalylglutaminylcysteinylle-
ucyllysylthreonyltryptophylphenylalanylglutamylthreonylglutaminylglutamyl-
lysylarginylleucyllysylglutaminylglutaminylhistidylarginylisoleucylglycyl-
aspartylglutaminylalanylserylvalylglutaminylasparaginylalanylleucyllysyla-
spartylcysteinylglutaminylaspartylleucylglutamylaspartylleucylisoleucylly-
sylalanyllysylglutamyllysylglutamylvalylglutamyllysylisoleucylglutamylglu-
taminylasparaginylglycylleucylalanylleucylisoleucylglutaminylasparaginyll-
ysyllysylglutamylaspartylvalylserylserylisoleucylvalylmethionylserylthreo-
nylleucylarginylglutamylleucylglycylglutaminylthreonyltryptophylalanylasp-
araginylleucylaspartylhistidylmethionylvalylglycylglutaminylleucyllysylis-
oleucylleucylleucyllysylserylvalylleucylaspartylglutaminyltryptophylseryl-
serylhistidyllysylvalylalanylphenylalanylaspartyllysylisoleucylasparaginy-
lseryltyrosylleucylmethionylglutamylalanylarginyltyrosylserylleucylseryla-
rginylphenylalanylarginylleucylleucylthreonylglycylserylleucylglutamylala-
nylvalylglutaminylvalylglutaminylvalylaspartylasparaginylleucylglutaminyl-
asparaginylleucylglutaminylaspartylaspartylleucylglutamyllysylglutaminylg-
lutamylarginylserylleucylglutaminyllysylphenylalanylglycylserylisoleucylt-
hreonylasparaginylglutaminylleucylleucyllysylglutamylcysteinylhistidylpro-
lylprolylvalylthreonylglutamylthreonylleucylthreonylasparaginylthreonylle-
ucyllysylglutamylvalylasparaginylmethionylarginyltryptophylasparaginylasp-
araginylleucylleucylglutamylglutamylisoleucylalanylglutamylglutaminylleuc-
ylglutaminylserylseryllysylalanylleucylleucylglutaminylleucyltryptophylgl-
utaminylarginyltyrosyllysylaspartyltyrosylseryllysylglutaminylcysteinylal-
anylserylthreonylvalylglutaminylglutaminylglutaminylglutamylaspartylargin-
ylthreonylasparaginylglutamylleucylleucyllysylalanylalanylthreonylasparag-
inyllysylaspartylisoleucylalanylaspartylaspartylglutamylvalylalanylthreon-
yltryptophylisoleucylglutaminylaspartylcysteinylasparaginylaspartylleucyl-
leucyllysylglycylleucylglycylthreonylvalyllysylaspartylserylleucylphenyla-
lanylphenylalanylleucylhistidylglutamylleucylglycylglutamylglutaminylleuc-
yllysylglutaminylglutaminylvalylaspartylalanylserylalanylalanylserylalany-
lisoleucylglutaminylserylaspartylglutaminylleucylserylleucylserylglutamin-
ylhistidylleucylcysteinylalanylleucylglutamylglutaminylalanylleucylcystei-
nyllysylglutaminylglutaminylthreonylserylleucylglutaminylalanylglycylvaly-
lleucylaspartyltyrosylglutamylthreonylphenylalanylalanyllysylserylleucylg-
lutamylalanylleucylglutamylalanyltryptophylisoleucylvalylglutamylalanylgl-
utamylglutamylisoleucylleucylglutaminylglycylglutaminylaspartylprolylsery-
lhistidylserylserylaspartylleucylserylthreonylisoleucylglutaminylglutamyl-
arginylmethionylglutamylglutamylleucyllysylglycylglutaminylmethionylleucy-
llysylphenylalanylserylserylmethionylalanylprolylaspartylleucylaspartylar-
ginylleucylasparaginylglutamylleucylglycyltyrosylarginylleucylprolylleucy-
lasparaginylaspartyllysylglutamylisoleucyllysylarginylmethionylglutaminyl-
asparaginylleucylasparaginylarginylhistidyltryptophylserylleucylisoleucyl-
serylserylglutaminylthreonylthreonylglutamylarginylphenylalanylseryllysyl-
leucylglutaminylserylphenylalanylleucylleucylglutaminylhistidylglutaminyl-
threonylphenylalanylleucylglutamyllysylcysteinylglutamylthreonyltryptophy-
lmethionylglutamylphenylalanylleucylvalylglutaminylthreonylglutamylglutam-
inyllysylleucylalanylvalylglutamylisoleucylserylglycylasparaginyltyrosylg-
lutaminylhistidylleucylleucylglutamylglutaminylglutaminylarginylalanylhis-
tidylglutamylleucylphenylalanylglutaminylalanylglutamylmethionylphenylala-
nylserylarginylglutaminylglutaminylisoleucylleucylhistidylserylisoleucyli-
soleucylisoleucylaspartylglycylglutaminylarginylleucylleucylglutamylgluta-
minylglycylglutaminylvalylaspartylaspartylarginylaspartylglutamylphenylal-
anylasparaginylleucyllysylleucylthreonylleucylleucylserylasparaginylgluta-
minyltryptophylglutaminylglycylvalylisoleucylarginylarginylalanylglutamin-
ylglutaminylarginylarginylglycylisoleucylisoleucylaspartylserylglutaminyl-
isoleucylarginylglutaminyltryptophylglutaminylarginyltyrosylarginylglutam-
ylmethionylalanylglutamyllysylleucylarginyllysyltryptophylleucylvalylglut-
amylvalylseryltyrosylleucylprolylmethionylserylglycylleucylglycylserylval-
ylprolylisoleucylprolylleucylglutaminylglutaminylalanylarginylthreonylleu-
cylphenylalanylaspartylglutamylvalylglutaminylphenylalanyllysylglutamylly-
sylvalylphenylalanylleucylarginylglutaminylglutaminylglycylseryltyrosylis-
oleucylleucylthreonylvalylglutamylalanylglycyllysylglutaminylleucylleucyl-
leucylserylalanylaspartylserylglycylalanylglutamylalanylalanylleucylgluta-
minylalanylglutamylleucylalanylglutamylisoleucylglutaminylglutamyllysyltr-
yptophyllysylserylalanylserylmethionylarginylleucylglutamylglutamylglutam-
inyllysyllysyllysylleucylalanylphenylalanylleucylleucyllysylaspartyltrypt-
ophylglutamyllysylcysteinylglutamyllysylglycylisoleucylalanylaspartylsery-
lleucylglutamyllysylleucylarginylthreonylphenylalanyllysyllysyllysylleucy-
lserylglutaminylserylleucylprolylaspartylhistidylhistidylglutamylglutamyl-
leucylhistidylalanylglutamylglutaminylmethionylarginylcysteinyllysylgluta-
mylleucylglutamylasparaginylalanylvalylglycylseryltryptophylthreonylaspar-
tylaspartylleucylthreonylglutaminylleucylserylleucylleucyllysylaspartylth-
reonylleucylserylalanyltyrosylisoleucylserylalanylaspartylaspartylisoleuc-
ylserylisoleucylleucylasparaginylglutamylarginylvalylglutamylleucylleucyl-
glutaminylarginylglutaminyltryptophylglutamylglutamylleucylcysteinylhisti-
dylglutaminylleucylserylleucylarginylarginylglutaminylglutaminylisoleucyl-
glycylglutamylarginylleucylasparaginylglutamyltryptophylalanylvalylphenyl-
alanylserylglutamyllysylasparaginyllysylglutamylleucylcysteinylglutamyltr-
yptophylleucylthreonylglutaminylmethionylglutamylseryllysylvalylserylglut-
aminylasparaginylglycylaspartylisoleucylleucylisoleucylglutamylglutamylme-
thionylisoleucylglutamyllysylleucyllysyllysylaspartyltyrosylglutaminylglu-
tamylglutamylisoleucylalanylisoleucylalanylglutaminylglutamylasparaginyll-
ysylisoleucylglutaminylleucylglutaminylglutaminylmethionylglycylglutamyla-
rginylleucylalanyllysylalanylserylhistidylglutamylseryllysylalanylserylgl-
utamylisoleucylglutamyltyrosyllysylleucylglycyllysylvalylasparaginylaspar-
tylarginyltryptophylglutaminylhistidylleucylleucylaspartylleucylisoleucyl-
alanylalanylarginylvalyllysyllysylleucyllysylglutamylthreonylleucylvalyla-
lanylvalylglutaminylglutaminylleucylaspartyllysylasparaginylmethionylsery-
lserylleucylarginylthreonyltryptophylleucylalanylhistidylisoleucylglutamy-
lserylglutamylleucylalanyllysylprolylisoleucylvalyltyrosylaspartylserylcy-
steinylasparaginylserylglutamylglutamylisoleucylglutaminylarginyllysylleu-
cylasparaginylglutamylglutaminylglutaminylglutamylleucylglutaminylarginyl-
aspartylisoleucylglutamyllysylhistidylserylthreonylglycylvalylalanylseryl-
valylleucylasparaginylleucylcysteinylglutamylvalylleucylleucylhistidylasp-
artylcysteinylaspartylalanylcysteinylalanylthreonylaspartylalanylglutamyl-
cysteinylaspartylserylisoleucylglutaminylglutaminylalanylthreonylarginyla-
sparaginylleucylaspartylarginylarginyltryptophylarginylasparaginylisoleuc-
ylcysteinylalanylmethionylserylmethionylglutamylarginylarginylleucyllysyl-
isoleucylglutamylglutamylthreonyltryptophylarginylleucyltryptophylglutami-
nyllysylphenylalanylleucylaspartylaspartyltyrosylserylarginylphenylalanyl-
glutamylaspartyltryptophylleucyllysylserylserylglutamylarginylthreonylala-
nylalanylphenylalanylprolylserylserylserylglycylvalylisoleucyltyrosylthre-
onylvalylalanyllysylglutamylglutamylleucyllysyllysylphenylalanylglutamyla-
lanylphenylalanylglutaminylarginylglutaminylvalylhistidylglutamylcysteiny-
lleucylthreonylglutaminylleucylglutamylleucylisoleucylasparaginyllysylglu-
taminyltyrosylarginylarginylleucylalanylarginylglutamylasparaginylarginyl-
threonylaspartylserylalanylcysteinylserylleucyllysylglutaminylmethionylva-
lylhistidylglutamylglycylasparaginylglutaminylarginyltryptophylaspartylas-
paraginylleucylglutaminyllysylarginylvalylthreonylserylisoleucylleucylarg-
inylarginylleucyllysylhistidylphenylalanylisoleucylglycylglutaminylarginy-
lglutamylglutamylphenylalanylglutamylthreonylalanylarginylaspartylserylis-
oleucylleucylvalyltryptophylleucylthreonylglutamylmethionylaspartylleucyl-
glutaminylleucylthreonylasparaginylisoleucylglutamylhistidylphenylalanyls-
erylglutamylcysteinylaspartylvalylglutaminylalanyllysylisoleucyllysylglut-
aminylleucyllysylalanylphenylalanylglutaminylglutaminylglutamylisoleucyls-
erylleucylasparaginylhistidylasparaginyllysylisoleucylglutamylglutaminyli-
soleucylisoleucylalanylglutaminylglycylglutamylglutaminylleucylisoleucylg-
lutamyllysylserylglutamylprolylleucylaspartylalanylalanylisoleucylisoleuc-
ylglutamylglutamylglutamylleucylaspartylglutamylleucylarginylarginyltyros-
ylcysteinylglutaminylglutamylvalylphenylalanylglycylarginylvalylglutamyla-
rginyltyrosylhistidyllysyllysylleucylisoleucylarginylleucylprolylleucylpr-
olylaspartylaspartylglutamylhistidylaspartylleucylserylaspartylarginylglu-
tamylleucylglutamylleucylglutamylaspartylserylalanylalanylleucylserylaspa-
rtylleucylhistidyltryptophylhistidylaspartylarginylserylalanylaspartylser-
ylleucylleucylserylprolylglutaminylprolylserylserylasparaginylleucylseryl-
leucylserylleucylalanylglutaminylprolylleucylarginylserylglutamylarginyls-
erylglycylarginylaspartylthreonylprolylalanylserylvalylaspartylserylisole-
ucylprolylleucylglutamyltryptophylaspartylhistidylaspartyltyrosylaspartyl-
leucylserylarginylaspartylleucylglutamylserylalanylmethionylserylarginyla-
lanylleucylprolylserylglutamylaspartylglutamylglutamylglycylglutaminylasp-
artylaspartyllysylaspartylphenylalanyltyrosylleucylarginylglycylalanylval-
ylalanylleucylserylglycylaspartylhistidylserylalanylleucylglutamylserylgl-
utaminylisoleucylarginylglutaminylleucylglycyllysylalanylleucylaspartylas-
partylserylarginylphenylalanylglutaminylisoleucylglutaminylglutaminylthre-
onylglutamylasparaginylisoleucylisoleucylarginylseryllysylthreonylprolylt-
hreonylglycylprolylglutamylleucylaspartylthreonylseryltyrosyllysylglycylt-
yrosylmethionyllysylleucylleucylglycylglutamylcysteinylserylserylseryliso-
leucylaspartylserylvalyllysylarginylleucylglutamylhistidyllysylleucyllysy-
lglutamylglutamylglutamylglutamylserylleucylprolylglycylphenylalanylvalyl-
asparaginylleucylhistidylserylthreonylglutamylthreonylglutaminylthreonyla-
lanylglycylvalylisoleucylaspartylarginyltryptophylglutamylleucylleucylglu-
taminylalanylglutaminylalanylleucylseryllysylglutamylleucylarginylmethion-
yllysylglutaminylasparaginylleucylglutaminyllysyltryptophylglutaminylglut-
aminylphenylalanylasparaginylserylaspartylleucylasparaginylserylisoleucyl-
tryptophylalanyltryptophylleucylglycylaspartylthreonylglutamylglutamylglu-
tamylleucylglutamylglutaminylleucylglutaminylarginylleucylglutamylleucyls-
erylthreonylaspartylisoleucylglutaminylthreonylisoleucylglutamylleucylglu-
taminylisoleucyllysyllysylleucyllysylglutamylleucylglutaminyllysylalanylv-
alylaspartylhistidylarginyllysylalanylisoleucylisoleucylleucylserylisoleu-
cylasparaginylleucylcysteinylserylprolylglutamylphenylalanylthreonylgluta-
minylalanylaspartylseryllysylglutamylserylarginylaspartylleucylglutaminyl-
aspartylarginylleucylserylglutaminylmethionylasparaginylglycylarginyltryp-
tophylaspartylarginylvalylcysteinylserylleucylleucylglutamylglutamyltrypt-
ophylarginylglycylleucylleucylglutaminylaspartylalanylleucylmethionylglut-
aminylcysteinylglutaminylglycylphenylalanylhistidylglutamylmethionylseryl-
histidylglycylleucylleucylleucylmethionylleucylglutamylasparaginylisoleuc-
ylaspartylarginylarginyllysylasparaginylglutamylisoleucylvalylprolylisole-
ucylaspartylserylasparaginylleucylaspartylalanylglutamylisoleucylleucylgl-
utaminylaspartylhistidylhistidyllysylglutaminylleucylmethionylglutaminyli-
soleucyllysylhistidylglutamylleucylleucylglutamylserylglutaminylleucylarg-
inylvalylalanylserylleucylglutaminylaspartylmethionylserylcysteinylglutam-
inylleucylleucylvalylasparaginylalanylglutamylglycylthreonylaspartylcyste-
inylleucylglutamylalanyllysylglutamyllysylvalylhistidylvalylisoleucylglyc-
ylasparaginylarginylleucyllysylleucylleucylleucyllysylglutamylvalylseryla-
rginylhistidylisoleucyllysylglutamylleucylglutamyllysylleucylleucylaspart-
ylvalylserylserylserylglutaminylglutaminylaspartylleucylserylseryltryptop-
hylserylserylalanylaspartylglutamylleucylaspartylthreonylserylglycylseryl-
valylserylprolylthreonylserylglycylarginylserylthreonylprolylasparaginyla-
rginylglutaminyllysylthreonylprolylarginylglycyllysylcysteinylserylleucyl-
serylglutaminylprolylglycylprolylserylvalylserylserylprolylhistidylseryla-
rginylserylthreonyllysylglycylglycylserylaspartylserylserylleucylserylglu-
tamylprolylglycylprolylglycylarginylserylglycylarginylglycylphenylalanyll-
eucylphenylalanylarginylvalylleucylarginylalanylalanylleucylprolylleucylg-
lutaminylleucylleucylleucylleucylleucylleucylisoleucylglycylleucylalanylc-
ysteinylleucylvalylprolylmethionylserylglutamylglutamylaspartyltyrosylser-
ylcysteinylalanylleucylserylasparaginylasparaginylphenylalanylalanylargin-
ylserylphenylalanylhistidylprolylmethionylleucylarginyltyrosylthreonylasp-
araginylglycylprolylprolylprolylleucine


 

Answer by Shaun
Submitted on 4/7/2005
Rating: Not yet rated Rate this answer: Vote
A biology chemical term found on wikisource.net, it contains over 180,000 letters...here goes...

Methionylthreonylthreonylglutaminylalanylprolylthreonylphenylalanylthreon–
ylglutaminylprolylleucylglutaminylserylvalylvalylvalylleucylglutamylglycy–
lserylthreonylalanylthreonylphenylalanylglutamylalanylhistidylisoleucylse–
rylglycylphenylalanylprolylvalylprolylglutamylvalylseryltryptophylphenyla–
lanylarginylaspartylglycylglutaminylvalylisoleucylserylthreonylserylthreo–
nylleucylprolylglycylvalylglutaminylisoleucylserylphenylalanylserylaspart–
ylglycylarginylalanyllysylleucylthreonylisoleucylprolylalanylvalylthreony–
llysylalanylasparaginylserylglycylarginyltyrosylserylleucyllysylalanylthr–
eonylasparaginylglycylserylglycylglutaminylalanylthreonylserylthreonylala–
nylglutamylleucylleucylvalyllysylalanylglutamylthreonylalanylprolylprolyl–
asparaginylphenylalanylvalylglutaminylarginylleucylglutaminylserylmethion–
ylthreonylvalylarginylglutaminylglycylserylglutaminylvalylarginylleucylgl–
utaminylvalylarginylvalylthreonylglycylisoleucylprolylasparaginylprolylva–
lylvalyllysylphenylalanyltyrosylarginylaspartylglycylalanylglutamylisoleu–
cylglutaminylserylserylleucylaspartylphenylalanylglutaminylisoleucylseryl–
glutaminylglutamylglycylaspartylleucyltyrosylserylleucylleucylisoleucylal–
anylglutamylalanyltyrosylprolylglutamylaspartylserylglycylthreonyltyrosyl–
serylvalylasparaginylalanylthreonylasparaginylserylvalylglycylarginylalan–
ylthreonylserylthreonylalanylglutamylleucylleucylvalylglutaminylglycylglu–
tamylglutamylglutamylvalylprolylalanyllysyllysylthreonyllysylthreonylisol–
eucylvalylserylthreonylalanylglutaminylisoleucylserylglutamylserylarginyl–
glutaminylthreonylarginylisoleucylglutamyllysyllysylisoleucylglutamylalan–
ylhistidylphenylalanylaspartylalanylarginylserylisoleucylalanylthreonylva–
lylglutamylmethionylvalylisoleucylaspartylglycylalanylalanylglycylglutami–
nylglutaminylleucylprolylhistidyllysylthreonylprolylprolylarginylisoleucy–
lprolylprolyllysylprolyllysylserylarginylserylprolylthreonylprolylprolyls–
erylisoleucylalanylalanyllysylalanylglutaminylleucylalanylarginylglutamin–
ylglutaminylserylprolylserylprolylisoleucylarginylhistidylserylprolylsery–
lprolylvalylarginylhistidylvalylarginylalanylprolylthreonylprolylserylpro–
lylvalylarginylserylvalylserylprolylalanylalanylarginylisoleucylserylthre–
onylserylprolylisoleucylarginylserylvalylarginylserylprolylleucylleucylme–
thionylarginyllysylthreonylglutaminylalanylserylthreonylvalylalanylthreon–
ylglycylprolylglutamylvalylprolylprolylprolyltryptophyllysylglutaminylglu–
tamylglycyltyrosylvalylalanylserylserylserylglutamylalanylglutamylmethion–
ylarginylglutamylthreonylthreonylleucylthreonylthreonylserylthreonylgluta–
minylisoleucylarginylthreonylglutamylglutamylarginyltryptophylglutamylgly–
cylarginyltyrosylglycylvalylglutaminylglutamylglutaminylvalylthreonylisol–
eucylserylglycylalanylalanylglycylalanylalanylalanylserylvalylserylalanyl–
serylalanylseryltyrosylalanylalanylglutamylalanylvalylalanylthreonylglycy–
lalanyllysylglutamylvalyllysylglutaminylaspartylalanylaspartyllysylseryla–
lanylalanylvalylalanylthreonylvalylvalylalanylalanylvalylaspartylmethiony–
lalanylarginylvalylarginylglutamylprolylvalylisoleucylserylalanylvalylglu–
tamylglutaminylthreonylalanylglutaminylarginylthreonylthreonylthreonylthr–
eonylalanylvalylhistidylisoleucylglutaminylprolylalanylglutaminylglutamyl–
glutaminylvalylarginyllysylglutamylalanylglutamyllysylthreonylalanylvalyl–
threonyllysylvalylvalylvalylalanylalanylaspartyllysylalanyllysylglutamylg–
lutaminylglutamylleucyllysylserylarginylthreonyllysylglutamylisoleucyliso–
leucylthreonylthreonyllysylglutaminylglutamylglutaminylmethionylhistidylv–
alylthreonylhistidylglutamylglutaminylisoleucylarginyllysylglutamylthreon–
ylglutamyllysylthreonylphenylalanylvalylprolyllysylvalylvalylisoleucylser–
ylalanylalanyllysylalanyllysylglutamylglutaminylglutamylthreonylarginylis–
oleucylserylglutamylglutamylisoleucylthreonyllysyllysylglutaminyllysylglu–
taminylvalylthreonylglutaminylglutamylalanylisoleucylmethionyllysylglutam–
ylthreonylarginyllysylthreonylvalylvalylprolyllysylvalylisoleucylvalylala–
nylthreonylprolyllysylvalyllysylglutamylglutaminylaspartylleucylvalylsery–
larginylglycylarginylglutamylglycylisoleucylthreonylthreonyllysylarginylg–
lutamylglutaminylvalylglutaminylisoleucylthreonylglutaminylglutamyllysylm–
ethionylarginyllysylglutamylalanylglutamyllysylthreonylalanylleucylserylt–
hreonylisoleucylalanylvalylalanylthreonylalanyllysylalanyllysylglutamylgl–
utaminylglutamylthreonylisoleucylleucylarginylthreonylarginylglutamylthre–
onylmethionylalanylthreonylarginylglutaminylglutamylglutaminylisoleucylgl–
utaminylvalylthreonylhistidylglycyllysylvalylaspartylvalylglycyllysyllysy–
lalanylglutamylalanylvalylalanylthreonylvalylvalylalanylalanylvalylaspart–
ylglutaminylalanylarginylvalylarginylglutamylprolylarginylglutamylprolylg–
lycylhistidylleucylglutamylglutamylseryltyrosylalanylglutaminylglutaminyl–
threonylthreonylleucylglutamyltyrosylglycyltyrosyllysylglutamylarginyliso–
leucylserylalanylalanyllysylvalylalanylglutamylprolylprolylglutaminylargi–
nylprolylalanylserylglutamylprolylhistidylvalylvalylprolyllysylalanylvaly–
llysylprolylarginylvalylisoleucylglutaminylalanylprolylserylglutamylthreo–
nylhistidylisoleucyllysylthreonylthreonylaspartylglutaminyllysylglycylmet–
hionylhistidylisoleucylserylserylglutaminylisoleucyllysyllysylthreonylthr–
eonylaspartylleucylthreonylthreonylglutamylarginylleucylvalylhistidylvaly–
laspartyllysylarginylprolylarginylthreonylalanylserylprolylhistidylphenyl–
alanylthreonylvalylseryllysylisoleucylserylvalylprolyllysylthreonylglutam–
ylhistidylglycyltyrosylglutamylalanylserylisoleucylalanylglycylserylalany–
lisoleucylalanylthreonylleucylglutaminyllysylglutamylleucylserylalanylthr–
eonylserylserylalanylglutaminyllysylisoleucylthreonyllysylserylvalyllysyl–
alanylprolylthreonylvalyllysylprolylserylglutamylthreonylarginylvalylargi–
nylalanylglutamylprolylthreonylprolylleucylprolylglutaminylphenylalanylpr–
olylphenylalanylalanylaspartylthreonylprolylaspartylthreonyltyrosyllysyls–
erylglutamylalanylglycylvalylglutamylvalyllysyllysylglutamylvalylglycylva–
lylserylisoleucylthreonylglycylthreonylthreonylvalylarginylglutamylglutam–
ylarginylphenylalanylglutamylvalylleucylhistidylglycylarginylglutamylalan–
yllysylvalylthreonylglutamylthreonylalanylarginylvalylprolylalanylprolylv–
alylglutamylisoleucylprolylvalylthreonylprolylprolylthreonylleucylvalylse–
rylglycylleucyllysylasparaginylvalylthreonylvalylisoleucylglutamylglycylg–
lutamylserylvalylthreonylleucylglutamylcysteinylhistidylisoleucylserylgly–
cyltyrosylprolylserylprolylthreonylvalylthreonyltryptophyltyrosylarginylg–
lutamylaspartyltyrosylglutaminylisoleucylglutamylserylserylisoleucylaspar–
tylphenylalanylglutaminylisoleucylthreonylphenylalanylglutaminylserylglyc–
ylisoleucylalanylarginylleucylmethionylisoleucylarginylglutamylalanylphen–
ylalanylalanylglutamylaspartylserylglycylarginylphenylalanylthreonylcyste–
inylserylalanylvalylasparaginylglutamylalanylglycylthreonylvalylserylthre–
onylserylcysteinyltyrosylleucylalanylvalylglutaminylvalylserylglutamylglu–
tamylphenylalanylglutamyllysylglutamylthreonylthreonylalanylvalylthreonyl–
glutamyllysylphenylalanylthreonylthreonylglutamylglutamyllysylarginylphen–
ylalanylvalylglutamylserylarginylaspartylvalylvalylmethionylthreonylaspar–
tylthreonylserylleucylthreonylglutamylglutamylglutaminylalanylglycylproly–
lglycylglutamylprolylalanylalanylprolyltyrosylphenylalanylisoleucylthreon–
yllysylprolylvalylvalylglutaminyllysylleucylvalylglutamylglycylglycylsery–
lvalylvalylphenylalanylglycylcysteinylglutaminylvalylglycylglycylasparagi–
nylprolyllysylprolylhistidylvalyltyrosyltryptophyllysyllysylserylglycylva–
lylprolylleucylthreonylthreonylglycyltyrosylarginyltyrosyllysylvalylseryl–
tyrosylasparaginyllysylglutaminylthreonylglycylglutamylcysteinyllysylleuc–
ylvalylisoleucylserylmethionylthreonylphenylalanylalanylaspartylaspartyla–
lanylglycylglutamyltyrosylthreonylisoleucylvalylvalylarginylasparaginylly–
sylhistidylglycylglutamylthreonylserylalanylserylalanylserylleucylleucylg–
lutamylglutamylalanylaspartyltyrosylglutamylleucylleucylmethionyllysylser–
ylglutaminylglutaminylglutamylmethionylleucyltyrosylglutaminylthreonylglu–
taminylvalylthreonylalanylphenylalanylvalylglutaminylglutamylprolylglutam–
ylvalylglycylglutamylthreonylalanylprolylglycylphenylalanylvalyltyrosylse–
rylglutamyltyrosylglutamyllysylglutamyltyrosylglutamyllysylglutamylglutam–
inylalanylleucylisoleucylarginyllysyllysylmethionylalanyllysylaspartylthr–
eonylvalylvalylvalylarginylthreonyltyrosylvalylglutamylaspartylglutaminyl–
glutamylphenylalanylhistidylisoleucylserylserylphenylalanylglutamylglutam–
ylarginylleucylisoleucyllysylglutamylisoleucylglutamyltyrosylarginylisole–
ucylisoleucyllysylthreonylthreonylleucylglutamylglutamylleucylleucylgluta–
mylglutamylaspartylglycylglutamylglutamyllysylmethionylalanylvalylasparty–
lisoleucylserylglutamylserylglutamylalanylvalylglutamylserylglycylphenyla–
lanylaspartylleucylarginylisoleucyllysylasparaginyltyrosylarginylisoleucy–
lleucylglutamylglycylmethionylglycylvalylthreonylphenylalanylhistidylcyst–
einyllysylmethionylserylglycyltyrosylprolylleucylprolyllysylisoleucylalan–
yltryptophyltyrosyllysylaspartylglycyllysylarginylisoleucyllysylhistidylg–
lycylglutamylarginyltyrosylglutaminylmethionylaspartylphenylalanylleucylg–
lutaminylaspartylglycylarginylalanylserylleucylarginylisoleucylprolylvaly–
lvalylleucylprolylglutamylaspartylglutamylglycylisoleucyltyrosylthreonyla–
lanylphenylalanylalanylserylasparaginylisoleucyllysylglycylasparaginylala–
nylisoleucylcysteinylserylglycyllysylleucyltyrosylvalylglutamylprolylalan–
ylalanylprolylleucylglycylalanylprolylthreonyltyrosylisoleucylprolylthreo–
nylleucylglutamylprolylvalylserylarginylisoleucylarginylserylleucylserylp–
rolylarginylserylvalylserylarginylserylprolylisoleucylarginylmethionylser–
ylprolylalanylarginylmethionylserylprolylalanylarginylmethionylserylproly–
lalanylarginylmethionylserylprolylalanylarginylmethionylserylprolylglycyl–
arginylarginylleucylglutamylglutamylthreonylaspartylglutamylserylglutamin–
ylleucylglutamylarginylleucyltyrosyllysylprolylvalylphenylalanylvalylleuc–
yllysylprolylvalylserylphenylalanyllysylcysteinylleucylglutamylglycylalan–
ylasparaginylcysteinylarginylphenylalanylaspartylleucyllysylvalylvalylgly–
cylarginylprolylmethionylprolylglutamylthreonylphenylalanyltryptophylphen–
ylalanylhistidylaspartylglycylglutaminylglutaminylisoleucylvalylasparagin–
ylaspartyltyrosylthreonylhistidyllysylvalylvalylisoleucyllysylglutamylasp–
artylglycylthreonylglutaminylserylleucylisoleucylisoleucylvalylprolylalan–
ylthreonylprolylserylaspartylserylglycylglutamyltryptophylthreonylvalylva–
lylalanylglutaminylasparaginylarginylalanylglycylarginylserylserylisoleuc–
ylserylvalylisoleucylleucylthreonylvalylglutamylalanylvalylglutamylhistid–
ylglutaminylvalyllysylprolylmethionylphenylalanylvalylglutamyllysylleucyl–
lysylasparaginylvalylasparaginylisoleucyllysylglutamylglycylserylarginyll–
eucylglutamylmethionyllysylvalylarginylalanylthreonylglycylasparaginylpro–
lylasparaginylprolylaspartylisoleucylvalyltryptophylleucyllysylasparaginy–
lserylaspartylisoleucylisoleucylvalylprolylhistidyllysyltyrosylprolyllysy–
lisoleucylarginylisoleucylglutamylglycylthreonyllysylglycylglutamylalanyl–
alanylleucyllysylisoleucylaspartylserylthreonylvalylserylglutaminylaspart–
ylserylalanyltryptophyltyrosylthreonylalanylthreonylalanylisoleucylaspara–
ginyllysylalanylglycylarginylaspartylthreonylthreonylarginylcysteinyllysy–
lvalylasparaginylvalylglutamylvalylglutamylphenylalanylalanylglutamylprol–
ylglutamylprolylglutamylarginyllysylleucylisoleucylisoleucylprolylarginyl–
glycylthreonyltyrosylarginylalanyllysylglutamylisoleucylalanylalanylproly–
lglutamylleucylglutamylprolylleucylhistidylleucylarginyltyrosylglycylglut–
aminylglutamylglutaminyltryptophylglutamylglutamylglycylaspartylleucyltyr–
osylaspartyllysylglutamyllysylglutaminylglutaminyllysylprolylphenylalanyl–
phenylalanyllysyllysyllysylleucylthreonylserylleucylarginylleucyllysylarg–
inylphenylalanylglycylprolylalanylhistidylphenylalanylglutamylcysteinylar–
ginylleucylthreonylprolylisoleucylserylaspartylprolylthreonylmethionylval–
ylvalylglutamyltryptophylleucylhistidylaspartylglycyllysylprolylleucylglu–
tamylalanylalanylasparaginylarginylleucylarginylmethionylisoleucylasparag–
inylglutamylphenylalanylglycyltyrosylcysteinylserylleucylaspartyltyrosylg–
lycylvalylalanyltyrosylserylarginylaspartylserylglycylisoleucylisoleucylt–
hreonylcysteinylarginylalanylthreonylasparaginyllysyltyrosylglycylthreony–
laspartylhistidylthreonylserylalanylthreonylleucylisoleucylvalyllysylaspa–
rtylglutamyllysylserylleucylvalylglutamylglutamylserylglutaminylleucylpro–
lylglutamylglycylarginyllysylglycylleucylglutaminylarginylisoleucylglutam–
ylglutamylleucylglutamylarginylmethionylalanylhistidylglutamylglycylalany–
lleucylthreonylglycylvalylthreonylthreonylaspartylglutaminyllysylglutamyl–
lysylglutaminyllysylprolylaspartylisoleucylvalylleucyltyrosylprolylglutam–
ylprolylvalylarginylvalylleucylglutamylglycylglutamylthreonylalanylarginy–
lphenylalanylarginylcysteinylarginylvalylthreonylglycyltyrosylprolylgluta–
minylprolyllysylvalylasparaginyltryptophyltyrosylleucylasparaginylglycylg–
lutaminylleucylisoleucylarginyllysylseryllysylarginylphenylalanylarginylv–
alylarginyltyrosylaspartylglycylisoleucylhistidyltyrosylleucylaspartyliso–
leucylvalylaspartylcysteinyllysylseryltyrosylaspartylthreonylglycylglutam–
ylvalyllysylvalylthreonylalanylglutamylasparaginylprolylglutamylglycylval–
ylisoleucylglutamylhistidyllysylvalyllysylleucylglutamylisoleucylglutamin–
ylglutaminylarginylglutamylaspartylphenylalanylarginylserylvalylleucylarg–
inylarginylalanylprolylglutamylprolylarginylprolylglutamylphenylalanylhis–
tidylvalylhistidylglutamylprolylglycyllysylleucylglutaminylphenylalanylgl–
utamylvalylglutaminyllysylvalylaspartylarginylprolylvalylaspartylthreonyl–
threonylglutamylthreonyllysylglutamylvalylvalyllysylleucyllysylarginylala–
nylglutamylarginylisoleucylthreonylhistidylglutamyllysylvalylprolylglutam–
ylglutamylserylglutamylglutamylleucylarginylseryllysylphenylalanyllysylar–
ginylarginylthreonylglutamylglutamylglycyltyrosyltyrosylglutamylalanyliso–
leucylthreonylalanylvalylglutamylleucyllysylserylarginyllysyllysylasparty–
lglutamylseryltyrosylglutamylglutamylleucylleucylarginyllysylthreonyllysy–
laspartylglutamylleucylleucylhistidyltryptophylthreonyllysylglutamylleucy–
lthreonylglutamylglutamylglutamyllysyllysylalanylleucylalanylglutamylglut–
amylglycyllysylisoleucylthreonylisoleucylprolylthreonylphenylalanyllysylp–
rolylaspartyllysylisoleucylglutamylleucylserylprolylserylmethionylglutamy–
lalanylprolyllysylisoleucylphenylalanylglutamylarginylisoleucylglutaminyl–
serylglutaminylthreonylvalylglycylglutaminylglycylserylaspartylalanylhist–
idylphenylalanylarginylvalylarginylvalylvalylglycyllysylprolylaspartylpro–
lylglutamylcysteinylglutamyltryptophyltyrosyllysylasparaginylglycylvalyll–
ysylisoleucylglutamylarginylserylaspartylarginylisoleucyltyrosyltryptophy–
ltyrosyltryptophylprolylglutamylaspartylasparaginylvalylcysteinylglutamyl–
leucylvalylisoleucylarginylaspartylvalylthreonylalanylglutamylaspartylser–
ylalanylserylisoleucylmethionylvalyllysylalanylisoleucylasparaginylisoleu–
cylalanylglycylglutamylthreonylserylserylhistidylalanylphenylalanylleucyl–
leucylvalylglutaminylalanyllysylglutaminylleucylisoleucylthreonylphenylal–
anylthreonylglutaminylglutamylleucylglutaminylaspartylvalylvalylalanyllys–
ylglutamyllysylaspartylthreonylmethionylalanylthreonylphenylalanylglutamy–
lcysteinylglutamylthreonylserylglutamylprolylphenylalanylvalyllysylvalyll–
ysyltryptophyltyrosyllysylaspartylglycylmethionylglutamylvalylhistidylglu–
tamylglycylaspartyllysyltyrosylarginylmethionylhistidylserylaspartylargin–
yllysylvalylhistidylphenylalanylleucylserylisoleucylleucylthreonylisoleuc–
ylaspartylthreonylserylaspartylalanylglutamylaspartyltyrosylserylcysteiny–
lvalylleucylvalylglutamylaspartylglutamylasparaginylvalyllysylthreonylthr–
eonylalanyllysylleucylisoleucylvalylglutamylglycylalanylvalylvalylglutamy–
lphenylalanylvalyllysylglutamylleucylglutaminylaspartylisoleucylglutamylv–
alylprolylglutamylseryltyrosylserylglycylglutamylleucylglutamylcysteinyli–
soleucylvalylserylprolylglutamylasparaginylisoleucylglutamylglycyllysyltr–
yptophyltyrosylhistidylasparaginylaspartylvalylglutamylleucyllysylserylas–
paraginylglycyllysyltyrosylthreonylisoleucylthreonylserylarginylarginylgl–
ycylarginylglutaminylasparaginylleucylthreonylvalyllysylaspartylvalylthre–
onyllysylglutamylaspartylglutaminylglycylglutamyltyrosylserylphenylalanyl–
valylisoleucylaspartylglycyllysyllysylthreonylthreonylcysteinyllysylleucy–
llysylmethionyllysylprolylarginylprolylisoleucylalanylisoleucylleucylglut–
aminylglycylleucylserylaspartylglutaminyllysylvalylcysteinylglutamylglycy–
laspartylisoleucylvalylglutaminylleucylglutamylvalyllysylvalylserylleucyl–
glutamylserylvalylglutamylglycylvalyltryptophylmethionyllysylaspartylglyc–
ylglutaminylglutamylvalylglutaminylprolylserylaspartylarginylvalylhistidy–
lisoleucylvalylisoleucylaspartyllysylglutaminylserylhistidylmethionylleuc–
ylleucylisoleucylglutamylaspartylmethionylthreonyllysylglutamylaspartylal–
anylglycylasparaginyltyrosylserylphenylalanylthreonylisoleucylprolylalany–
lleucylglycylleucylserylthreonylserylglycylarginylvalylserylvalyltyrosyls–
erylvalylaspartylvalylisoleucylthreonylprolylleucyllysylaspartylvalylaspa–
raginylvalylisoleucylglutamylglycylthreonyllysylalanylvalylleucylglutamyl–
cysteinyllysylvalylserylvalylprolylaspartylvalylthreonylserylvalyllysyltr–
yptophyltyrosylleucylasparaginylaspartylglutamylglutaminylisoleucyllysylp–
rolylaspartylaspartylarginylvalylglutaminylalanylisoleucylvalyllysylglycy–
lthreonyllysylglutaminylarginylleucylvalylisoleucylasparaginylarginylthre–
onylhistidylalanylserylaspartylglutamylglycylprolyltyrosyllysylleucylisol–
eucylvalylglycylarginylvalylglutamylthreonylasparaginylcysteinylasparagin–
ylleucylserylvalylglutamyllysylisoleucyllysylisoleucylisoleucylarginylgly–
cylleucylarginylaspartylleucylthreonylcysteinylthreonylglutamylthreonylgl–
utaminylasparaginylvalylvalylphenylalanylglutamylvalylglutamylleucylseryl–
histidylserylglycylisoleucylaspartylvalylleucyltryptophylasparaginylpheny–
lalanyllysylaspartyllysylglutamylisoleucyllysylprolylserylseryllysyltyros–
yllysylisoleucylglutamylalanylhistidylglycyllysylisoleucyltyrosyllysylleu–
cylthreonylvalylleucylasparaginylmethionylmethionyllysylaspartylaspartylg–
lutamylglycyllysyltyrosylthreonylphenylalanyltyrosylalanylglycylglutamyla–
sparaginylmethionylthreonylserylglycyllysylleucylthreonylvalylalanylglycy–
lglycylalanylisoleucylseryllysylprolylleucylthreonylaspartylglutaminylthr–
eonylvalylalanylglutamylserylglutaminylglutamylalanylvalylphenylalanylglu–
tamylcysteinylglutamylvalylalanylasparaginylprolylaspartylseryllysylglycy–
lglutamyltryptophylleucylarginylaspartylglycyllysylhistidylleucylprolylle–
ucylthreonylasparaginylasparaginylisoleucylarginylserylglutamylserylaspar–
tylglycylhistidyllysylarginylarginylleucylisoleucylisoleucylalanylalanylt–
hreonyllysylleucylaspartylaspartylisoleucylglycylglutamyltyrosylthreonylt–
yrosyllysylvalylalanylthreonylseryllysylthreonylserylalanyllysylleucyllys–
ylvalylglutamylalanylvalyllysylisoleucyllysyllysylthreonylleucyllysylaspa–
raginylleucylthreonylvalylthreonylglutamylthreonylglutaminylaspartylalany–
lvalylphenylalanylthreonylvalylglutamylleucylthreonylhistidylprolylaspara–
ginylvalyllysylglycylvalylglutaminyltryptophylisoleucyllysylasparaginylgl–
ycylvalylvalylleucylglutamylserylasparaginylglutamyllysyltyrosylalanyliso–
leucylserylvalyllysylglycylthreonylisoleucyltyrosylserylleucylarginylisol–
eucyllysylasparaginylcysteinylalanylisoleucylvalylaspartylglutamylserylva–
lyltyrosylglycylphenylalanylarginylleucylglycylarginylleucylglycylalanyls–
erylalanylarginylleucylhistidylvalylglutamylthreonylvalyllysylisoleucylis–
oleucyllysyllysylprolyllysylaspartylvalylthreonylalanylleucylglutamylaspa–
raginylalanylthreonylvalylalanylphenylalanylglutamylvalylserylvalylserylh–
istidylaspartylthreonylvalylprolylvalyllysyltryptophylphenylalanylhistidy–
llysylserylvalylglutamylisoleucyllysylprolylserylaspartyllysylhistidylarg–
inylleucylvalylserylglutamylarginyllysylvalylhistidyllysylleucylmethionyl–
leucylglutaminylasparaginylisoleucylserylprolylserylaspartylalanylglycylg–
lutamyltyrosylthreonylalanylvalylvalylglycylglutaminylleucylglutamylcyste–
inyllysylalanyllysylleucylphenylalanylvalylglutamylthreonylleucylhistidyl–
isoleucylthreonyllysylthreonylmethionyllysylasparaginylisoleucylglutamylv–
alylprolylglutamylthreonyllysylthreonylalanylserylphenylalanylglutamylcys–
teinylglutamylvalylserylhistidylphenylalanylasparaginylvalylprolylserylme–
thionyltryptophylleucyllysylasparaginylglycylvalylglutamylisoleucylglutam–
ylmethionylserylglutamyllysylphenylalanyllysylisoleucylvalylvalylglutamin–
ylglycyllysylleucylhistidylglutaminylleucylisoleucylisoleucylmethionylasp–
araginylthreonylserylthreonylglutamylaspartylserylalanylglutamyltyrosylth–
reonylphenylalanylvalylcysteinylglycylasparaginylaspartylglutaminylvalyls–
erylalanylthreonylleucylthreonylvalylthreonylprolylisoleucylmethionylisol–
eucylthreonylserylmethionylleucyllysylaspartylisoleucylasparaginylalanylg–
lutamylglutamyllysylaspartylthreonylisoleucylthreonylphenylalanylglutamyl–
valylthreonylvalylasparaginyltyrosylglutamylglycylisoleucylseryltyrosylly–
syltryptophylleucyllysylasparaginylglycylvalylglutamylisoleucyllysylseryl–
threonylaspartyllysylcysteinylglutaminylmethionylarginylthreonyllysyllysy–
lleucylthreonylhistidylserylleucylasparaginylisoleucylarginylasparaginylv–
alylhistidylphenylalanylglycylaspartylalanylalanylaspartyltyrosylthreonyl–
phenylalanylvalylalanylglycyllysylalanylthreonylserylthreonylalanylthreon–
ylleucyltyrosylvalylglutamylalanylarginylhistidylisoleucylglutamylphenyla–
lanylarginyllysylhistidylisoleucyllysylaspartylisoleucyllysylvalylleucylg–
lutamyllysyllysylarginylalanylmethionylphenylalanylglutamylcysteinylgluta–
mylvalylserylglutamylprolylaspartylisoleucylthreonylvalylglutaminyltrypto–
phylmethionyllysylaspartylaspartylglutaminylglutamylleucylglutaminylisole–
ucylthreonylaspartylarginylisoleucyllysylisoleucylglutaminyllysylglutamyl–
lysyltyrosylvalylhistidylarginylleucylleucylisoleucylprolylserylthreonyla–
rginylmethionylserylaspartylalanylglycyllysyltyrosylthreonylvalylvalylala–
nylglycylglycylasparaginylvalylserylthreonylalanyllysylleucylphenylalanyl–
valylglutamylglycylarginylaspartylvalylarginylisoleucylarginylserylisoleu–
cyllysyllysylglutamylvalylglutaminylvalylisoleucylglutamyllysylglutaminyl–
arginylalanylvalylvalylglutamylphenylalanylglutamylvalylasparaginylglutam–
ylaspartylaspartylvalylaspartylalanylhistidyltryptophyltyrosyllysylaspart–
ylglycylisoleucylglutamylisoleucylasparaginylphenylalanylglutaminylvalylg–
lutaminylglutamylarginylhistidyllysyltyrosylvalylvalylglutamylarginylargi–
nylisoleucylhistidylarginylmethionylphenylalanylisoleucylserylglutamylthr–
eonylarginylglutaminylserylaspartylalanylglycylglutamyltyrosylthreonylphe–
nylalanylvalylalanylglycylarginylasparaginylarginylserylserylvalylthreony–
lleucyltyrosylvalylasparaginylalanylprolylglutamylprolylprolylglutaminylv–
alylleucylglutaminylglutamylleucylglutaminylprolylvalylthreonylvalylgluta–
minylserylglycyllysylprolylalanylarginylphenylalanylcysteinylalanylmethio–
nylisoleucylserylglycylarginylprolylglutaminylprolyllysylisoleucylseryltr–
yptophyltyrosyllysylglutamylglutamylglutaminylleucylleucylserylthreonylgl–
ycylphenylalanyllysylcysteinyllysylphenylalanylleucylhistidylaspartylglyc–
ylglutaminylglutamyltyrosylthreonylleucylleucylleucylisoleucylglutamylala–
nylphenylalanylprolylglutamylaspartylalanylalanylvalyltyrosylthreonylcyst–
einylglutamylalanyllysylasparaginylaspartyltyrosylglycylvalylalanylthreon–
ylthreonylserylalanylserylleucylserylvalylglutamylvalylprolylglutamylvaly–
lvalylserylprolylaspartylglutaminylglutamylmethionylprolylvalyltyrosylpro–
lylprolylalanylisoleucylisoleucylthreonylprolylleucylglutaminylaspartylth–
reonylvalylthreonylserylglutamylglycylglutaminylprolylalanylarginylphenyl–
alanylglutaminylcysteinylarginylvalylserylglycylthreonylaspartylleucyllys–
ylvalylseryltryptophyltyrosylseryllysylaspartyllysyllysylisoleucyllysylpr–
olylserylarginylphenylalanylphenylalanylarginylmethionylthreonylglutaminy–
lphenylalanylglutamylaspartylthreonyltyrosylglutaminylleucylglutamylisole–
ucylalanylglutamylalanyltyrosylprolylglutamylaspartylglutamylglycylthreon–
yltyrosylthreonylphenylalanylvalylalanylasparaginylasparaginylalanylvalyl–
glycylglutaminylvalylserylserylthreonylalanylasparaginylleucylserylleucyl–
glutamylalanylprolylglutamylserylisoleucylleucylhistidylglutamylarginylis–
oleucylglutamylglutaminylglutamylisoleucylglutamylmethionylglutamylmethio–
nyllysylglutamylphenylalanylserylserylserylphenylalanylleucylserylalanylg–
lutamylglutamylglutamylglycylleucylhistidylserylalanylglutamylleucylgluta–
minylleucylseryllysylisoleucylasparaginylglutamylthreonylleucylglutamylle–
ucylleucylserylglutamylserylprolylvalyltyrosylprolylthreonyllysylphenylal–
anylaspartylserylglutamyllysylglutamylglycylthreonylglycylprolylisoleucyl–
phenylalanylisoleucyllysylglutamylvalylserylasparaginylalanylaspartylisol–
eucylserylmethionylglycylaspartylvalylalanylthreonylleucylserylvalylthreo–
nylvalylisoleucylglycylisoleucylprolyllysylprolyllysylisoleucylglutaminyl–
tryptophylphenylalanylphenylalanylasparaginylglycylvalylleucylleucylthreo–
nylprolylserylalanylaspartyltyrosyllysylphenylalanylvalylphenylalanylaspa–
rtylglycylaspartylaspartylhistidylserylleucylisoleucylisoleucylleucylphen–
ylalanylthreonyllysylleucylglutamylaspartylglutamylglycylglutamyltyrosylt–
hreonylcysteinylmethionylalanylserylasparaginylaspartyltyrosylglycyllysyl–
threonylisoleucylcysteinylserylalanyltyrosylleucyllysylisoleucylasparagin–
ylseryllysylglycylglutamylglycylhistidyllysylaspartylthreonylglutamylthre–
onylglutamylserylalanylvalylalanyllysylserylleucylglutamyllysylleucylglyc–
ylglycylprolylcysteinylprolylprolylhistidylphenylalanylleucyllysylglutamy–
lleucyllysylprolylisoleucylarginylcysteinylalanylglutaminylglycylleucylpr–
olylalanylisoleucylphenylalanylglutamyltyrosylthreonylvalylvalylglycylglu–
tamylprolylalanylprolylthreonylvalylthreonyltryptophylphenylalanyllysylgl–
utamylasparaginyllysylglutaminylleucylcysteinylthreonylserylvalyltyrosylt–
yrosylthreonylisoleucylisoleucylhistidylasparaginylprolylasparaginylglycy–
lserylglycylthreonylphenylalanylisoleucylvalylasparaginylaspartylprolylgl–
utaminylarginylglutamylaspartylserylglycylleucyltyrosylisoleucylcysteinyl–
lysylalanylglutamylasparaginylmethionylleucylglycylglutamylserylthreonylc–
ysteinylalanylalanylglutamylleucylleucylvalylleucylleucylglutamylaspartyl–
threonylaspartylmethionylthreonylaspartylthreonylprolylcysteinyllysylalan–
yllysylserylthreonylprolylglutamylalanylprolylglutamylaspartylphenylalany–
lprolylglutaminylthreonylprolylleucyllysylglycylprolylalanylvalylglutamyl–
alanylleucylaspartylserylglutamylglutaminylglutamylisoleucylalanylthreony–
lphenylalanylvalyllysylaspartylthreonylisoleucylleucyllysylalanylalanylle–
ucylisoleucylthreonylglutamylglutamylasparaginylglutaminylglutaminylleucy–
lseryltyrosylglutamylhistidylisoleucylalanyllysylalanylasparaginylglutamy–
lleucylserylserylglutaminylleucylprolylleucylglycylalanylglutaminylglutam–
ylleucylglutaminylserylisoleucylleucylglutamylglutaminylaspartyllysylleuc–
ylthreonylprolylglutamylserylthreonylarginylglutamylphenylalanylleucylcys–
teinylisoleucylasparaginylglycylserylisoleucylhistidylphenylalanylglutami–
nylprolylleucyllysylglutamylprolylserylprolylasparaginylleucylglutaminyll–
eucylglutaminylisoleucylvalylglutaminylserylglutaminyllysylthreonylphenyl–
alanylseryllysylglutamylglycylisoleucylleucylmethionylprolylglutamylgluta–
mylprolylglutamylthreonylglutaminylalanylvalylleucylserylaspartylthreonyl–
glutamyllysylisoleucylphenylalanylprolylserylalanylmethionylserylisoleucy–
lglutamylglutaminylisoleucylasparaginylserylleucylthreonylvalylglutamylpr–
olylleucyllysylthreonylleucylleucylalanylglutamylprolylglutamylglycylaspa–
raginyltyrosylprolylglutaminylserylserylisoleucylglutamylprolylprolylmeth–
ionylhistidylseryltyrosylleucylthreonylserylvalylalanylglutamylglutamylva–
lylleucylserylleucyllysylglutamyllysylthreonylvalylserylaspartylthreonyla–
sparaginylarginylglutamylglutaminylarginylvalylthreonylleucylglutaminylly–
sylglutaminylglutamylalanylglutaminylserylalanylleucylisoleucylleucylsery–
lglutaminylserylleucylalanylglutamylglycylhistidylvalylglutamylserylleucy–
lglutaminylserylprolylaspartylvalylmethionylisoleucylserylglutaminylvalyl–
asparaginyltyrosylglutamylprolylleucylvalylprolylserylglutamylhistidylser–
ylcysteinylthreonylglutamylglycylglycyllysylisoleucylleucylisoleucylgluta–
mylserylalanylasparaginylprolylleucylglutamylasparaginylalanylglycylgluta–
minylaspartylserylalanylvalylarginylisoleucylglutamylglutamylglycyllysyls–
erylleucylarginylphenylalanylprolylleucylalanylleucylglutamylglutamyllysy–
lglutaminylvalylleucylleucyllysylglutamylglutamylhistidylserylaspartylasp–
araginylvalylvalylmethionylprolylprolylaspartylglutaminylisoleucylisoleuc–
ylglutamylseryllysylarginylglutamylprolylvalylalanylisoleucyllysyllysylva–
lylglutaminylglutamylvalylglutaminylglycylarginylaspartylleucylleucylsery–
llysylglutamylserylleucylleucylserylglycylisoleucylprolylglutamylglutamyl–
glutaminylarginylleucylasparaginylleucyllysylisoleucylglutaminylisoleucyl–
cysteinylarginylalanylleucylglutaminylalanylalanylvalylalanylserylglutamy–
lglutaminylprolylglycylleucylphenylalanylserylglutamyltryptophylleucylarg–
inylasparaginylisoleucylglutamyllysylvalylglutamylvalylglutamylalanylvaly–
lasparaginylisoleucylthreonylglutaminylglutamylprolylarginylhistidylisole–
ucylmethionylcysteinylmethionyltyrosylleucylvalylthreonylserylalanyllysyl–
serylvalylthreonylglutamylglutamylvalylthreonylisoleucylisoleucylisoleucy–
lglutamylaspartylvalylaspartylprolylglutaminylmethionylalanylasparaginyll–
eucyllysylmethionylglutamylleucylarginylaspartylalanylleucylcysteinylalan–
ylisoleucylisoleucyltyrosylglutamylglutamylisoleucylaspartylisoleucylleuc–
ylthreonylalanylglutamylglycylprolylarginylisoleucylglutaminylglutaminylg–
lycylalanyllysylthreonylserylleucylglutaminylglutamylglutamylmethionylasp–
artylserylphenylalanylserylglycylserylglutaminyllysylvalylglutamylprolyli–
soleucylthreonylglutamylprolylglutamylvalylglutamylseryllysyltyrosylleucy–
lisoleucylserylthreonylglutamylglutamylvalylseryltyrosylphenylalanylaspar–
aginylvalylglutaminylserylarginylvalyllysyltyrosylleucylaspartylalanylthr–
eonylprolylvalylthreonyllysylglycylvalylalanylserylalanylvalylvalylseryla–
spartylglutamyllysylglutaminylaspartylglutamylserylleucyllysylprolylseryl–
glutamylglutamyllysylglutamylglutamylserylserylserylglutamylserylglycylth–
reonylglutamylglutamylvalylalanylthreonylvalyllysylisoleucylglutaminylglu–
tamylalanylglutamylglycylglycylleucylisoleucyllysylglutamylaspartylglycyl–
prolylmethionylisoleucylhistidylthreonylprolylleucylvalylaspartylthreonyl–
valylserylglutamylglutamylglycylaspartylisoleucylvalylhistidylleucylthreo–
nylthreonylserylisoleucylthreonylasparaginylalanyllysylglutamylvalylaspar–
aginyltryptophyltyrosylphenylalanylglutamylasparaginyllysylleucylvalylpro–
lylserylaspartylglutamyllysylphenylalanyllysylcysteinylleucylglutaminylas–
partylglutaminylasparaginylthreonyltyrosylthreonylleucylvalylisoleucylasp–
artyllysylvalylasparaginylthreonylglutamylaspartylhistidylglutaminylglycy–
lglutamyltyrosylvalylcysteinylglutamylalanylleucylasparaginylaspartylsery–
lglycyllysylthreonylalanylthreonylserylalanyllysylleucylthreonylvalylvaly–
llysylarginylalanylalanylprolylvalylisoleucyllysylarginyllysylisoleucylgl–
utamylprolylleucylglutamylvalylalanylleucylglycylhistidylleucylalanyllysy–
lphenylalanylthreonylcysteinylglutamylisoleucylglutaminylserylalanylproly–
lasparaginylvalylarginylphenylalanylglutaminyltryptophylphenylalanyllysyl–
alanylglycylarginylglutamylisoleucyltyrosylglutamylserylaspartyllysylcyst–
einylserylisoleucylarginylserylseryllysyltyrosylisoleucylserylserylleucyl–
glutamylisoleucylleucylarginylthreonylglutaminylvalylvalylaspartylcystein–
ylglycylglutamyltyrosylthreonylcysteinyllysylalanylserylasparaginylglutam–
yltyrosylglycylserylvalylserylcysteinylthreonylalanylthreonylleucylthreon–
ylvalylthreonylvalylprolylglycylglycylglutamyllysyllysylvalylarginyllysyl–
leucylleucylprolylglutamylarginyllysylprolylglutamylprolyllysylglutamylgl–
utamylvalylvalylleucyllysylserylvalylleucylarginyllysylarginylprolylgluta–
mylglutamylglutamylglutamylprolyllysylvalylglutamylprolyllysyllysylleucyl–
glutamyllysylvalyllysyllysylprolylalanylvalylprolylglutamylprolylprolylpr–
olylprolyllysylprolylvalylglutamylglutamylvalylglutamylvalylprolylthreony–
lvalylthreonyllysylarginylglutamylarginyllysylisoleucylprolylglutamylprol–
ylthreonyllysylvalylprolylglutamylisoleucyllysylprolylalanylisoleucylprol–
ylleucylprolylalanylprolylglutamylprolyllysylprolyllysylprolylglutamylala–
nylglutamylvalyllysylthreonylisoleucyllysylprolylprolylprolylvalylglutamy–
lprolylglutamylprolylthreonylprolylisoleucylalanylalanylprolylvalylthreon–
ylvalylprolylvalylvalylglycyllysyllysylalanylglutamylalanyllysylalanylpro–
lyllysylglutamylglutamylalanylalanyllysylprolyllysylglycylprolylisoleucyl–
lysylglycylvalylprolyllysyllysylthreonylprolylserylprolylisoleucylglutamy–
lalanylglutamylarginylarginyllysylleucylarginylprolylglycylserylglycylgly–
cylglutamyllysylprolylprolylaspartylglutamylalanylprolylphenylalanylthreo–
nyltyrosylglutaminylleucyllysylalanylvalylprolylleucyllysylphenylalanylva–
lyllysylglutamylisoleucyllysylaspartylisoleucylisoleucylleucylthreonylglu–
tamylserylglutamylphenylalanylvalylglycylserylserylalanylisoleucylphenyla–
lanylglutamylcysteinylleucylvalylserylprolylserylthreonylalanylisoleucylt–
hreonylthreonyltryptophylmethionyllysylaspartylglycylserylasparaginylisol–
eucylarginylglutamylserylprolyllysylhistidylarginylphenylalanylisoleucyla–
lanylaspartylglycyllysylaspartylarginyllysylleucylhistidylisoleucylisoleu–
cylaspartylvalylglutaminylleucylserylaspartylalanylglycylglutamyltyrosylt–
hreonylcysteinylvalylleucylarginylleucylglycylasparaginyllysylglutamyllys–
ylthreonylserylthreonylalanyllysylleucylvalylvalylglutamylglutamylleucylp–
rolylvalylarginylphenylalanylvalyllysylthreonylleucylglutamylglutamylglut–
amylvalylthreonylvalylvalyllysylglycylglutaminylprolylleucyltyrosylleucyl–
serylcysteinylglutamylleucylasparaginyllysylglutamylarginylaspartylvalylv–
alyltryptophylarginyllysylaspartylglycyllysylisoleucylvalylvalylglutamyll–
ysylprolylglycylarginylisoleucylvalylprolylglycylvalylisoleucylglycylleuc–
ylmethionylarginylalanylleucylthreonylisoleucylasparaginylaspartylalanyla–
spartylaspartylthreonylaspartylalanylglycylthreonyltyrosylthreonylvalylth–
reonylvalylglutamylasparaginylalanylasparaginylasparaginylleucylglutamylc–
ysteinylserylserylcysteinylvalyllysylvalylvalylglutamylvalylisoleucylargi–
nylaspartyltryptophylleucylvalyllysylprolylisoleucylarginylaspartylglutam–
inylhistidylvalyllysylprolyllysylglycylthreonylalanylisoleucylphenylalany–
lalanylcysteinylaspartylisoleucylalanyllysylaspartylthreonylprolylasparag–
inylisoleucyllysyltryptophylphenylalanyllysylglycyltyrosylaspartylglutamy–
lisoleucylprolylalanylglutamylprolylasparaginylaspartyllysylthreonylgluta–
mylisoleucylleucylarginylaspartylglycylasparaginylhistidylleucyltyrosylle–
ucyllysylisoleucyllysylasparaginylalanylmethionylprolylglutamylaspartylis–
oleucylalanylglutamyltyrosylalanylvalylglutamylisoleucylglutamylglycyllys–
ylarginyltyrosylprolylalanyllysylleucylthreonylleucylglycylglutamylarginy–
lglutamylvalylglutamylleucylleucyllysylprolylisoleucylglutamylaspartylval–
ylthreonylisoleucyltyrosylglutamyllysylglutamylserylalanylserylphenylalan–
ylaspartylalanylglutamylisoleucylserylglutamylalanylaspartylisoleucylprol–
ylglycylglutaminyltryptophyllysylleucyllysylglycylglutamylleucylleucylarg–
inylprolylserylprolylthreonylcysteinylglutamylisoleucyllysylalanylglutamy–
lglycylglycyllysylarginylphenylalanylleucylthreonylleucylhistidyllysylval–
yllysylleucylaspartylglutaminylalanylglycylglutamylvalylleucyltyrosylglut–
aminylalanylleucylasparaginylalanylisoleucylthreonylthreonylalanylisoleuc–
ylleucylthreonylvalyllysylglutamylisoleucylglutamylleucylaspartylphenylal–
anylalanylvalylprolylleucyllysylaspartylvalylthreonylvalylprolylglutamyla–
rginylarginylglutaminylalanylarginylphenylalanylglutamylcysteinylvalylleu–
cylthreonylarginylglutamylalanylasparaginylvalylisoleucyltryptophylseryll–
ysylglycylprolylaspartylisoleucylisoleucyllysylserylserylaspartyllysylphe–
nylalanylaspartylisoleucylisoleucylalanylaspartylglycyllysyllysylhistidyl–
isoleucylleucylvalylisoleucylasparaginylaspartylserylglutaminylphenylalan–
ylaspartylaspartylglutamylglycylvalyltyrosylthreonylalanylglutamylvalylgl–
utamylglycyllysyllysylthreonylserylalanylarginylleucylphenylalanylvalylth–
reonylglycylisoleucylarginylleucyllysylphenylalanylmethionylserylprolylle–
ucylglutamylaspartylglutaminylthreonylvalyllysylglutamylglycylglutamylthr–
eonylalanylthreonylphenylalanylvalylcysteinylglutamylleucylserylhistidylg–
lutamyllysylmethionylhistidylvalylvalyltryptophylphenylalanyllysylasparag–
inylaspartylalanyllysylleucylhistidylthreonylserylarginylthreonylvalylleu–
cylisoleucylserylserylglutamylglycyllysylthreonylhistidyllysylleucylgluta–
mylmethionyllysylglutamylvalylthreonylleucylaspartylaspartylisoleucylsery–
lglutaminylisoleucyllysylalanylglutaminylvalyllysylglutamylleucylserylser–
ylthreonylalanylglutaminylleucyllysylvalylleucylglutamylalanylaspartylpro–
lyltyrosylphenylalanylthreonylvalyllysylleucylhistidylaspartyllysylthreon–
ylalanylvalylglutamyllysylaspartylglutamylisoleucylthreonylleucyllysylcys–
teinylglutamylvalylseryllysylaspartylvalylprolylvalyllysyltryptophylpheny–
lalanyllysylaspartylglycylglutamylglutamylisoleucylvalylprolylserylprolyl–
lysyltyrosylserylisoleucyllysylalanylaspartylglycylleucylarginylarginylis–
oleucylleucyllysylisoleucyllysyllysylalanylaspartylleucyllysylaspartyllys–
ylglycylglutamyltyrosylvalylcysteinylaspartylcysteinylglycylthreonylaspar–
tyllysylthreonyllysylalanylasparaginylvalylthreonylvalylglutamylalanylarg–
inylleucylisoleucylglutamylvalylglutamyllysylprolylleucyltyrosylglycylval–
ylglutamylvalylphenylalanylvalylglycylglutamylthreonylalanylhistidylpheny–
lalanylglutamylisoleucylglutamylleucylserylglutamylprolylaspartylvalylhis–
tidylglycylglutaminyltryptophyllysylleucyllysylglycylglutaminylprolylleuc–
ylthreonylalanylserylprolylaspartylcysteinylglutamylisoleucylisoleucylglu–
tamylaspartylglycyllysyllysylhistidylisoleucylleucylisoleucylleucylhistid–
ylasparaginylcysteinylglutaminylleucylglycylmethionylthreonylglycylglutam–
ylvalylserylphenylalanylglutaminylalanylalanylasparaginylalanyllysylseryl–
alanylalanylasparaginylleucyllysylvalyllysylglutamylleucylprolylleucyliso–
leucylphenylalanylisoleucylthreonylprolylleucylserylaspartylvalyllysylval–
ylphenylalanylglutamyllysylaspartylglutamylalanyllysylphenylalanylglutamy–
lcysteinylglutamylvalylserylarginylglutamylprolyllysylthreonylphenylalany–
larginyltryptophylleucyllysylglycylthreonylglutaminylglutamylisoleucylthr–
eonylglycylaspartylaspartylarginylphenylalanylglutamylleucylisoleucyllysy–
laspartylglycylthreonyllysylhistidylserylmethionylvalylisoleucyllysylsery–
lalanylalanylphenylalanylglutamylaspartylglutamylalanyllysyltyrosylmethio–
nylphenylalanylglutamylalanylglutamylaspartyllysylhistidylthreonylserylgl–
ycyllysylleucylisoleucylisoleucylglutamylglycylisoleucylarginylleucyllysy–
lphenylalanylleucylthreonylprolylleucyllysylaspartylvalylthreonylalanylly–
sylglutamyllysylglutamylserylalanylvalylphenylalanylthreonylvalylglutamyl–
leucylserylhistidylaspartylasparaginylisoleucylarginylvalyllysyltryptophy–
lphenylalanyllysylasparaginylaspartylglutaminylarginylleucylhistidylthreo–
nylthreonylarginylserylvalylserylmethionylglutaminylaspartylglutamylglycy–
llysylthreonylhistidylserylisoleucylthreonylphenylalanyllysylaspartylleuc–
ylserylisoleucylaspartylaspartylthreonylserylglutaminylisoleucylarginylva–
lylglutamylalanylmethionylglycylmethionylserylserylglutamylalanyllysylleu–
cylthreonylvalylleucylglutamylglycylaspartylprolyltyrosylphenylalanylthre–
onylglycyllysylleucylglutaminylaspartyltyrosylthreonylglycylvalylglutamyl–
lysylaspartylglutamylvalylisoleucylleucylglutaminylcysteinylglutamylisole–
ucylseryllysylalanylaspartylalanylprolylvalyllysyltryptophylphenylalanyll–
ysylaspartylglycyllysylglutamylisoleucyllysylprolylseryllysylasparaginyla–
lanylvalylisoleucyllysylthreonylaspartylglycyllysyllysylarginylmethionyll–
eucylisoleucylleucyllysyllysylalanylleucyllysylserylaspartylisoleucylglyc–
ylglutaminyltyrosylthreonylcysteinylaspartylcysteinylglycylthreonylaspart–
yllysylthreonylserylglycyllysylleucylaspartylisoleucylglutamylaspartylarg–
inylglutamylisoleucyllysylleucylvalylarginylprolylleucylhistidylserylvaly–
lglutamylvalylmethionylglutamylthreonylglutamylthreonylalanylarginylpheny–
lalanylglutamylthreonylglutamylisoleucylserylglutamylaspartylaspartylisol–
eucylhistidylalanylasparaginyltryptophyllysylleucyllysylglycylglutamylala–
nylleucylleucylglutaminylthreonylprolylaspartylcysteinylglutamylisoleucyl–
lysylglutamylglutamylglycyllysylisoleucylhistidylserylleucylvalylleucylhi–
stidylasparaginylcysteinylarginylleucylaspartylglutaminylthreonylglycylgl–
ycylvalylaspartylphenylalanylglutaminylalanylalanylasparaginylvalyllysyls–
erylserylalanylhistidylleucylarginylvalyllysylprolylarginylvalylisoleucyl–
glycylleucylleucylarginylprolylleucyllysylaspartylvalylthreonylvalylthreo–
nylalanylglycylglutamylthreonylalanylthreonylphenylalanylaspartylcysteiny–
lglutamylleucylseryltyrosylglutamylaspartylisoleucylprolylvalylglutamyltr–
yptophyltyrosylleucyllysylglycyllysyllysylleucylglutamylprolylserylaspart–
yllysylvalylvalylprolylarginylserylglutamylglycyllysylvalylhistidylthreon–
ylleucylthreonylleucylarginylaspartylvalyllysylleucylglutamylaspartylalan–
ylglycylglutamylvalylglutaminylleucylthreonylalanyllysylaspartylphenylala–
nyllysylthreonylhistidylalanylasparaginylleucylphenylalanylvalyllysylglut–
amylprolylprolylvalylglutamylphenylalanylthreonyllysylprolylleucylglutamy–
laspartylglutaminylthreonylvalylglutamylglutamylglycylalanylthreonylalany–
lvalylleucylglutamylcysteinylglutamylvalylserylarginylglutamylasparaginyl–
alanyllysylvalyllysyltryptophylphenylalanyllysylasparaginylglycylthreonyl–
glutamylisoleucylleucyllysylseryllysyllysyltyrosylglutamylisoleucylvalyla–
lanylaspartylglycylarginylvalylarginyllysylleucylvalylisoleucylhistidylas–
partylcysteinylthreonylprolylglutamylaspartylisoleucyllysylthreonyltyrosy–
lthreonylcysteinylaspartylalanyllysylaspartylphenylalanyllysylthreonylser–
ylcysteinylasparaginylleucylasparaginylvalylvalylprolylprolylhistidylvaly–
lglutamylphenylalanylleucylarginylprolylleucylthreonylaspartylleucylgluta–
minylvalylarginylglutamyllysylglutamylmethionylalanylarginylphenylalanylg–
lutamylcysteinylglutamylleucylserylarginylglutamylasparaginylalanyllysylv–
alyllysyltryptophylphenylalanyllysylaspartylglycylalanylglutamylisoleucyl–
lysyllysylglycyllysyllysyltyrosylaspartylisoleucylisoleucylseryllysylglyc–
ylalanylvalylarginylisoleucylleucylvalylisoleucylasparaginyllysylcysteiny–
lleucylleucylaspartylaspartylglutamylalanylglutamyltyrosylserylcysteinylg–
lutamylvalylarginylthreonylalanylarginylthreonylserylglycylmethionylleucy–
lthreonylvalylleucylglutamylglutamylglutamylalanylvalylphenylalanylthreon–
yllysylasparaginylleucylalanylasparaginylisoleucylglutamylvalylserylgluta–
mylthreonylaspartylthreonylisoleucyllysylleucylvalylcysteinylglutamylvaly–
lseryllysylprolylglycylalanylglutamylvalylisoleucyltryptophyltyrosyllysyl–
glycylaspartylglutamylglutamylisoleucylisoleucylglutamylthreonylglycylarg–
inyltyrosylglutamylisoleucylleucylthreonylglutamylglycylarginyllysylargin–
ylisoleucylleucylvalylisoleucylglutaminylasparaginylalanylhistidylleucylg–
lutamylaspartylalanylglycylasparaginyltyrosylasparaginylcysteinylarginyll–
eucylprolylserylserylarginylthreonylaspartylglycyllysylvalyllysylvalylhis–
tidylglutamylleucylalanylalanylglutamylphenylalanylisoleucylseryllysylpro–
lylglutaminylasparaginylleucylglutamylisoleucylleucylglutamylglycylglutam–
yllysylalanylglutamylphenylalanylvalylcysteinylserylisoleucylseryllysylgl–
utamylserylphenylalanylprolylvalylglutaminyltryptophyllysylarginylasparty–
laspartyllysylthreonylleucylglutamylserylglycylaspartyllysyltyrosylaspart–
ylvalylisoleucylalanylaspartylglycyllysyllysylarginylvalylleucylvalylvaly–
llysylaspartylalanylthreonylleucylglutaminylaspartylmethionylglycylthreon–
yltyrosylvalylvalylmethionylvalylglycylalanylalanylarginylalanylalanylala–
nylhistidylleucylthreonylvalylisoleucylglutamyllysylleucylarginylisoleucy–
lvalylvalylprolylleucyllysylaspartylthreonylarginylvalyllysylglutamylglut–
aminylglutaminylglutamylvalylvalylphenylalanylasparaginylcysteinylglutamy–
lvalylasparaginylthreonylglutamylglycylalanyllysylalanyllysyltryptophylph–
enylalanylarginylasparaginylglutamylglutamylalanylisoleucylphenylalanylas–
partylserylseryllysyltyrosylisoleucylisoleucylleucylglutaminyllysylaspart–
ylleucylvalyltyrosylthreonylleucylarginylisoleucylarginylaspartylalanylhi–
stidylleucylaspartylaspartylglutaminylalanylasparaginyltyrosylasparaginyl–
valylserylleucylthreonylasparaginylhistidylarginylglycylglutamylasparagin–
ylvalyllysylserylalanylalanylasparaginylleucylisoleucylvalylglutamylgluta–
mylglutamylaspartylleucylarginylisoleucylvalylglutamylprolylleucyllysylas–
partylisoleucylglutamylthreonylmethionylglutamyllysyllysylserylvalylthreo–
nylphenylalanyltryptophylcysteinyllysylvalylasparaginylarginylleucylaspar–
aginylvalylthreonylleucyllysyltryptophylthreonyllysylasparaginylglycylglu–
tamylglutamylvalylprolylphenylalanylaspartylasparaginylarginylvalylserylt–
yrosylarginylvalylaspartyllysyltyrosyllysylhistidylmethionylleucylthreony–
lisoleucyllysylaspartylcysteinylglycylphenylalanylprolylaspartylglutamylg–
lycylglutamyltyrosylisoleucylvalylthreonylalanylglycylglutaminylaspartyll–
ysylserylvalylalanylglutamylleucylleucylisoleucylisoleucylglutamylalanylp–
rolylthreonylglutamylphenylalanylvalylglutamylhistidylleucylglutamylaspar–
tylglutaminylthreonylvalylthreonylglutamylphenylalanylaspartylaspartylala–
nylvalylphenylalanylserylcysteinylglutaminylleucylserylarginylglutamyllys–
ylalanylasparaginylvalyllysyltryptophyltyrosylarginylasparaginylglycylarg–
inylglutamylisoleucyllysylglutamylglycyllysyllysyltyrosyllysylphenylalany–
lglutamyllysylaspartylglycylserylisoleucylhistidylarginylleucylisoleucyli–
soleucyllysylaspartylcysteinylarginylleucylaspartylaspartylglutamylcystei–
nylglutamyltyrosylalanylcysteinylglycylvalylglutamylaspartylarginyllysyls–
erylarginylalanylarginylleucylphenylalanylvalylglutamylglutamylisoleucylp–
rolylvalylglutamylisoleucylisoleucylarginylprolylprolylglutaminylaspartyl–
isoleucylleucylglutamylalanylprolylglycylalanylaspartylvalylvalylphenylal–
anylleucylalanylglutamylleucylasparaginyllysylaspartyllysylvalylglutamylv–
alylglutaminyltryptophylleucylarginylasparaginylasparaginylmethionylvalyl–
valylvalylglutaminylglycylaspartyllysylhistidylglutaminylmethionylmethion–
ylserylglutamylglycyllysylisoleucylhistidylarginylleucylglutaminylisoleuc–
ylcysteinylaspartylisoleucyllysylprolylarginylaspartylglutaminylglycylglu–
tamyltyrosylarginylphenylalanylisoleucylalanyllysylaspartyllysylglutamyla–
lanylarginylalanyllysylleucylglutamylleucylalanylalanylalanylprolyllysyli–
soleucyllysylthreonylalanylaspartylglutaminylaspartylleucylvalylvalylaspa–
rtylvalylglycyllysylprolylleucylthreonylmethionylvalylvalylprolyltyrosyla–
spartylalanyltyrosylprolyllysylalanylglutamylalanylglutamyltryptophylphen–
ylalanyllysylglutamylasparaginylglutamylprolylleucylserylthreonyllysylthr–
eonylisoleucylaspartylthreonylthreonylalanylglutamylglutaminylthreonylser–
ylphenylalanylarginylisoleucylleucylglutamylalanyllysyllysylglycylasparty–
llysylglycylarginyltyrosyllysylisoleucylvalylleucylglutaminylasparaginyll–
ysylhistidylglycyllysylalanylglutamylglycylphenylalanylisoleucylasparagin–
ylleucyllysylvalylisoleucylaspartylvalylprolylglycylprolylvalylarginylasp–
araginylleucylglutamylvalylthreonylglutamylthreonylphenylalanylaspartylgl–
ycylglutamylvalylserylleucylalanyltryptophylglutamylglutamylprolylleucylt–
hreonylaspartylglycylglycylseryllysylisoleucylisoleucylglycyltyrosylvalyl–
valylglutamylarginylarginylaspartylisoleucyllysylarginyllysylthreonyltryp–
tophylvalylleucylalanylthreonylaspartylarginylalanylglutamylserylcysteiny–
lglutamylphenylalanylthreonylvalylthreonylglycylleucylglutaminyllysylglyc–
ylglycylvalylglutamyltyrosylleucylphenylalanylarginylvalylserylalanylargi–
nylasparaginylarginylvalylglycylthreonylglycylglutamylprolylvalylglutamyl–
threonylaspartylasparaginylprolylvalylglutamylalanylarginylseryllysyltyro–
sylaspartylvalylprolylglycylprolylprolylleucylasparaginylvalylthreonyliso–
leucylthreonylaspartylvalylasparaginylarginylphenylalanylglycylvalylseryl–
leucylthreonyltryptophylglutamylprolylprolylglutamyltyrosylaspartylglycyl–
glycylalanylglutamylisoleucylthreonylasparaginyltyrosylvalylisoleucylglut–
amylleucylarginylaspartyllysylthreonylserylisoleucylarginyltryptophylaspa–
rtylthreonylalanylmethionylthreonylvalylarginylalanylglutamylaspartylleuc–
ylserylalanylthreonylvalylthreonylaspartylvalylvalylglutamylglycylglutami–
nylglutamyltyrosylserylphenylalanylarginylvalylarginylalanylglutaminylasp–
araginylarginylisoleucylglycylvalylglycyllysylprolylserylalanylalanylthre–
onylprolylphenylalanylvalyllysylvalylalanylaspartylprolylisoleucylglutamy–
larginylprolylserylprolylprolylvalylasparaginylleucylthreonylserylserylas–
partylglutaminylthreonylglutaminylserylserylvalylglutaminylleucyllysyltry–
ptophylglutamylprolylprolylleucyllysylaspartylglycylglycylserylprolylisol–
eucylleucylglycyltyrosylisoleucylisoleucylglutamylarginylcysteinylglutamy–
lglutamylglycyllysylaspartylasparaginyltryptophylisoleucylarginylcysteiny–
lasparaginylmethionyllysylleucylvalylprolylglutamylleucylthreonyltyrosyll–
ysylvalylthreonylglycylleucylglutamyllysylglycylasparaginyllysyltyrosylle–
ucyltyrosylarginylvalylserylalanylglutamylasparaginyllysylalanylglycylval–
ylserylaspartylprolylserylglutamylisoleucylleucylglycylprolylleucylthreon–
ylalanylaspartylaspartylalanylphenylalanylvalylglutamylprolylthreonylmeth–
ionylaspartylleucylserylalanylphenylalanyllysylaspartylglycylleucylglutam–
ylvalylisoleucylvalylprolylasparaginylprolylisoleucylthreonylisoleucylleu–
cylvalylprolylserylthreonylglycyltyrosylprolylarginylprolylthreonylalanyl–
threonyltryptophylcysteinylphenylalanylglycylaspartyllysylvalylleucylglut–
amylthreonylglycylaspartylarginylvalyllysylmethionyllysylthreonylleucylse–
rylalanyltyrosylalanylglutamylleucylvalylisoleucylserylprolylserylglutamy–
larginylserylaspartyllysylglycylisoleucyltyrosylthreonylleucyllysylleucyl–
glutamylasparaginylarginylvalyllysylthreonylisoleucylserylglycylglutamyli–
soleucylaspartylvalylasparaginylvalylisoleucylalanylarginylprolylserylala–
nylprolyllysylglutamylleucyllysylphenylalanylglycylaspartylisoleucylthreo–
nyllysylaspartylserylvalylhistidylleucylthreonyltryptophylglutamylprolylp–
rolylaspartylaspartylaspartylglycylglycylserylprolylleucylthreonylglycylt–
yrosylvalylvalylglutamyllysylarginylglutamylvalylserylarginyllysylthreony–
ltryptophylthreonyllysylvalylmethionylaspartylphenylalanylvalylthreonylas–
partylleucylglutamylphenylalanylthreonylvalylprolylaspartylleucylvalylglu–
taminylglycyllysylglutamyltyrosylleucylphenylalanyllysylvalylcysteinylala–
nylarginylasparaginyllysylcysteinylglycylprolylglycylglutamylprolylalanyl–
tyrosylvalylaspartylglutamylprolylvalylasparaginylmethionylserylthreonylp–
rolylalanylthreonylvalylprolylaspartylprolylprolylglutamylasparaginylvaly–
llysyltryptophylarginylaspartylarginylthreonylalanylasparaginylserylisole–
ucylphenylalanylleucylthreonyltryptophylaspartylprolylprolyllysylasparagi–
nylaspartylglycylglycylserylarginylisoleucyllysylglycyltyrosylisoleucylva–
lylglutamylarginylcysteinylprolylarginylglycylserylaspartyllysyltryptophy–
lvalylalanylcysteinylglycylglutamylprolylvalylalanylglutamylthreonyllysyl–
methionylglutamylvalylthreonylglycylleucylglutamylglutamylglycyllysyltryp–
tophyltyrosylalanyltyrosylarginylvalyllysylthreonylleucylasparaginylargin–
ylglutaminylglycylalanylseryllysylprolylserylarginylprolylthreonylglutamy–
lglutamylisoleucylglutaminylalanylvalylaspartylthreonylglutaminylglutamyl–
alanylprolylglutamylisoleucylphenylalanylleucylaspartylvalyllysylleucylle–
ucylalanylglycylleucylthreonylvalyllysylalanylglycylthreonyllysylisoleucy–
lglutamylleucylprolylalanylthreonylvalylthreonylglycyllysylprolylglutamyl–
prolyllysylisoleucylthreonyltryptophylthreonyllysylalanylaspartylmethiony–
lisoleucylleucyllysylglutaminylaspartyllysylarginylisoleucylthreonylisole–
ucylglutamylasparaginylvalylprolyllysyllysylserylthreonylvalylthreonyliso–
leucylvalylaspartylseryllysylarginylserylaspartylthreonylglycylthreonylty–
rosylisoleucylisoleucylglutamylalanylvalylasparaginylvalylcysteinylglycyl–
arginylalanylthreonylalanylvalylvalylglutamylvalylasparaginylvalylleucyla–
spartyllysylprolylglycylprolylprolylalanylalanylphenylalanylaspartylisole–
ucylthreonylaspartylvalylthreonylasparaginylglutamylserylcysteinylleucyll–
eucylthreonyltryptophylasparaginylprolylprolylarginylaspartylaspartylglyc–
ylglycylseryllysylisoleucylthreonylasparaginyltyrosylvalylvalylglutamylar–
ginylarginylalanylthreonylaspartylserylglutamylvalyltryptophylhistidyllys–
ylleucylserylserylthreonylvalyllysylaspartylthreonylasparaginylphenylalan–
yllysylalanylthreonyllysylleucylisoleucylprolylasparaginyllysylglutamylty–
rosylisoleucylphenylalanylarginylvalylalanylalanylglutamylasparaginylmeth–
ionyltyrosylglycylalanylglycylglutamylprolylvalylglutaminylalanylserylpro–
lylisoleucylthreonylalanyllysyltyrosylglutaminylphenylalanylaspartylproly–
lprolylglycylprolylprolylthreonylarginylleucylglutamylprolylserylaspartyl–
isoleucylthreonyllysylaspartylalanylvalylthreonylleucylthreonyltryptophyl–
cysteinylglutamylprolylaspartylaspartylaspartylglycylglycylserylprolyliso–
leucylthreonylglycyltyrosyltryptophylvalylglutamylarginylleucylaspartylpr–
olylaspartylthreonylaspartyllysyltryptophylvalylarginylcysteinylasparagin–
yllysylmethionylprolylvalyllysylaspartylthreonylthreonyltyrosylarginylval–
yllysylglycylleucylthreonylasparaginyllysyllysyllysyltyrosylarginylphenyl–
alanylarginylvalylleucylalanylglutamylasparaginylleucylalanylglycylprolyl–
glycyllysylprolylseryllysylserylthreonylglutamylprolylisoleucylleucylisol–
eucyllysylaspartylprolylisoleucylaspartylprolylprolyltryptophylprolylprol–
ylglycyllysylprolylthreonylvalyllysylaspartylvalylglycyllysylthreonylsery–
lvalylarginylleucylasparaginyltryptophylthreonyllysylprolylglutamylhistid–
ylaspartylglycylglycylalanyllysylisoleucylglutamylseryltyrosylvalylisoleu–
cylglutamylmethionylleucyllysylthreonylglycylthreonylaspartylglutamyltryp–
tophylvalylarginylvalylalanylglutamylglycylvalylprolylthreonylthreonylglu–
taminylhistidylleucylleucylprolylglycylleucylmethionylglutamylglycylgluta–
minylglutamyltyrosylserylphenylalanylarginylvalylarginylalanylvalylaspara–
ginyllysylalanylglycylglutamylserylglutamylprolylserylglutamylprolylseryl–
aspartylprolylvalylleucylcysteinylarginylglutamyllysylleucyltyrosylprolyl–
prolylserylprolylprolylarginyltryptophylleucylglutamylvalylisoleucylaspar–
aginylisoleucylthreonyllysylasparaginylthreonylalanylaspartylleucyllysylt–
ryptophylthreonylvalylprolylglutamyllysylaspartylglycylglycylserylprolyli–
soleucylthreonylasparaginyltyrosylisoleucylvalylglutamyllysylarginylaspar–
tylvalylarginylarginyllysylglycyltryptophylglutaminylthreonylvalylasparty–
lthreonylthreonylvalyllysylaspartylthreonyllysylcysteinylthreonylvalylthr–
eonylprolylleucylthreonylglutamylglycylserylleucyltyrosylvalylphenylalany–
larginylvalylalanylalanylglutamylasparaginylalanylisoleucylglycylglutamin–
ylserylaspartyltyrosylthreonylglutamylisoleucylglutamylaspartylserylvalyl–
leucylalanyllysylaspartylthreonylphenylalanylthreonylthreonylprolylglycyl–
prolylprolyltyrosylalanylleucylalanylvalylvalylaspartylvalylthreonyllysyl–
arginylhistidylvalylaspartylleucyllysyltryptophylglutamylprolylprolyllysy–
lasparaginylaspartylglycylglycylarginylprolylisoleucylglutaminylarginylty–
rosylvalylisoleucylglutamyllysyllysylglutamylarginylleucylglycylthreonyla–
rginyltryptophylvalyllysylalanylglycyllysylthreonylalanylglycylprolylaspa–
rtylcysteinylasparaginylphenylalanylarginylvalylthreonylaspartylvalylisol–
eucylglutamylglycylthreonylglutamylvalylglutaminylphenylalanylglutaminylv–
alylarginylalanylglutamylasparaginylglutamylalanylglycylvalylglycylhistid–
ylprolylserylglutamylprolylthreonylglutamylisoleucylleucylserylisoleucylg–
lutamylaspartylprolylthreonylserylprolylprolylserylprolylprolylleucylaspa–
rtylleucylhistidylvalylthreonylaspartylalanylglycylarginyllysylhistidylis–
oleucylalanylisoleucylalanyltryptophyllysylprolylprolylglutamyllysylaspar–
aginylglycylglycylserylprolylisoleucylisoleucylglycyltyrosylhistidylvalyl–
glutamylmethionylcysteinylprolylvalylglycylthreonylglutamyllysyltryptophy–
lmethionylarginylvalylasparaginylserylarginylprolylisoleucyllysylaspartyl–
leucyllysylphenylalanyllysylvalylglutamylglutamylglycylvalylvalylprolylas–
partyllysylglutamyltyrosylvalylleucylarginylvalylarginylalanylvalylaspara–
ginylalanylisoleucylglycylvalylserylglutamylprolylserylglutamylisoleucyls–
erylglutamylasparaginylvalylvalylalanyllysylaspartylprolylaspartylcystein–
yllysylprolylthreonylisoleucylaspartylleucylglutamylthreonylhistidylaspar–
tylisoleucylisoleucylvalylisoleucylglutamylglycylglutamyllysylleucylseryl–
isoleucylprolylvalylprolylphenylalanylarginylalanylvalylprolylvalylprolyl–
threonylvalylseryltryptophylhistidyllysylaspartylglycyllysylglutamylvalyl–
lysylalanylserylaspartylarginylleucylthreonylmethionyllysylasparaginylasp–
artylhistidylisoleucylserylalanylhistidylleucylglutamylvalylprolyllysylse–
rylvalylarginylalanylaspartylalanylglycylisoleucyltyrosylthreonylisoleucy–
lthreonylleucylglutamylasparaginyllysylleucylglycylserylalanylthreonylala–
nylserylisoleucylasparaginylvalyllysylvalylisoleucylglycylleucylprolylgly–
cylprolylcysteinyllysylaspartylisoleucyllysylalanylserylaspartylisoleucyl–
threonyllysylserylserylcysteinyllysylleucylthreonyltryptophylglutamylprol–
ylprolylglutamylphenylalanylaspartylglycylglycylthreonylprolylisoleucylle–
ucylhistidyltyrosylvalylleucylglutamylarginylarginylglutamylalanylglycyla–
rginylarginylthreonyltyrosylisoleucylprolylvalylmethionylserylglycylgluta–
mylasparaginyllysylleucylseryltryptophylthreonylvalyllysylaspartylleucyli–
soleucylprolylasparaginylglycylglutamyltyrosylphenylalanylphenylalanylarg–
inylvalyllysylalanylvalylasparaginyllysylvalylglycylglycylglycylglutamylt–
yrosylisoleucylglutamylleucyllysylasparaginylprolylvalylisoleucylalanylgl–
utaminylaspartylprolyllysylglutaminylprolylprolylaspartylprolylprolylvaly–
laspartylvalylglutamylvalylhistidylasparaginylprolylthreonylalanylglutamy–
lalanylmethionylthreonylisoleucylthreonyltryptophyllysylprolylprolylleucy–
ltyrosylaspartylglycylglycylseryllysylisoleucylmethionylglycyltyrosylisol–
eucylisoleucylglutamyllysylisoleucylalanyllysylglycylglutamylglutamylargi–
nyltryptophyllysylarginylcysteinylasparaginylglutamylhistidylleucylvalylp–
rolylisoleucylleucylthreonyltyrosylthreonylalanyllysylglycylleucylglutamy–
lglutamylglycyllysylglutamyltyrosylglutaminylphenylalanylarginylvalylargi–
nylalanylglutamylasparaginylalanylalanylglycylisoleucylserylglutamylproly–
lserylarginylalanylthreonylprolylprolylthreonyllysylalanylvalylaspartylpr–
olylisoleucylaspartylalanylprolyllysylvalylisoleucylleucylarginylthreonyl–
serylleucylglutamylvalyllysylarginylglycylaspartylglutamylisoleucylalanyl–
leucylaspartylalanylserylisoleucylserylglycylserylprolyltyrosylprolylthre–
onylisoleucylthreonyltryptophylisoleucyllysylaspartylglutamylasparaginylv–
alylisoleucylvalylprolylglutamylglutamylisoleucyllysyllysylarginylalanyla–
lanylprolylleucylvalylarginylarginylarginyllysylglycylglutamylvalylglutam–
inylglutamylglutamylglutamylprolylphenylalanylvalylleucylprolylleucylthre–
onylglutaminylarginylleucylserylisoleucylaspartylasparaginylseryllysyllys–
ylglycylglutamylserylglutaminylleucylarginylvalylarginylaspartylserylleuc–
ylarginylprolylaspartylhistidylglycylleucyltyrosylmethionylisoleucyllysyl–
valylglutamylasparaginylaspartylhistidylglycylisoleucylalanyllysylalanylp–
rolylcysteinylthreonylvalylserylvalylleucylaspartylthreonylprolylglycylpr–
olylprolylisoleucylasparaginylphenylalanylvalylphenylalanylglutamylaspart–
ylisoleucylarginyllysylthreonylserylvalylleucylcysteinyllysyltryptophylgl–
utamylprolylprolylleucylaspartylaspartylglycylglycylserylglutamylisoleucy–
lisoleucylasparaginyltyrosylthreonylleucylglutamyllysyllysylaspartyllysyl–
threonyllysylprolylaspartylserylglutamyltryptophylisoleucylvalylvalylthre–
onylserylthreonylleucylarginylhistidylcysteinyllysyltyrosylserylvalylthre–
onyllysylleucylisoleucylglutamylglycyllysylglutamyltyrosylleucylphenylala–
nylarginylvalylarginylalanylglutamylasparaginylarginylphenylalanylglycylp–
rolylglycylprolylprolylcysteinylvalylseryllysylprolylleucylvalylalanyllys–
ylaspartylprolylphenylalanylglycylprolylprolylaspartylalanylprolylasparty–
llysylprolylisoleucylvalylglutamylaspartylvalylthreonylserylasparaginylse–
rylmethionylleucylvalyllysyltryptophylasparaginylglutamylprolyllysylaspar–
tylasparaginylglycylserylprolylisoleucylleucylglycyltyrosyltryptophylleuc–
ylglutamyllysylarginylglutamylvalylasparaginylserylthreonylhistidyltrypto–
phylserylarginylvalylasparaginyllysylserylleucylleucylasparaginylalanylle–
ucyllysylalanylasparaginylvalylaspartylglycylleucylleucylglutamylglycylle–
ucylthreonyltyrosylvalylphenylalanylarginylvalylcysteinylalanylglutamylas–
paraginylalanylalanylglycylprolylglycyllysylphenylalanylserylprolylprolyl–
serylaspartylprolyllysylthreonylalanylhistidylaspartylprolylisoleucylsery–
lprolylprolylglycylprolylprolylisoleucylprolylarginylvalylthreonylasparty–
lthreonylserylserylthreonylthreonylisoleucylglutamylleucylglutamyltryptop–
hylglutamylprolylprolylalanylphenylalanylasparaginylglycylglycylglycylglu–
tamylisoleucylvalylglycyltyrosylphenylalanylvalylaspartyllysylglutaminyll–
eucylvalylglycylthreonylasparaginyllysyltryptophylserylarginylcysteinylth–
reonylglutamyllysylmethionylisoleucyllysylvalylarginylglutaminyltyrosylth–
reonylvalyllysylglutamylisoleucylarginylglutamylglycylalanylaspartyltyros–
yllysylleucylarginylvalylserylalanylvalylasparaginylalanylalanylglycylglu–
tamylglycylprolylprolylglycylglutamylthreonylglutaminylprolylvalylthreony–
lvalylalanylglutamylprolylglutaminylglutamylprolylprolylalanylvalylglutam–
ylleucylaspartylvalylserylvalyllysylglycylglycylisoleucylglutaminylisoleu–
cylmethionylalanylglycyllysylthreonylleucylarginylisoleucylprolylalanylva–
lylvalylthreonylglycylarginylprolylvalylprolylthreonyllysylvalyltryptophy–
lthreonyllysylglutamylglutamylglycylglutamylleucylaspartyllysylaspartylar–
ginylvalylvalylisoleucylaspartylasparaginylvalylglycylthreonyllysylserylg–
lutamylleucylisoleucylisoleucyllysylaspartylalanylleucylarginyllysylaspar–
tylhistidylglycylarginyltyrosylvalylisoleucylthreonylalanylthreonylaspara–
ginylserylcysteinylglycylseryllysylphenylalanylalanylalanylalanylarginylv–
alylglutamylvalylphenylalanylaspartylvalylprolylglycylprolylvalylleucylas–
partylleucyllysylprolylvalylvalylthreonylasparaginylarginyllysylmethionyl–
cysteinylleucylleucylasparaginyltryptophylserylaspartylprolylglutamylaspa–
rtylaspartylglycylglycylserylglutamylisoleucylthreonylglycylphenylalanyli–
soleucylisoleucylglutamylarginyllysylaspartylalanyllysylmethionylhistidyl–
threonyltryptophylarginylglutaminylprolylisoleucylglutamylthreonylglutamy–
larginylseryllysylcysteinylaspartylisoleucylthreonylglycylleucylleucylglu–
tamylglycylglutaminylglutamyltyrosyllysylphenylalanylarginylvalylisoleucy–
lalanyllysylasparaginyllysylphenylalanylglycylcysteinylglycylprolylprolyl–
valylglutamylisoleucylglycylprolylisoleucylleucylalanylvalylaspartylproly–
lleucylglycylprolylprolylthreonylserylprolylglutamylarginylleucylthreonyl–
tyrosylthreonylglutamylarginylglutaminylarginylserylthreonylisoleucylthre–
onylleucylaspartyltryptophyllysylglutamylprolylarginylserylasparaginylgly–
cylglycylserylprolylisoleucylglutaminylglycyltyrosylisoleucylisoleucylglu–
tamyllysylarginylarginylhistidylaspartyllysylprolylaspartylphenylalanylgl–
utamylarginylvalylasparaginyllysylarginylleucylcysteinylprolylthreonylthr–
eonylserylphenylalanylleucylvalylglutamylasparaginylleucylaspartylglutamy–
lhistidylglutaminylmethionyltyrosylglutamylphenylalanylarginylvalyllysyla–
lanylvalylasparaginylglutamylisoleucylglycylglutamylserylglutamylprolylse–
rylleucylprolylleucylasparaginylvalylvalylisoleucylglutaminylaspartylaspa–
rtylglutamylvalylprolylprolylthreonylisoleucyllysylleucylarginylleucylser–
ylvalylarginylglycylaspartylthreonylisoleucyllysylvalyllysylalanylglycylg–
lutamylprolylvalylhistidylisoleucylprolylalanylaspartylvalylthreonylglycy–
lleucylprolylmethionylprolyllysylisoleucylglutamyltryptophylseryllysylasp–
araginylglutamylthreonylvalylisoleucylglutamyllysylprolylthreonylaspartyl–
alanylleucylglutaminylisoleucylthreonyllysylglutamylglutamylvalylserylarg–
inylserylglutamylalanyllysylthreonylglutamylleucylserylisoleucylprolyllys–
ylalanylvalylarginylglutamylaspartyllysylglycylthreonyltyrosylthreonylval–
ylthreonylalanylserylasparaginylarginylleucylglycylserylvalylphenylalanyl–
arginylasparaginylvalylhistidylvalylglutamylvalyltyrosylaspartylarginylpr–
olylserylprolylprolylarginylasparaginylleucylalanylvalylthreonylaspartyli–
soleucyllysylalanylglutamylserylcysteinyltyrosylleucylthreonyltryptophyla–
spartylalanylprolylleucylaspartylasparaginylglycylglycylserylglutamylisol–
eucylthreonylhistidyltyrosylvalylisoleucylaspartyllysylarginylaspartylala–
nylserylarginyllysyllysylalanylglutamyltryptophylglutamylglutamylvalylthr–
eonylasparaginylthreonylalanylvalylglutamyllysylarginyltyrosylglycylisole–
ucyltryptophyllysylleucylisoleucylprolylasparaginylglycylglutaminyltyrosy–
lglutamylphenylalanylarginylvalylarginylalanylvalylasparaginyllysyltyrosy–
lglycylisoleucylserylaspartylglutamylcysteinyllysylserylaspartyllysylvaly–
lvalylisoleucylglutaminylaspartylprolyltyrosylarginylleucylprolylglycylpr–
olylprolylglycyllysylprolyllysylvalylleucylalanylarginylthreonyllysylglyc–
ylserylmethionylleucylvalylseryltryptophylthreonylprolylprolylleucylaspar–
tylasparaginylglycylglycylserylprolylisoleucylthreonylglycyltyrosyltrypto–
phylleucylglutamyllysylarginylglutamylglutamylglycylserylprolyltyrosyltry–
ptophylserylarginylvalylserylarginylalanylprolylisoleucylthreonyllysylval–
ylglycylleucyllysylglycylvalylglutamylphenylalanylasparaginylvalylprolyla–
rginylleucylleucylglutamylglycylvalyllysyltyrosylglutaminylphenylalanylar–
ginylalanylmethionylalanylisoleucylasparaginylalanylalanylglycylisoleucyl–
glycylprolylprolylserylglutamylprolylserylaspartylprolylglutamylvalylalan–
ylglycylaspartylprolylisoleucylphenylalanylprolylprolylglycylprolylprolyl–
serylcysteinylprolylglutamylvalyllysylaspartyllysylthreonyllysylserylsery–
lisoleucylserylleucylglycyltryptophyllysylprolylprolylalanyllysylaspartyl–
glycylglycylserylprolylisoleucyllysylglycyltyrosylisoleucylvalylglutamylm–
ethionylglutaminylglutamylglutamylglycylthreonylthreonylaspartyltryptophy–
llysylarginylvalylasparaginylglutamylprolylaspartyllysylleucylisoleucylth–
reonylthreonylcysteinylglutamylcysteinylvalylvalylprolylasparaginylleucyl–
lysylglutamylleucylarginyllysyltyrosylarginylphenylalanylarginylvalyllysy–
lalanylvalylasparaginylglutamylalanylglycylglutamylserylglutamylprolylser–
ylaspartylthreonylthreonylglycylglutamylisoleucylprolylalanylthreonylaspa–
rtylisoleucylglutaminylglutamylglutamylprolylglutamylvalylphenylalanyliso–
leucylaspartylisoleucylglycylalanylglutaminylaspartylcysteinylleucylvalyl–
cysteinyllysylalanylglycylserylglutaminylisoleucylarginylisoleucylprolyla–
lanylvalylisoleucyllysylglycylarginylprolylthreonylprolyllysylserylserylt–
ryptophylglutamylphenylalanylaspartylglycyllysylalanyllysyllysylalanylmet–
hionyllysylaspartylglycylvalylhistidylaspartylisoleucylprolylglutamylaspa–
rtylalanylglutaminylleucylglutamylthreonylalanylglutamylasparaginylseryls–
erylvalylisoleucylisoleucylisoleucylprolylglutamylcysteinyllysylarginylse–
rylhistidylthreonylglycyllysyltyrosylserylisoleucylthreonylalanyllysylasp–
araginyllysylalanylglycylglutaminyllysylthreonylalanylasparaginylcysteiny–
larginylvalyllysylvalylmethionylaspartylvalylprolylglycylprolylprolyllysy–
laspartylleucyllysylvalylserylaspartylisoleucylthreonylarginylglycylseryl–
cysteinylarginylleucylseryltryptophyllysylmethionylprolylaspartylaspartyl–
aspartylglycylglycylaspartylarginylisoleucyllysylglycyltyrosylvalylisoleu–
cylglutamyllysylarginylthreonylisoleucylaspartylglycyllysylalanyltryptoph–
ylthreonyllysylvalylasparaginylprolylaspartylcysteinylglycylserylthreonyl–
threonylphenylalanylvalylvalylprolylaspartylleucylleucylserylglutamylglut–
aminylglutaminyltyrosylphenylalanylphenylalanylarginylvalylarginylalanylg–
lutamylasparaginylarginylphenylalanylglycylisoleucylglycylprolylprolylval–
ylglutamylthreonylisoleucylglutaminylarginylthreonylthreonylalanylarginyl–
aspartylprolylisoleucyltyrosylprolylprolylaspartylprolylprolylisoleucylly–
sylleucyllysylisoleucylglycylleucylisoleucylthreonyllysylasparaginylthreo–
nylvalylhistidylleucylseryltryptophyllysylprolylprolyllysylasparaginylasp–
artylglycylglycylserylprolylvalylthreonylhistidyltyrosylisoleucylvalylglu–
tamylcysteinylleucylalanyltryptophylaspartylprolylthreonylglycylthreonyll–
ysyllysylglutamylalanyltryptophylarginylglutaminylcysteinylasparaginyllys–
ylarginylaspartylvalylglutamylglutamylleucylglutaminylphenylalanylthreony–
lvalylglutamylaspartylleucylvalylglutamylglycylglycylglutamyltyrosylgluta–
mylphenylalanylarginylvalyllysylalanylvalylasparaginylalanylalanylglycylv–
alylseryllysylprolylserylalanylthreonylvalylglycylprolylcysteinylaspartyl–
cysteinylglutaminylarginylprolylaspartylmethionylprolylprolylserylisoleuc–
ylaspartylleucyllysylglutamylphenylalanylmethionylglutamylvalylglutamylgl–
utamylglycylthreonylasparaginylvalylasparaginylisoleucylvalylalanyllysyli–
soleucyllysylglycylvalylprolylphenylalanylprolylthreonylleucylthreonyltry–
ptophylphenylalanyllysylalanylprolylprolyllysyllysylprolylaspartylasparag–
inyllysylglutamylprolylvalylleucyltyrosylaspartylthreonylhistidylvalylasp–
araginyllysylleucylvalylvalylaspartylaspartylthreonylcysteinylthreonylleu–
cylvalylisoleucylprolylglutaminylserylarginylarginylserylaspartylthreonyl–
glycylleucyltyrosylthreonylisoleucylthreonylalanylvalylasparaginylasparag–
inylleucylglycylthreonylalanylseryllysylglutamylmethionylarginylleucylasp–
araginylvalylleucylglycylarginylprolylglycylprolylprolylvalylglycylprolyl–
isoleucyllysylphenylalanylglutamylserylvalylserylalanylaspartylglutaminyl–
methionylthreonylleucylseryltryptophylphenylalanylprolylprolyllysylaspart–
ylaspartylglycylglycylseryllysylisoleucylthreonylasparaginyltyrosylvalyli–
soleucylglutamyllysylarginylglutamylalanylasparaginylarginyllysylthreonyl–
tryptophylvalylhistidylvalylserylserylglutamylprolyllysylglutamylcysteiny–
lthreonyltyrosylthreonylisoleucylprolyllysylleucylleucylglutamylglycylhis–
tidylglutamyltyrosylvalylphenylalanylarginylisoleucylmethionylalanylgluta–
minylasparaginyllysyltyrosylglycylisoleucylglycylglutamylprolylleucylaspa–
rtylserylglutamylprolylglutamylthreonylalanylarginylasparaginylleucylphen–
ylalanylserylvalylprolylglycylalanylprolylaspartyllysylprolylthreonylvaly–
lserylserylvalylthreonylarginylasparaginylserylmethionylthreonylvalylaspa–
raginyltryptophylglutamylglutamylprolylglutamyltyrosylaspartylglycylglycy–
lserylprolylvalylthreonylglycyltyrosyltryptophylleucylglutamylmethionylly–
sylaspartylthreonylthreonylseryllysylarginyltryptophyllysylarginylvalylas–
paraginylarginylaspartylprolylisoleucyllysylalanylmethionylthreonylleucyl–
glycylvalylseryltyrosyllysylvalylthreonylglycylleucylisoleucylglutamylgly–
cylserylaspartyltyrosylglutaminylphenylalanylarginylvalyltyrosylalanyliso–
leucylasparaginylalanylalanylglycylvalylglycylprolylalanylserylleucylprol–
ylserylaspartylprolylalanylthreonylalanylarginylaspartylprolylisoleucylal–
anylprolylprolylglycylprolylprolylphenylalanylprolyllysylvalylthreonylasp–
artyltryptophylthreonyllysylserylserylalanylaspartylleucylglutamyltryptop–
hylserylprolylprolylleucyllysylaspartylglycylglycylseryllysylvalylthreony–
lglycyltyrosylisoleucylvalylglutamyltyrosyllysylglutamylglutamylglycyllys–
ylglutamylglutamyltryptophylglutamyllysylglycyllysylaspartyllysylglutamyl–
valylarginylglycylthreonyllysylleucylvalylvalylthreonylglycylleucyllysylg–
lutamylglycylalanylphenylalanyltyrosyllysylphenylalanylarginylvalylseryla–
lanylvalylasparaginylisoleucylalanylglycylisoleucylglycylglutamylprolylgl–
ycylglutamylvalylthreonylaspartylvalylisoleucylglutamylmethionyllysylaspa–
rtylarginylleucylvalylserylprolylaspartylleucylglutaminylleucylaspartylal–
anylserylvalylarginylaspartylarginylisoleucylvalylvalylhistidylalanylglyc–
ylglycylvalylisoleucylarginylisoleucylisoleucylalanyltyrosylvalylserylgly–
cyllysylprolylprolylprolylthreonylvalylthreonyltryptophylasparaginylmethi–
onylasparaginylglutamylarginylthreonylleucylprolylglutaminylglutamylalany–
lthreonylisoleucylglutamylthreonylthreonylalanylisoleucylserylserylserylm–
ethionylvalylisoleucyllysylasparaginylcysteinylglutaminylarginylserylhist–
idylglutaminylglycylvalyltyrosylserylleucylleucylalanyllysylasparaginylgl–
utamylalanylglycylglutamylarginyllysyllysylthreonylisoleucylisoleucylvaly–
laspartylvalylleucylaspartylvalylprolylglycylprolylvalylglycylthreonylpro–
lylphenylalanylleucylalanylhistidylasparaginylleucylthreonylasparaginylgl–
utamylserylcysteinyllysylleucylthreonyltryptophylphenylalanylserylprolylg–
lutamylaspartylaspartylglycylglycylserylprolylisoleucylthreonylasparaginy–
ltyrosylvalylisoleucylglutamyllysylarginylglutamylserylaspartylarginylarg–
inylalanyltryptophylthreonylprolylvalylthreonyltyrosylthreonylvalylthreon–
ylarginylglutaminylasparaginylalanylthreonylvalylglutaminylglycylleucylis–
oleucylglutaminylglycyllysylalanyltyrosylphenylalanylphenylalanylarginyli–
soleucylalanylalanylglutamylasparaginylserylisoleucylglycylmethionylglycy–
lprolylphenylalanylvalylglutamylthreonylserylglutamylalanylleucylvalyliso–
leucylarginylglutamylprolylisoleucylthreonylvalylprolylglutamylarginylpro–
lylglutamylaspartylleucylglutamylvalyllysylglutamylvalylthreonyllysylaspa–
raginylthreonylvalylthreonylleucylthreonyltryptophylasparaginylprolylprol–
yllysyltyrosylaspartylglycylglycylserylglutamylisoleucylisoleucylasparagi–
nyltyrosylvalylleucylglutamylserylarginylleucylisoleucylglycylthreonylglu–
tamyllysylphenylalanylhistidyllysylvalylthreonylasparaginylaspartylaspara–
ginylleucylleucylserylarginyllysyltyrosylthreonylvalyllysylglycylleucylly–
sylglutamylglycylaspartylthreonyltyrosylglutamyltyrosylarginylvalylseryla–
lanylvalylasparaginylisoleucylvalylglycylglutaminylglycyllysylprolylseryl–
phenylalanylcysteinylthreonyllysylprolylisoleucylthreonylcysteinyllysylas–
partylglutamylleucylalanylprolylprolylthreonylleucylhistidylleucylasparty–
lphenylalanylarginylaspartyllysylleucylthreonylisoleucylarginylvalylglycy–
lglutamylalanylphenylalanylalanylleucylthreonylglycylarginyltyrosylserylg–
lycyllysylprolyllysylprolyllysylvalylseryltryptophylphenylalanyllysylaspa–
rtylglutamylalanylaspartylvalylleucylglutamylaspartylaspartylarginylthreo–
nylhistidylisoleucyllysylthreonylthreonylprolylalanylthreonylleucylalanyl–
leucylglutamyllysylisoleucyllysylalanyllysylarginylserylaspartylserylglyc–
yllysyltyrosylcysteinylvalylvalylvalylglutamylasparaginylserylthreonylgly–
cylserylarginyllysylglycylphenylalanylcysteinylglutaminylvalylasparaginyl–
valylvalylaspartylhistidylprolylglycylprolylprolylvalylglycylprolylvalyls–
erylphenylalanylaspartylglutamylvalylthreonyllysylaspartyltyrosylmethiony–
lvalylisoleucylseryltryptophyllysylprolylprolylleucylaspartylaspartylglyc–
ylglycylseryllysylisoleucylthreonylasparaginyltyrosylisoleucylisoleucylgl–
utamyllysyllysylglutamylvalylglycyllysylaspartylvalyltryptophylmethionylp–
rolylvalylthreonylserylalanylserylalanyllysylthreonylthreonylcysteinyllys–
ylvalylseryllysylleucylleucylglutamylglycyllysylaspartyltyrosylisoleucylp–
henylalanylarginylisoleucylhistidylalanylglutamylasparaginylleucyltyrosyl–
glycylisoleucylserylaspartylprolylleucylvalylserylaspartylserylmethionyll–
ysylalanyllysylaspartylarginylphenylalanylarginylvalylprolylaspartylalany–
lprolylaspartylglutaminylprolylisoleucylvalylthreonylglutamylvalylthreony–
llysylaspartylserylalanylleucylvalylthreonyltryptophylasparaginyllysylpro–
lylhistidylaspartylglycylglycyllysylprolylisoleucylthreonylasparaginyltyr–
osylisoleucylleucylglutamyllysylarginylglutamylthreonylmethionylseryllysy–
larginyltryptophylalanylarginylvalylthreonyllysylaspartylprolylisoleucylh–
istidylprolyltyrosylthreonyllysylphenylalanylarginylvalylprolylaspartylle–
ucylleucylglutamylglycylcysteinylglutaminyltyrosylglutamylphenylalanylarg–
inylvalylserylalanylglutamylasparaginylglutamylisoleucylglycylisoleucylgl–
ycylaspartylprolylserylprolylprolylseryllysylprolylvalylphenylalanylalany–
llysylaspartylprolylisoleucylalanyllysylprolylserylprolylprolylvalylaspar–
aginylprolylglutamylalanylisoleucylaspartylthreonylthreonylcysteinylaspar–
aginylserylvalylaspartylleucylthreonyltryptophylglutaminylprolylprolylarg–
inylhistidylaspartylglycylglycylseryllysylisoleucylleucylglycyltyrosyliso–
leucylvalylglutamyltyrosylglutaminyllysylvalylglycylaspartylglutamylgluta–
myltryptophylarginylarginylalanylasparaginylhistidylthreonylprolylglutamy–
lserylcysteinylprolylglutamylthreonyllysyltyrosyllysylvalylthreonylglycyl–
leucylarginylaspartylglycylglutaminylthreonyltyrosyllysylphenylalanylargi–
nylvalylleucylalanylvalylasparaginylalanylalanylglycylglutamylserylaspart–
ylprolylalanylhistidylvalylprolylglutamylprolylvalylleucylvalyllysylaspar–
tylarginylleucylglutamylprolylprolylglutamylleucylisoleucylleucylaspartyl–
alanylasparaginylmethionylalanylarginylglutamylglutaminylhistidylisoleucy–
llysylvalylglycylaspartylthreonylleucylarginylleucylserylalanylisoleucyli–
soleucyllysylglycylvalylprolylphenylalanylprolyllysylvalylthreonyltryptop–
hyllysyllysylglutamylaspartylarginylaspartylalanylprolylthreonyllysylalan–
ylarginylisoleucylaspartylvalylthreonylprolylvalylglycylseryllysylleucylg–
lutamylisoleucylarginylasparaginylalanylalanylhistidylglutamylaspartylgly–
cylglycylisoleucyltyrosylserylleucylthreonylvalylglutamylasparaginylproly–
lalanylglycylseryllysylthreonylvalylserylvalyllysylvalylleucylvalylleucyl–
aspartyllysylprolylglycylprolylprolylarginylaspartylleucylglutamylvalylse–
rylglutamylisoleucylarginyllysylaspartylserylcysteinyltyrosylleucylthreon–
yltryptophyllysylglutamylprolylleucylaspartylaspartylglycylglycylserylval–
ylisoleucylthreonylasparaginyltyrosylvalylvalylglutamylarginylarginylaspa–
rtylvalylalanylserylalanylglutaminyltryptophylserylprolylleucylserylalany–
lthreonylseryllysyllysyllysylserylhistidylphenylalanylalanyllysylhistidyl–
leucylasparaginylglutamylglycylasparaginylglutaminyltyrosylleucylphenylal–
anylarginylvalylalanylalanylglutamylasparaginylglutaminyltyrosylglycylarg–
inylglycylprolylphenylalanylvalylglutamylthreonylprolyllysylprolylisoleuc–
yllysylalanylleucylaspartylprolylleucylhistidylprolylprolylglycylprolylpr–
olyllysylaspartylleucylhistidylhistidylvalylaspartylvalylaspartyllysylthr–
eonylglutamylvalylserylleucylvalyltryptophylasparaginyllysylprolylasparty–
larginylaspartylglycylglycylserylprolylisoleucylthreonylglycyltyrosylleuc–
ylvalylglutamyltyrosylglutaminylglutamylglutamylglycylthreonylglutaminyla–
spartyltryptophylisoleucyllysylphenylalanyllysylthreonylvalylthreonylaspa–
raginylleucylglutamylcysteinylvalylvalylthreonylglycylleucylglutaminylglu–
taminylglycyllysylthreonyltyrosylarginylphenylalanylarginylvalyllysylalan–
ylglutamylasparaginylisoleucylvalylglycylleucylglycylleucylprolylaspartyl–
threonylthreonylisoleucylprolylisoleucylglutamylcysteinylglutaminylglutam–
yllysylleucylvalylprolylprolylserylvalylglutamylleucylaspartylvalyllysyll–
eucylisoleucylglutamylglycylleucylvalylvalyllysylalanylglycylthreonylthre–
onylvalylarginylphenylalanylprolylalanylisoleucylisoleucylarginylglycylva–
lylprolylvalylprolylthreonylalanyllysyltryptophylthreonylthreonylaspartyl–
glycylserylglutamylisoleucyllysylthreonylaspartylglutamylhistidyltyrosylt–
hreonylvalylglutamylthreonylaspartylasparaginylphenylalanylserylserylvaly–
lleucylthreonylisoleucyllysylasparaginylcysteinylleucylarginylarginylaspa–
rtylthreonylglycylglutamyltyrosylglutaminylisoleucylthreonylvalylserylasp–
araginylalanylalanylglycylseryllysylthreonylvalylalanylvalylhistidylleucy–
lthreonylvalylleucylaspartylvalylprolylglycylprolylprolylthreonylglycylpr–
olylisoleucylasparaginylisoleucylleucylaspartylvalylthreonylprolylglutamy–
lhistidylmethionylthreonylisoleucylseryltryptophylglutaminylprolylprolyll–
ysylaspartylaspartylglycylglycylserylprolylvalylisoleucylasparaginyltyros–
ylisoleucylvalylglutamyllysylglutaminylaspartylthreonylarginyllysylaspart–
ylthreonyltryptophylglycylvalylvalylserylserylglycylserylseryllysylthreon–
yllysylleucyllysylisoleucylprolylhistidylleucylglutaminyllysylglycylcyste–
inylglutamyltyrosylvalylphenylalanylarginylvalylarginylalanylglutamylaspa–
raginyllysylisoleucylglycylvalylglycylprolylprolylleucylaspartylserylthre–
onylprolylthreonylvalylalanyllysylhistidyllysylphenylalanylserylprolylpro–
lylserylprolylprolylglycyllysylprolylvalylvalylthreonylaspartylisoleucylt–
hreonylglutamylasparaginylalanylalanylthreonylvalylseryltryptophylthreony–
lleucylprolyllysylserylaspartylglycylglycylserylprolylisoleucylthreonylgl–
ycyltyrosyltyrosylmethionylglutamylarginylarginylglutamylvalylthreonylgly–
cyllysyltryptophylvalylarginylvalylasparaginyllysylthreonylprolylisoleucy–
lalanylaspartylleucyllysylphenylalanylarginylvalylthreonylglycylleucyltyr–
osylglutamylglycylasparaginylthreonyltyrosylglutamylphenylalanylarginylva–
lylphenylalanylalanylglutamylasparaginylleucylalanylglycylleucylseryllysy–
lprolylserylprolylserylserylaspartylprolylisoleucyllysylalanylcysteinylar–
ginylprolylisoleucyllysylprolylprolylglycylprolylprolylisoleucylasparagin–
ylprolyllysylleucyllysylaspartyllysylserylarginylglutamylthreonylalanylas–
partylleucylvalyltryptophylthreonyllysylprolylleucylserylaspartylglycylgl–
ycylserylprolylisoleucylleucylglycyltyrosylvalylvalylglutamylcysteinylglu–
taminyllysylprolylglycylthreonylalanylglutaminyltryptophylasparaginylargi–
nylisoleucylasparaginyllysylaspartylglutamylleucylisoleucylarginylglutami–
nylcysteinylalanylphenylalanylarginylvalylprolylglycylleucylisoleucylglut–
amylglycylasparaginylglutamyltyrosylarginylphenylalanylarginylisoleucylly–
sylalanylalanylasparaginylisoleucylvalylglycylglutamylglycylglutamylproly–
larginylglutamylleucylalanylglutamylserylvalylisoleucylalanyllysylasparty–
lisoleucylleucylhistidylprolylprolylglutamylvalylglutamylleucylaspartylva–
lylthreonylcysteinylarginylaspartylvalylisoleucylthreonylvalylarginylvaly–
lglycylglutaminylthreonylisoleucylarginylisoleucylleucylalanylarginylvaly–
llysylglycylarginylprolylglutamylprolylaspartylisoleucylthreonyltryptophy–
lthreonyllysylglutamylglycyllysylvalylleucylvalylarginylglutamyllysylargi–
nylvalylaspartylleucylisoleucylglutaminylaspartylleucylprolylarginylvalyl–
glutamylleucylglutaminylisoleucyllysylglutamylalanylvalylarginylalanylasp–
artylhistidylglycyllysyltyrosylisoleucylisoleucylserylalanyllysylasparagi–
nylserylserylglycylhistidylalanylglutaminylglycylserylalanylisoleucylvaly–
lasparaginylvalylleucylaspartylarginylprolylglycylprolylcysteinylglutamin–
ylasparaginylleucyllysylvalylthreonylasparaginylvalylthreonyllysylglutamy–
lasparaginylcysteinylthreonylisoleucylseryltryptophylglutamylasparaginylp–
rolylleucylaspartylasparaginylglycylglycylserylglutamylisoleucylthreonyla–
sparaginylphenylalanylisoleucylvalylglutamyltyrosylarginyllysylprolylaspa–
raginylglutaminyllysylglycyltryptophylserylisoleucylvalylalanylserylaspar–
tylvalylthreonyllysylarginylleucylisoleucyllysylalanylasparaginylleucylle–
ucylalanylasparaginylasparaginylglutamyltyrosyltyrosylphenylalanylarginyl–
valylcysteinylalanylglutamylasparaginyllysylvalylglycylvalylglycylprolylt–
hreonylisoleucylglutamylthreonyllysylthreonylprolylisoleucylleucylalanyli–
soleucylasparaginylprolylisoleucylaspartylarginylprolylglycylglutamylprol–
ylglutamylasparaginylleucylhistidylisoleucylalanylaspartyllysylglycyllysy–
lthreonylphenylalanylvalyltyrosylleucyllysyltryptophylarginylarginylproly–
laspartyltyrosylaspartylglycylglycylserylprolylasparaginylleucylseryltyro–
sylhistidylvalylglutamylarginylarginylleucyllysylglycylserylaspartylaspar–
tyltryptophylglutamylarginylvalylhistidyllysylglycylserylisoleucyllysylgl–
utamylthreonylhistidyltyrosylmethionylvalylaspartylarginylcysteinylvalylg–
lutamylasparaginylglutaminylisoleucyltyrosylglutamylphenylalanylarginylva–
lylglutaminylthreonyllysylasparaginylglutamylglycylglycylglutamylserylasp–
artyltryptophylvalyllysylthreonylglutamylglutamylvalylvalylvalyllysylglut–
amylaspartylleucylglutaminyllysylprolylvalylleucylaspartylleucyllysylleuc–
ylserylglycylvalylleucylthreonylvalyllysylalanylglycylaspartylthreonyliso–
leucylarginylleucylglutamylalanylglycylvalylarginylglycyllysylprolylpheny–
lalanylprolylglutamylvalylalanyltryptophylthreonyllysylaspartyllysylaspar–
tylalanylthreonylaspartylleucylthreonylarginylserylprolylarginylvalyllysy–
lisoleucylaspartylthreonylarginylalanylaspartylserylseryllysylphenylalany–
lserylleucylthreonyllysylalanyllysylarginylserylaspartylglycylglycyllysyl–
tyrosylvalylvalylthreonylalanylthreonylasparaginylthreonylalanylglycylser–
ylphenylalanylvalylalanyltyrosylalanylthreonylvalylasparaginylvalylleucyl–
aspartyllysylprolylglycylprolylvalylarginylasparaginylleucyllysylisoleucy–
lvalylaspartylvalylserylserylaspartylarginylcysteinylthreonylvalylcystein–
yltryptophylaspartylprolylprolylglutamylaspartylaspartylglycylglycylcyste–
inylglutamylisoleucylglutaminylasparaginyltyrosylisoleucylleucylglutamyll–
ysylcysteinylglutamylthreonyllysylarginylmethionylvalyltryptophylserylthr–
eonyltyrosylserylalanylthreonylvalylleucylthreonylprolylglycylthreonylthr–
eonylvalylthreonylarginylleucylisoleucylglutamylglycylasparaginylglutamyl–
tyrosylisoleucylphenylalanylarginylvalylarginylalanylglutamylasparaginyll–
ysylisoleucylglycylthreonylglycylprolylprolylthreonylglutamylseryllysylpr–
olylvalylisoleucylalanyllysylthreonyllysyltyrosylaspartyllysylprolylglycy–
larginylprolylaspartylprolylprolylglutamylvalylthreonyllysylvalylseryllys–
ylglutamylglutamylmethionylthreonylvalylvalyltryptophylasparaginylprolylp–
rolylglutamyltyrosylaspartylglycylglycyllysylserylisoleucylthreonylglycyl–
tyrosylphenylalanylleucylglutamyllysyllysylglutamyllysylhistidylserylthre–
onylarginyltryptophylvalylprolylvalylasparaginyllysylserylalanylisoleucyl–
prolylglutamylarginylarginylmethionyllysylvalylglutaminylasparaginylleucy–
lleucylprolylaspartylhistidylglutamyltyrosylglutaminylphenylalanylarginyl–
valyllysylalanylglutamylasparaginylglutamylisoleucylglycylisoleucylglycyl–
glutamylprolylserylleucylprolylserylarginylprolylvalylvalylalanyllysylasp–
artylprolylisoleucylglutamylprolylprolylglycylprolylprolylthreonylasparag–
inylphenylalanylarginylvalylvalylaspartylthreonylthreonyllysylhistidylser–
ylisoleucylthreonylleucylglycyltryptophylglycyllysylprolylvalyltyrosylasp–
artylglycylglycylalanylprolylisoleucylisoleucylglycyltyrosylvalylvalylglu–
tamylmethionylarginylprolyllysylisoleucylalanylaspartylalanylserylprolyla–
spartylglutamylglycyltryptophyllysylarginylcysteinylasparaginylalanylalan–
ylalanylglutaminylleucylvalylarginyllysylglutamylphenylalanylthreonylvaly–
lthreonylserylleucylaspartylglutamylasparaginylglutaminylglutamyltyrosylg–
lutamylphenylalanylarginylvalylcysteinylalanylglutaminylasparaginylglutam–
inylvalylglycylisoleucylglycylarginylprolylalanylglutamylleucyllysylgluta–
mylalanylisoleucyllysylprolyllysylglutamylisoleucylleucylglutamylprolylpr–
olylglutamylisoleucylaspartylleucylaspartylalanylserylmethionylarginyllys–
ylleucylvalylisoleucylvalylarginylalanylglycylcysteinylprolylisoleucylarg–
inylleucylphenylalanylalanylisoleucylvalylarginylglycylarginylprolylalany–
lprolyllysylvalylthreonyltryptophylarginyllysylvalylglycylisoleucylaspart–
ylasparaginylvalylvalylarginyllysylglycylglutaminylvalylaspartylleucylval–
ylaspartylthreonylmethionylalanylphenylalanylleucylvalylisoleucylprolylas–
paraginylserylthreonylarginylaspartylaspartylserylglycyllysyltyrosylseryl–
leucylthreonylleucylvalylasparaginylprolylalanylglycylglutamyllysylalanyl–
valylphenylalanylvalylasparaginylvalylarginylvalylleucylaspartylthreonylp–
rolylglycylprolylvalylserylaspartylleucyllysylvalylserylaspartylvalylthre–
onyllysylthreonylserylcysteinylhistidylvalylseryltryptophylalanylprolylpr–
olylglutamylasparaginylaspartylglycylglycylserylglutaminylvalylthreonylhi–
stidyltyrosylisoleucylvalylglutamyllysylarginylglutamylalanylaspartylargi–
nyllysylthreonyltryptophylserylthreonylvalylthreonylprolylglutamylvalylly–
syllysylthreonylserylphenylalanylhistidylvalylthreonylasparaginylleucylva–
lylprolylglycylasparaginylglutamyltyrosyltyrosylphenylalanylarginylvalylt–
hreonylalanylvalylasparaginylglutamyltyrosylglycylprolylglycylvalylprolyl–
threonylaspartylvalylprolyllysylprolylvalylleucylalanylserylaspartylproly–
lleucylserylglutamylprolylaspartylprolylprolylarginyllysylleucylglutamyla–
lanylthreonylglutamylmethionylthreonyllysylasparaginylserylalanylthreonyl–
leucylalanyltryptophylleucylprolylprolylleucylarginylaspartylglycylglycyl–
alanyllysylisoleucylaspartylglycyltyrosylisoleucylisoleucylseryltyrosylar–
ginylglutamylglutamylglutamylglutaminylprolylalanylaspartylarginyltryptop–
hylthreonylglutamyltyrosylserylvalylvalyllysylaspartylleucylserylleucylva–
lylvalylthreonylglycylleucyllysylglutamylglycyllysyllysyltyrosyllysylphen–
ylalanylarginylvalylalanylalanylarginylasparaginylalanylvalylglycylvalyls–
erylleucylprolylarginylglutamylalanylglutamylglycylvalyltyrosylglutamylal–
anyllysylglutamylglutaminylleucylleucylprolylprolyllysylisoleucylleucylme–
thionylprolylglutamylglutaminylisoleucylthreonylisoleucyllysylalanylglycy–
llysyllysylleucylarginylisoleucylglutamylalanylhistidylvalyltyrosylglycyl–
lysylprolylhistidylprolylthreonylcysteinyllysyltryptophyllysyllysylglycyl–
glutamylaspartylglutamylvalylvalylthreonylserylserylhistidylleucylalanylv–
alylhistidyllysylalanylaspartylserylserylserylisoleucylleucylisoleucyliso–
leucyllysylaspartylvalylthreonylarginyllysylaspartylserylglycyltyrosyltyr–
osylserylleucylthreonylalanylglutamylasparaginylserylserylglycylthreonyla–
spartylthreonylglutaminyllysylisoleucyllysylvalylvalylvalylmethionylaspar–
tylalanylprolylglycylprolylprolylglutaminylprolylprolylphenylalanylaspart–
ylisoleucylserylaspartylisoleucylaspartylalanylaspartylalanylcysteinylser–
ylleucylseryltryptophylhistidylisoleucylprolylleucylglutamylaspartylglycy–
lglycylserylasparaginylisoleucylthreonylasparaginyltyrosylisoleucylvalylg–
lutamyllysylcysteinylaspartylvalylserylarginylglycylaspartyltryptophylval–
ylthreonylalanylleucylalanylserylvalylthreonyllysylthreonylserylcysteinyl–
arginylvalylglycyllysylleucylisoleucylprolylglycylglutaminylglutamyltyros–
ylisoleucylphenylalanylarginylvalylarginylalanylglutamylasparaginylarginy–
lphenylalanylglycylisoleucylserylglutamylprolylleucylthreonylserylprolyll–
ysylmethionylvalylalanylglutaminylphenylalanylprolylphenylalanylglycylval–
ylprolylserylglutamylprolyllysylasparaginylalanylarginylvalylthreonyllysy–
lvalylasparaginyllysylaspartylcysteinylisoleucylphenylalanylvalylalanyltr–
yptophylaspartylarginylprolylaspartylserylaspartylglycylglycylserylprolyl–
isoleucylisoleucylglycyltyrosylleucylisoleucylglutamylarginyllysylglutamy–
larginylasparaginylserylleucylleucyltryptophylvalyllysylalanylasparaginyl–
aspartylthreonylleucylvalylarginylserylthreonylglutamyltyrosylprolylcyste–
inylalanylglycylleucylvalylglutamylglycylleucylglutamyltyrosylserylphenyl–
alanylarginylisoleucyltyrosylalanylleucylasparaginyllysylalanylglycylsery–
lserylprolylprolylseryllysylprolylthreonylglutamyltyrosylvalylthreonylala–
nylarginylmethionylprolylvalylaspartylprolylprolylglycyllysylprolylglutam–
ylvalylisoleucylaspartylvalylthreonyllysylserylthreonylvalylserylleucylis–
oleucyltryptophylalanylarginylprolyllysylhistidylaspartylglycylglycylsery–
llysylisoleucylisoleucylglycyltyrosylphenylalanylvalylglutamylalanylcyste–
inyllysylleucylprolylglycylaspartyllysyltryptophylvalylarginylcysteinylas–
paraginylthreonylalanylprolylhistidylglutaminylisoleucylprolylglutaminylg–
lutamylglutamyltyrosylthreonylalanylthreonylglycylleucylglutamylglutamyll–
ysylalanylglutaminyltyrosylglutaminylphenylalanylarginylalanylisoleucylal–
anylarginylthreonylalanylvalylasparaginylisoleucylserylprolylprolylserylg–
lutamylprolylserylaspartylprolylvalylthreonylisoleucylleucylalanylglutamy–
lasparaginylvalylprolylprolylarginylisoleucylaspartylleucylserylvalylalan–
ylmethionyllysylserylleucylleucylthreonylvalyllysylalanylglycylthreonylas–
paraginylvalylcysteinylleucylaspartylalanylthreonylvalylphenylalanylglycy–
llysylprolylmethionylprolylthreonylvalylseryltryptophyllysyllysylaspartyl–
glycylthreonylleucylleucyllysylprolylalanylglutamylglycylisoleucyllysylme–
thionylalanylmethionylglutaminylarginylasparaginylleucylcysteinylthreonyl–
leucylglutamylleucylphenylalanylserylvalylasparaginylarginyllysylaspartyl–
serylglycylaspartyltyrosylthreonylisoleucylthreonylalanylglutamylasparagi–
nylserylserylglycylseryllysylserylalanylthreonylisoleucyllysylleucyllysyl–
valylleucylaspartyllysylprolylglycylprolylprolylalanylserylvalyllysylisol–
eucylasparaginyllysylmethionyltyrosylserylaspartylarginylalanylmethionyll–
eucylseryltryptophylglutamylprolylprolylleucylglutamylaspartylglycylglycy–
lserylglutamylisoleucylthreonylasparaginyltyrosylisoleucylvalylaspartylly–
sylarginylglutamylthreonylserylarginylprolylasparaginyltryptophylalanylgl–
utaminylvalylserylalanylthreonylvalylprolylisoleucylthreonylserylcysteiny–
lserylvalylglutamyllysylleucylisoleucylglutamylglycylhistidylglutamyltyro–
sylglutaminylphenylalanylarginylisoleucylcysteinylalanylglutamylasparagin–
yllysyltyrosylglycylvalylglycylaspartylprolylvalylphenylalanylthreonylglu–
tamylprolylalanylisoleucylalanyllysylasparaginylprolyltyrosylaspartylprol–
ylprolylglycylarginylcysteinylaspartylprolylprolylvalylisoleucylserylaspa–
raginylisoleucylthreonyllysylaspartylhistidylmethionylthreonylvalylserylt–
ryptophyllysylprolylprolylalanylaspartylaspartylglycylglycylserylprolylis–
oleucylthreonylglycyltyrosylleucylleucylglutamyllysylarginylglutamylthreo–
nylglutaminylalanylvalylasparaginyltryptophylthreonyllysylvalylasparaginy–
larginyllysylprolylisoleucylisoleucylglutamylarginylthreonylleucyllysylal–
anylthreonylglycylleucylglutaminylglutamylglycylthreonylglutamyltyrosylgl–
utamylphenylalanylarginylvalylthreonylalanylisoleucylasparaginyllysylalan–
ylglycylprolylglycyllysylprolylserylaspartylalanylseryllysylalanylalanylt–
yrosylalanylarginylaspartylprolylglutaminyltyrosylprolylprolylalanylproly–
lprolylalanylphenylalanylprolyllysylvalyltyrosylaspartylthreonylthreonyla–
rginylserylserylvalylserylleucylseryltryptophylglycyllysylprolylalanyltyr–
osylaspartylglycylglycylserylprolylisoleucylisoleucylglycyltyrosylleucylv–
alylglutamylvalyllysylarginylalanylaspartylserylaspartylasparaginyltrypto–
phylvalylarginylcysteinylasparaginylleucylprolylglutaminylasparaginylleuc–
ylglutaminyllysylthreonylarginylphenylalanylglutamylvalylthreonylglycylle–
ucylmethionylglutamylaspartylthreonylglutaminyltyrosylglutaminylphenylala–
nylarginylvalyltyrosylalanylvalylasparaginyllysylisoleucylglycyltyrosylse–
rylaspartylprolylserylaspartylvalylprolylaspartyllysylhistidyltyrosylprol–
yllysylaspartylisoleucylleucylisoleucylprolylprolylglutamylglycylglutamyl–
histidylaspartylalanylaspartylleucylarginyllysylthreonylleucylisoleucylle–
ucylarginylalanylglycylvalylthreonylmethionylarginylleucyltyrosylvalylpro–
lylvalyllysylglycylarginylprolylprolylprolyllysylisoleucylthreonyltryptop–
hylseryllysylprolylasparaginylvalylasparaginylleucylarginylaspartylarginy–
lisoleucylglycylleucylaspartylisoleucyllysylserylthreonylaspartylphenylal–
anylaspartylthreonylphenylalanylleucylarginylcysteinylglutamylasparaginyl–
valylasparaginyllysyltyrosylaspartylalanylglycyllysyltyrosylisoleucylleuc–
ylthreonylleucylglutamylasparaginylserylcysteinylglycyllysyllysylglutamyl–
tyrosylthreonylisoleucylvalylvalyllysylvalylleucylaspartylthreonylprolylg–
lycylprolylprolylisoleucylasparaginylvalylthreonylvalyllysylglutamylisole–
ucylseryllysylaspartylserylalanyltyrosylvalylthreonyltryptophylglutamylpr–
olylprolylisoleucylisoleucylaspartylglycylglycylserylprolylisoleucylisole–
ucylasparaginyltyrosylvalylvalylglutaminyllysylarginylaspartylalanylgluta–
mylarginyllysylseryltryptophylserylthreonylvalylthreonylthreonylglutamylc–
ysteinylseryllysylthreonylserylphenylalanylarginylvalylprolylasparaginyll–
eucylglutamylglutamylglycyllysylseryltyrosylphenylalanylphenylalanylargin–
ylvalylphenylalanylalanylglutamylasparaginylglutamyltyrosylglycylisoleucy–
lglycylaspartylprolylglycylglutamylthreonylarginylaspartylalanylvalyllysy–
lalanylserylglutaminylthreonylprolylglycylprolylvalylvalylaspartylleucyll–
ysylvalylarginylserylvalylseryllysylserylserylcysteinylserylisoleucylglyc–
yltryptophyllysyllysylprolylhistidylserylaspartylglycylglycylserylarginyl–
isoleucylisoleucylglycyltyrosylvalylvalylaspartylphenylalanylleucylthreon–
ylglutamylglutamylasparaginyllysyltryptophylglutaminylarginylvalylmethion–
yllysylserylleucylserylleucylglutaminyltyrosylserylalanyllysylaspartylleu–
cylthreonylglutamylglycyllysylglutamyltyrosylthreonylphenylalanylarginylv–
alylserylalanylglutamylasparaginylglutamylasparaginylglycylglutamylglycyl–
threonylprolylserylglutamylisoleucylthreonylvalylvalylalanylarginylaspart–
ylaspartylvalylvalylalanylprolylaspartylleucylaspartylleucyllysylglycylle–
ucylprolylaspartylleucylcysteinyltyrosylleucylalanyllysylglutamylasparagi–
nylserylasparaginylphenylalanylarginylleucyllysylisoleucylprolylisoleucyl–
lysylglycyllysylprolylalanylprolylserylvalylseryltryptophyllysyllysylglyc–
ylglutamylaspartylprolylleucylalanylthreonylaspartylthreonylarginylvalyls–
erylvalylglutamylserylserylalanylvalylasparaginylthreonylthreonylleucylis–
oleucylvalyltyrosylaspartylcysteinylglutaminyllysylserylaspartylalanylgly–
cyllysyltyrosylthreonylisoleucylthreonylleucyllysylasparaginylvalylalanyl–
glycylthreonyllysylglutamylglycylthreonylisoleucylserylisoleucyllysylvaly–
lvalylglycyllysylprolylglycylisoleucylprolylthreonylglycylprolylisoleucyl–
lysylphenylalanylaspartylglutamylvalylthreonylalanylglutamylalanylmethion–
ylthreonylleucyllysyltryptophylalanylprolylprolyllysylaspartylaspartylgly–
cylglycylserylglutamylisoleucylthreonylasparaginyltyrosylisoleucylleucylg–
lutamyllysylarginylaspartylserylvalylasparaginylasparaginyllysyltryptophy–
lvalylthreonylcysteinylalanylserylalanylvalylglutaminyllysylthreonylthreo–
nylphenylalanylarginylvalylthreonylarginylleucylhistidylglutamylglycylmet–
hionylglutamyltyrosylthreonylphenylalanylarginylvalylserylalanylglutamyla–
sparaginyllysyltyrosylglycylvalylglycylglutamylglycylleucyllysylserylglut–
amylprolylisoleucylvalylalanylarginylhistidylprolylphenylalanylaspartylva–
lylprolylaspartylalanylprolylprolylprolylprolylasparaginylisoleucylvalyla–
spartylvalylarginylhistidylaspartylserylvalylserylleucylthreonyltryptophy–
lthreonylaspartylprolyllysyllysylthreonylglycylglycylserylprolylisoleucyl–
threonylglycyltyrosylhistidylleucylglutamylphenylalanyllysylglutamylargin–
ylasparaginylserylleucylleucyltryptophyllysylarginylalanylasparaginyllysy–
lthreonylprolylisoleucylarginylmethionylarginylaspartylphenylalanyllysylv–
alylthreonylglycylleucylthreonylglutamylglycylleucylglutamyltyrosylglutam–
ylphenylalanylarginylvalylmethionylalanylisoleucylasparaginylleucylalanyl–
glycylvalylglycyllysylprolylserylleucylprolylserylglutamylprolylvalylvaly–
lalanylleucylaspartylprolylisoleucylaspartylprolylprolylglycyllysylprolyl–
glutamylvalylisoleucylasparaginylisoleucylthreonylarginylasparaginylseryl–
valylthreonylleucylisoleucyltryptophylthreonylglutamylprolyllysyltyrosyla–
spartylglycylglycylhistidyllysylleucylthreonylglycyltyrosylisoleucylvalyl–
glutamyllysylarginylaspartylleucylprolylseryllysylseryltryptophylmethiony–
llysylalanylasparaginylhistidylvalylasparaginylvalylprolylglutamylcystein–
ylalanylphenylalanylthreonylvalylthreonylaspartylleucylvalylglutamylglycy–
lglycyllysyltyrosylglutamylphenylalanylarginylisoleucylarginylalanyllysyl–
asparaginylthreonylalanylglycylalanylisoleucylserylalanylprolylserylgluta–
mylserylthreonylglutamylthreonylisoleucylisoleucylcysteinyllysylaspartylg–
lutamyltyrosylglutamylalanylprolylthreonylisoleucylvalylleucylaspartylpro–
lylthreonylisoleucyllysylaspartylglycylleucylthreonylisoleucyllysylalanyl–
glycylaspartylthreonylisoleucylvalylleucylasparaginylalanylisoleucylseryl–
isoleucylleucylglycyllysylprolylleucylprolyllysylserylseryltryptophylsery–
llysylalanylglycyllysylaspartylisoleucylarginylprolylserylaspartylisoleuc–
ylthreonylglutaminylisoleucylthreonylserylthreonylprolylthreonylserylsery–
lmethionylleucylthreonylisoleucyllysyltyrosylalanylthreonylarginyllysylas–
partylalanylglycylglutamyltyrosylthreonylisoleucylthreonylalanylthreonyla–
sparaginylprolylphenylalanylglycylthreonyllysylvalylglutamylhistidylvalyl–
lysylvalylthreonylvalylleucylaspartylvalylprolylglycylprolylprolylglycylp–
rolylvalylglutamylisoleucylserylasparaginylvalylserylalanylglutamyllysyla–
lanylthreonylleucylthreonyltryptophylthreonylprolylprolylleucylglutamylas–
partylglycylglycylserylprolylisoleucyllysylseryltyrosylisoleucylleucylglu–
tamyllysylarginylglutamylthreonylserylarginylleucylleucyltryptophylthreon–
ylvalylvalylserylglutamylaspartylisoleucylglutaminylserylcysteinylarginyl–
histidylvalylalanylthreonyllysylleucylisoleucylglutaminylglycylasparaginy–
lglutamyltyrosylisoleucylphenylalanylarginylvalylserylalanylvalylasparagi–
nylhistidyltyrosylglycyllysylglycylglutamylprolylvalylglutaminylserylglut–
amylprolylvalyllysylmethionylvalylaspartylarginylphenylalanylglycylprolyl–
prolylglycylprolylprolylglutamyllysylprolylglutamylvalylserylasparaginylv–
alylthreonyllysylasparaginylthreonylalanylthreonylvalylseryltryptophyllys–
ylarginylprolylvalylaspartylaspartylglycylglycylserylglutamylisoleucylthr–
eonylglycyltyrosylhistidylvalylglutamylarginylarginylglutamyllysyllysylse–
rylleucylarginyltryptophylvalylarginylalanylisoleucyllysylthreonylprolylv–
alylserylaspartylleucylarginylcysteinyllysylvalylthreonylglycylleucylglut–
aminylglutamylglycylserylthreonyltyrosylglutamylphenylalanylarginylvalyls–
erylalanylglutamylasparaginylarginylalanylglycylisoleucylglycylprolylprol–
ylserylglutamylalanylserylaspartylserylvalylleucylmethionyllysylaspartyla–
lanylalanyltyrosylprolylprolylglycylprolylprolylserylasparaginylprolylhis–
tidylvalylthreonylaspartylthreonylthreonyllysyllysylserylalanylserylleucy–
lalanyltryptophylglycyllysylprolylhistidyltyrosylaspartylglycylglycylleuc–
ylglutamylisoleucylthreonylglycyltyrosylvalylvalylglutamylhistidylglutami–
nyllysylvalylglycylaspartylglutamylalanyltryptophylisoleucyllysylaspartyl–
threonylthreonylglycylthreonylalanylleucylarginylisoleucylthreonylglutami–
nylphenylalanylvalylvalylprolylaspartylleucylglutaminylthreonyllysylgluta–
myllysyltyrosylasparaginylphenylalanylarginylisoleucylserylalanylisoleucy–
lasparaginylaspartylalanylglycylvalylglycylglutamylprolylalanylvalylisole–
ucylprolylaspartylvalylglutamylisoleucylvalylglutamylarginylglutamylmethi–
onylalanylprolylaspartylphenylalanylglutamylleucylaspartylalanylglutamyll–
eucylarginylarginylthreonylleucylvalylvalylarginylalanylglycylleucylseryl–
isoleucylarginylisoleucylphenylalanylvalylprolylisoleucyllysylglycylargin–
ylprolylalanylprolylglutamylvalylthreonyltryptophylthreonyllysylaspartyla–
sparaginylisoleucylasparaginylleucyllysylasparaginylarginylalanylasparagi–
nylisoleucylglutamylasparaginylthreonylglutamylserylphenylalanylthreonyll–
eucylleucylisoleucylisoleucylprolylglutamylcysteinylasparaginylarginyltyr–
osylaspartylthreonylglycyllysylphenylalanylvalylmethionylthreonylisoleucy–
lglutamylasparaginylprolylalanylglycyllysyllysylserylglycylphenylalanylva–
lylasparaginylvalylarginylvalylleucylaspartylthreonylprolylglycylprolylva–
lylleucylasparaginylleucylarginylprolylthreonylaspartylisoleucylthreonyll–
ysylaspartylserylvalylthreonylleucylhistidyltryptophylaspartylleucylproly–
lleucylisoleucylaspartylglycylglycylserylarginylisoleucylthreonylasparagi–
nyltyrosylisoleucylvalylglutamyllysylarginylglutamylalanylthreonylarginyl–
lysylseryltyrosylserylthreonylalanylthreonylthreonyllysylcysteinylhistidy–
llysylcysteinylthreonyltyrosyllysylvalylthreonylglycylleucylserylglutamyl–
glycylcysteinylglutamyltyrosylphenylalanylphenylalanylarginylvalylmethion–
ylalanylglutamylasparaginylglutamyltyrosylglycylisoleucylglycylglutamylpr–
olylthreonylglutamylthreonylthreonylglutamylprolylvalyllysylalanylserylgl–
utamylalanylprolylserylprolylprolylaspartylserylleucylasparaginylisoleucy–
lmethionylaspartylisoleucylthreonyllysylserylthreonylvalylserylleucylalan–
yltryptophylprolyllysylprolyllysylhistidylaspartylglycylglycylseryllysyli–
soleucylthreonylglycyltyrosylvalylisoleucylglutamylalanylglutaminylarginy–
llysylglycylserylaspartylglutaminyltryptophylthreonylhistidylisoleucylthr–
eonylthreonylvalyllysylglycylleucylglutamylcysteinylvalylvalylarginylaspa–
raginylleucylthreonylglutamylglycylglutamylglutamyltyrosylthreonylphenyla–
lanylglutaminylvalylmethionylalanylvalylasparaginylserylalanylglycylargin–
ylserylalanylprolylarginylglutamylserylarginylprolylvalylisoleucylvalylly–
sylglutamylglutaminylthreonylmethionylleucylprolylglutamylleucylaspartyll–
eucylarginylglycylisoleucyltyrosylglutaminyllysylleucylvalylisoleucylalan–
yllysylalanylglycylaspartylasparaginylisoleucyllysylvalylglutamylisoleucy–
lprolylvalylleucylglycylarginylprolyllysylprolylthreonylvalylthreonyltryp–
tophyllysyllysylglycylaspartylglutaminylisoleucylleucyllysylglutaminylthr–
eonylglutaminylarginylvalylasparaginylphenylalanylglutamylthreonylthreony–
lalanylthreonylserylthreonylisoleucylleucylasparaginylisoleucylasparaginy–
lglutamylcysteinylvalylarginylserylaspartylserylglycylprolyltyrosylprolyl–
leucylthreonylalanylarginylasparaginylisoleucylvalylglycylglutamylvalylgl–
ycylaspartylvalylisoleucylthreonylisoleucylglutaminylvalylhistidylasparty–
lisoleucylprolylglycylprolylprolylthreonylglycylprolylisoleucyllysylpheny–
lalanylaspartylglutamylvalylserylserylaspartylphenylalanylvalylthreonylph–
enylalanylseryltryptophylaspartylprolylprolylglutamylasparaginylaspartylg–
lycylglycylvalylprolylisoleucylserylasparaginyltyrosylvalylvalylglutamylm–
ethionylarginylglutaminylthreonylaspartylserylthreonylthreonyltryptophylv–
alylglutamylleucylalanylthreonylthreonylvalylisoleucylarginylthreonylthre–
onyltyrosyllysylalanylthreonylarginylleucylthreonylthreonylglycylleucylgl–
utamyltyrosylglutaminylphenylalanylarginylvalyllysylalanylglutaminylaspar–
aginylarginyltyrosylglycylvalylglycylprolylglycylisoleucylthreonylserylal–
anyltryptophylisoleucylvalylalanylasparaginyltyrosylprolylphenylalanyllys–
ylvalylprolylglycylprolylprolylglycylthreonylprolylglutaminylvalylthreony–
lalanylvalylthreonyllysylaspartylserylmethionylthreonylisoleucylseryltryp–
tophylhistidylglutamylprolylleucylserylaspartylglycylglycylserylprolyliso–
leucylleucylglycyltyrosylhistidylvalylglutamylarginyllysylglutamylarginyl–
asparaginylglycylisoleucylleucyltryptophylglutaminylthreonylvalylseryllys–
ylalanylleucylvalylprolylglycylasparaginylisoleucylphenylalanyllysylseryl–
serylglycylleucylthreonylaspartylglycylisoleucylalanyltyrosylglutamylphen–
ylalanylarginylvalylisoleucylalanylglutamylasparaginylmethionylalanylglyc–
yllysylseryllysylprolylseryllysylprolylserylglutamylprolylmethionylleucyl–
alanylleucylaspartylprolylisoleucylaspartylprolylprolylglycyllysylprolylv–
alylprolylleucylasparaginylisoleucylthreonylarginylhistidylthreonylvalylt–
hreonylleucyllysyltryptophylalanyllysylprolylglutamyltyrosylthreonylglycy–
lglycylphenylalanyllysylisoleucylthreonylseryltyrosylisoleucylvalylglutam–
yllysylarginylaspartylleucylprolylasparaginylglycylarginyltryptophylleucy–
llysylalanylasparaginylphenylalanylserylasparaginylisoleucylleucylglutamy–
lasparaginylglutamylphenylalanylthreonylvalylserylglycylleucylthreonylglu–
tamylaspartylalanylalanyltyrosylglutamylphenylalanylarginylvalylisoleucyl–
alanyllysylasparaginylalanylalanylglycylalanylisoleucylserylprolylprolyls–
erylglutamylprolylserylaspartylalanylisoleucylthreonylcysteinylarginylasp–
artylaspartylvalylglutamylalanylprolyllysylisoleucyllysylvalylaspartylval–
yllysylphenylalanyllysylaspartylthreonylvalylisoleucylleucyllysylalanylgl–
ycylglutamylalanylphenylalanylarginylleucylglutamylalanylaspartylvalylser–
ylglycylarginylprolylprolylprolylthreonylmethionylglutamyltryptophylseryl–
lysylaspartylglycyllysylglutamylleucylglutamylglycylthreonylalanyllysylle–
ucylglutamylisoleucyllysylisoleucylalanylaspartylphenylalanylserylthreony–
lasparaginylleucylvalylasparaginyllysylaspartylserylthreonylarginylarginy–
laspartylserylglycylalanyltyrosylthreonylleucylthreonylalanylthreonylaspa–
raginylprolylglycylglycylphenylalanylalanyllysylhistidylisoleucylphenylal–
anylasparaginylvalyllysylvalylleucylaspartylarginylprolylglycylprolylprol–
ylglutamylglycylprolylleucylalanylvalylthreonylglutamylvalylthreonylseryl–
glutamyllysylcysteinylvalylleucylseryltryptophylphenylalanylprolylprolyll–
eucylaspartylaspartylglycylglycylalanyllysylisoleucylaspartylhistidyltyro–
sylisoleucylvalylglutaminyllysylarginylglutamylthreonylserylarginylleucyl–
alanyltryptophylthreonylasparaginylvalylalanylserylglutamylvalylglutaminy–
lvalylthreonyllysylleucyllysylvalylthreonyllysylleucylleucyllysylglycylas–
paraginylglutamyltyrosylisoleucylphenylalanylarginylvalylmethionylalanylv–
alylasparaginyllysyltyrosylglycylvalylglycylglutamylprolylleucylglutamyls–
erylglutamylprolylvalylleucylalanylvalylasparaginylprolyltyrosylglycylpro–
lylprolylaspartylprolylprolyllysylasparaginylprolylglutamylvalylthreonylt–
hreonylisoleucylthreonyllysylaspartylserylmethionylvalylvalylcysteinyltry–
ptophylglycylhistidylprolylaspartylserylaspartylglycylglycylserylglutamyl–
isoleucylisoleucylasparaginyltyrosylisoleucylvalylglutamylarginylarginyla–
spartyllysylalanylglycylglutaminylarginyltryptophylisoleucyllysylcysteiny–
lasparaginyllysyllysylthreonylleucylthreonylaspartylleucylarginyltyrosyll–
ysylvalylserylglycylleucylthreonylglutamylglycylhistidylglutamyltyrosylgl–
utamylphenylalanylarginylisoleucylmethionylalanylglutamylasparaginylalany–
lalanylglycylisoleucylserylalanylprolylserylprolylthreonylserylprolylphen–
ylalanyltyrosyllysylalanylcysteinylaspartylthreonylvalylphenylalanyllysyl–
prolylglycylprolylprolylglycylasparaginylprolylarginylvalylleucylaspartyl–
threonylserylarginylserylserylisoleucylserylisoleucylalanyltryptophylaspa–
raginyllysylprolylisoleucyltyrosylaspartylglycylglycylserylglutamylisoleu–
cylthreonylglycyltyrosylmethionylvalylglutamylisoleucylalanylleucylprolyl–
glutamylglutamylaspartylglutamyltryptophylglutaminylisoleucylvalylthreony–
lprolylprolylalanylglycylleucyllysylalanylthreonylseryltyrosylthreonyliso–
leucylthreonylglycylleucylthreonylglutamylasparaginylglutaminylglutamylty–
rosyllysylisoleucylarginylisoleucyltyrosylalanylmethionylasparaginylseryl–
glutamylglycylleucylglycylglutamylprolylalanylleucylvalylprolylglycylthre–
onylprolyllysylalanylglutamylaspartylarginylmethionylleucylprolylprolylgl–
utamylisoleucylglutamylleucylaspartylalanylaspartylleucylarginyllysylvaly–
lvalylthreonylisoleucylarginylalanylcysteinylcysteinylthreonylleucylargin–
ylleucylphenylalanylvalylprolylisoleucyllysylglycylarginylprolylaspartylp–
rolylglutamylvalyllysyltryptophylalanylarginylaspartylhistidylglycylgluta–
mylserylleucylaspartyllysylalanylserylisoleucylglutamylserylalanylserylse–
ryltyrosylthreonylleucylleucylisoleucylvalylglycylasparaginylvalylasparag–
inylarginylphenylalanylaspartylserylglycyllysyltyrosylisoleucylleucylthre–
onylvalylglutamylasparaginylserylserylglycylseryllysylserylalanylphenylal–
anylvalylasparaginylvalylarginylvalylleucylaspartylthreonylprolylglycylpr–
olylprolylglutaminylaspartylleucyllysylvalyllysylglutamylvalylthreonyllys–
ylthreonylserylvalylthreonylleucylthreonyltryptophylaspartylprolylprolyll–
eucylleucylaspartylglycylglycylseryllysylisoleucyllysylasparaginyltyrosyl–
isoleucylvalylglutamyllysylarginylglutamylserylthreonylarginyllysylalanyl–
tyrosylserylthreonylvalylalanylthreonylasparaginylcysteinylhistidyllysylt–
hreonylseryltryptophyllysylvalylaspartylglutaminylleucylglutaminylglutamy–
lglycylcysteinylseryltyrosyltyrosylphenylalanylarginylvalylleucylalanylgl–
utamylasparaginylglutamyltyrosylglycylisoleucylglycylleucylprolylalanylgl–
utamylthreonylalanylglutamylserylvalyllysylalanylserylglutamylarginylprol–
ylleucylprolylprolylglycyllysylisoleucylthreonylleucylmethionylaspartylva–
lylthreonylarginylasparaginylserylvalylserylleucylseryltryptophylglutamyl–
lysylprolylglutamylhistidylaspartylglycylglycylserylarginylisoleucylleucy–
lglycyltyrosylisoleucylvalylglutamylmethionylglutaminylthreonyllysylglycy–
lserylaspartyllysyltryptophylalanylthreonylcysteinylalanylthreonylvalylly–
sylvalylthreonylglutamylalanylthreonylisoleucylthreonylglycylleucylisoleu–
cylglutaminylglycylglutamylglutamyltyrosylserylphenylalanylarginylvalylse–
rylalanylglutaminylasparaginylglutamyllysylglycylisoleucylserylaspartylpr–
olylarginylglutaminylleucylserylvalylprolylvalylisoleucylalanyllysylaspar–
tylleucylvalylisoleucylprolylprolylalanylphenylalanyllysylleucylleucylphe–
nylalanylasparaginylthreonylphenylalanylthreonylvalylleucylalanylglycylgl–
utamylaspartylleucyllysylvalylaspartylvalylprolylphenylalanylisoleucylgly–
cylarginylprolylthreonylprolylalanylvalylthreonyltryptophylhistidyllysyla–
spartylasparaginylvalylprolylleucyllysylglutaminylthreonylthreonylarginyl–
valylasparaginylalanylglutamylserylthreonylglutamylasparaginylasparaginyl–
serylleucylleucylthreonylisoleucyllysylaspartylalanylcysteinylarginylglut–
amylaspartylvalylglycylhistidyltyrosylvalylvalyllysylleucylthreonylaspara–
ginylserylalanylglycylglutamylalanylisoleucylglutamylthreonylleucylaspara–
ginylvalylisoleucylvalylleucylaspartyllysylprolylglycylprolylprolylthreon–
ylglycylprolylvalyllysylmethionylaspartylglutamylvalylthreonylalanylaspar–
tylserylisoleucylthreonylleucylseryltryptophylglycylprolylprolyllysyltyro–
sylaspartylglycylglycylserylserylisoleucylasparaginylasparaginyltyrosylis–
oleucylvalylglutamyllysylarginylaspartylthreonylserylthreonylthreonylthre–
onyltryptophylglutaminylisoleucylvalylserylalanylthreonylvalylalanylargin–
ylthreonylthreonylisoleucyllysylalanylcysteinylarginylleucyllysylthreonyl–
glycylcysteinylglutamyltyrosylglutaminylphenylalanylarginylisoleucylalany–
lalanylglutamylasparaginylarginyltyrosylglycyllysylserylthreonyltyrosylle–
ucylasparaginylserylglutamylprolylthreonylvalylalanylglutaminyltyrosylpro–
lylphenylalanyllysylvalylprolylglycylprolylprolylglycylthreonylprolylvaly–
lvalylthreonylleucylserylserylarginylaspartylserylmethionylglutamylvalylg–
lutaminyltryptophylasparaginylglutamylprolylisoleucylserylaspartylglycylg–
lycylserylarginylvalylisoleucylglycyltyrosylhistidylleucylglutamylarginyl–
lysylglutamylarginylasparaginylserylisoleucylleucyltryptophylvalyllysylle–
ucylasparaginyllysylthreonylprolylisoleucylprolylglutaminylthreonyllysylp–
henylalanyllysylthreonylthreonylglycylleucylglutamylglutamylglycylvalylgl–
utamyltyrosylglutamylphenylalanylarginylvalylserylalanylglutamylasparagin–
ylisoleucylvalylglycylisoleucylglycyllysylprolylseryllysylvalylserylgluta–
mylcysteinyltyrosylvalylalanylarginylaspartylprolylcysteinylaspartylproly–
lprolylglycylarginylprolylglutamylalanylisoleucylisoleucylvalylthreonylar–
ginylasparaginylserylvalylthreonylleucylglutaminyltryptophyllysyllysylpro–
lylthreonyltyrosylaspartylglycylglycylseryllysylisoleucylthreonylglycylty–
rosylisoleucylvalylglutamyllysyllysylglutamylleucylprolylglutamylglycylar–
ginyltryptophylmethionyllysylalanylserylphenylalanylthreonylasparaginylis–
oleucylisoleucylaspartylthreonylhistidylphenylalanylglutamylvalylthreonyl–
glycylleucylvalylglutamylaspartylhistidylarginyltyrosylglutamylphenylalan–
ylarginylvalylisoleucylalanylarginylasparaginylalanylalanylglycylvalylphe–
nylalanylserylglutamylprolylserylglutamylserylthreonylglycylalanylisoleuc–
ylthreonylalanylarginylaspartylglutamylvalylaspartylprolylprolylarginylis–
oleucylserylmethionylaspartylprolyllysyltyrosyllysylaspartylthreonylisole–
ucylvalylvalylhistidylalanylglycylglutamylserylphenylalanyllysylvalylaspa–
rtylalanylaspartylisoleucyltyrosylglycyllysylprolylisoleucylprolylthreony–
lisoleucylglutaminyltryptophylisoleucyllysylglycylaspartylglutaminylgluta–
mylleucylserylasparaginylthreonylalanylarginylleucylglutamylisoleucyllysy–
lserylthreonylaspartylphenylalanylalanylthreonylserylleucylserylvalyllysy–
laspartylalanylvalylarginylvalylaspartylserylglycylasparaginyltyrosylisol–
eucylleucyllysylalanyllysylasparaginylvalylalanylglycylglutamylarginylser–
ylvalylthreonylvalylasparaginylvalyllysylvalylleucylaspartylarginylprolyl–
glycylprolylprolylglutamylglycylprolylvalylvalylisoleucylserylglycylvalyl–
threonylalanylglutamyllysylcysteinylthreonylleucylalanyltryptophyllysylpr–
olylprolylleucylglutaminylaspartylglycylglycylserylaspartylisoleucylisole–
ucylasparaginyltyrosylisoleucylvalylglutamylarginylarginylglutamylthreony–
lserylarginylleucylvalyltryptophylthreonylvalylvalylaspartylalanylasparag–
inylvalylglutaminylthreonylleucylserylcysteinyllysylvalylthreonyllysylleu–
cylleucylglutamylglycylasparaginylglutamyltyrosylthreonylphenylalanylargi–
nylisoleucylmethionylalanylvalylasparaginyllysyltyrosylglycylvalylglycylg–
lutamylprolylleucylglutamylserylglutamylprolylvalylvalylalanyllysylaspara–
ginylprolylphenylalanylvalylvalylprolylaspartylalanylprolyllysylalanylpro–
lylglutamylvalylthreonylthreonylvalylthreonyllysylaspartylserylmethionyli–
soleucylvalylvalyltryptophylglutamylarginylprolylalanylserylaspartylglycy–
lglycylserylglutamylisoleucylleucylglycyltyrosylvalylleucylglutamyllysyla–
rginylaspartyllysylglutamylglycylisoleucylarginyltryptophylthreonylarginy–
lcysteinylhistidyllysylarginylleucylisoleucylglycylglutamylleucylarginyll–
eucylarginylvalylthreonylglycylleucylisoleucylglutamylasparaginylhistidyl–
aspartyltyrosylglutamylphenylalanylarginylvalylserylalanylglutamylasparag–
inylalanylalanylglycylleucylserylglutamylprolylserylprolylprolylserylalan–
yltyrosylglutaminyllysylalanylcysteinylaspartylprolylisoleucyltyrosyllysy–
lprolylglycylprolylprolylasparaginylasparaginylprolyllysylvalylisoleucyla–
spartylisoleucylthreonylarginylserylserylvalylphenylalanylleucylseryltryp–
tophylseryllysylprolylisoleucyltyrosylaspartylglycylglycylcysteinylglutam–
ylisoleucylglutaminylglycyltyrosylisoleucylvalylglutamyllysylcysteinylasp–
artylvalylasparaginylvalylglycylglutamyltryptophylthreonylmethionylcystei–
nylthreonylprolylprolylthreonylglycylisoleucylasparaginyllysylthreonylasp–
araginylisoleucylglutamylvalylglutamyllysylleucylleucylglutamyllysylhisti–
dylglutamyltyrosylasparaginylphenylalanylarginylisoleucylcysteinylalanyli–
soleucylasparaginyllysylalanylglycylvalylglycylglutamylhistidylalanylaspa–
rtylvalylprolylglycylprolylisoleucylisoleucylvalylglutamylglutamyllysylle–
ucylglutamylalanylprolylaspartylisoleucylaspartylleucylaspartylleucylglut–
amylleucylarginyllysylisoleucylisoleucylasparaginylisoleucylarginylalanyl–
glycylglycylserylleucylarginylleucylphenylalanylvalylprolylisoleucyllysyl–
glycylarginylprolylthreonylprolylglutamylvalyllysyltryptophylglycyllysylv–
alylaspartylglycylglutamylisoleucylarginylaspartylalanylalanylisoleucylis–
oleucylaspartylvalylthreonylserylserylphenylalanylthreonylserylleucylvaly–
lleucylaspartylasparaginylvalylasparaginylarginyltyrosylaspartylserylglyc–
yllysyltyrosylthreonylleucylthreonylleucylglutamylasparaginylserylserylgl–
ycylthreonyllysylserylalanylphenylalanylvalylthreonylvalylarginylvalylleu–
cylaspartylthreonylprolylserylprolylprolylvalylasparaginylleucyllysylvaly–
lthreonylglutamylisoleucylthreonyllysylaspartylserylvalylserylisoleucylth–
reonyltryptophylglutamylprolylprolylleucylleucylaspartylglycylglycylseryl–
lysylisoleucyllysylasparaginyltyrosylisoleucylvalylglutamyllysylarginylgl–
utamylalanylthreonylarginyllysylseryltyrosylalanylalanylvalylvalylthreony–
lasparaginylcysteinylhistidyllysylasparaginylseryltryptophyllysylisoleucy–
laspartylglutaminylleucylglutaminylglutamylglycylcysteinylseryltyrosyltyr–
osylphenylalanylarginylvalylthreonylalanylglutamylasparaginylglutamyltyro–
sylglycylisoleucylglycylleucylprolylalanylglutaminylthreonylalanylasparty–
lprolylisoleucyllysylvalylalanylglutamylvalylprolylglutaminylprolylprolyl–
glycyllysylisoleucylthreonylvalylaspartylaspartylvalylthreonylarginylaspa–
raginylserylvalylserylleucylseryltryptophylthreonyllysylprolylglutamylhis–
tidylaspartylglycylglycylseryllysylisoleucylisoleucylglutaminyltyrosyliso–
leucylvalylglutamylmethionylglutaminylalanyllysylhistidylserylglutamyllys–
yltryptophylserylglutamylcysteinylalanylarginylvalyllysylserylleucylgluta–
minylalanylvalylisoleucylthreonylasparaginylleucylthreonylglutaminylglycy–
lglutamylglutamyltyrosylleucylphenylalanylarginylvalylvalylalanylvalylasp–
araginylglutamyllysylglycylarginylserylaspartylprolylarginylserylleucylal–
anylvalylprolylisoleucylvalylalanyllysylaspartylleucylvalylisoleucylgluta–
mylprolylaspartylvalyllysylprolylalanylphenylalanylserylseryltyrosylseryl–
valylglutaminylvalylglycylglutaminylaspartylleucyllysylmethionylglutamylv–
alylprolylisoleucylserylglycylarginylprolyllysylprolylthreonylisoleucylth–
reonyltryptophylthreonyllysylaspartylglycylleucylprolylleucyllysylglutami–
nylthreonylthreonylarginylisoleucylasparaginylvalylthreonylaspartylseryll–
eucylaspartylleucylthreonylthreonylleucylserylisoleucyllysylglutamylthreo–
nylhistidyllysylaspartylaspartylglycylglycylglutaminyltyrosylglycylisoleu–
cylthreonylvalylalanylasparaginylvalylvalylglycylglutaminyllysylthreonyla–
lanylserylisoleucylglutamylisoleucylvalylthreonylleucylaspartyllysylproly–
laspartylprolylprolyllysylglycylprolylvalyllysylphenylalanylaspartylaspar–
tylvalylserylalanylglutamylserylisoleucylthreonylleucylseryltryptophylasp–
araginylprolylprolylleucyltyrosylthreonylglycylglycylcysteinylglutaminyli–
soleucylthreonylasparaginyltyrosylisoleucylvalylglutaminyllysylarginylasp–
artylthreonylthreonylthreonylthreonylvalyltryptophylaspartylvalylvalylser–
ylalanylthreonylvalylalanylarginylthreonylthreonylleucyllysylvalylthreony–
llysylleucyllysylthreonylglycylthreonylglutamyltyrosylglutaminylphenylala–
nylarginylisoleucylphenylalanylalanylglutamylasparaginylarginyltyrosylgly–
cylglutaminylserylphenylalanylalanylleucylglutamylserylaspartylprolylisol–
eucylvalylalanylglutaminyltyrosylprolyltyrosyllysylglutamylprolylglycylpr–
olylprolylglycylthreonylprolylphenylalanylalanylthreonylalanylisoleucylse–
ryllysylaspartylserylmethionylvalylisoleucylglutaminyltryptophylhistidylg–
lutamylprolylvalylasparaginylasparaginylglycylglycylserylprolylvalylisole–
ucylglycyltyrosylhistidylleucylglutamylarginyllysylglutamylarginylasparag–
inylserylisoleucylleucyltryptophylthreonyllysylvalylasparaginyllysylthreo–
nylisoleucylisoleucylhistidylaspartylthreonylglutaminylphenylalanyllysyla–
lanylglutaminylasparaginylleucylglutamylglutamylglycylisoleucylglutamylty–
rosylglutamylphenylalanylarginylvalyltyrosylalanylglutamylasparaginylisol–
eucylvalylglycylvalylglycyllysylalanylseryllysylasparaginylserylglutamylc–
ysteinyltyrosylvalylalanylarginylaspartylprolylcysteinylaspartylprolylpro–
lylglycylthreonylprolylglutamylprolylisoleucylmethionylvalyllysylarginyla–
sparaginylglutamylisoleucylthreonylleucylglutaminyltryptophylthreonyllysy–
lprolylvalyltyrosylaspartylglycylglycylserylmethionylisoleucylthreonylgly–
cyltyrosylisoleucylvalylglutamyllysylarginylaspartylleucylprolylaspartylg–
lycylarginyltryptophylmethionyllysylalanylserylphenylalanylthreonylaspara–
ginylvalylisoleucylglutamylthreonylglutaminylphenylalanylthreonylvalylser–
ylglycylleucylthreonylglutamylaspartylglutaminylarginyltyrosylglutamylphe–
nylalanylarginylvalylisoleucylalanyllysylasparaginylalanylalanylglycylala–
nylisoleucylseryllysylprolylserylaspartylserylthreonylglycylprolylisoleuc–
ylthreonylalanyllysylaspartylglutamylvalylglutamylleucylprolylarginylisol–
eucylserylmethionylaspartylprolyllysylphenylalanylarginylaspartylthreonyl–
isoleucylvalylvalylasparaginylalanylglycylglutamylthreonylphenylalanylarg–
inylleucylglutamylalanylaspartylvalylhistidylglycyllysylprolylleucylproly–
lthreonylisoleucylglutamyltryptophylleucylarginylglycylaspartyllysylgluta–
mylisoleucylglutamylglutamylserylalanylarginylcysteinylglutamylisoleucyll–
ysylasparaginylthreonylaspartylphenylalanyllysylalanylleucylleucylisoleuc–
ylvalyllysylaspartylalanylisoleucylarginylisoleucylaspartylglycylglycylgl–
utaminyltyrosylisoleucylleucylarginylalanylserylasparaginylvalylalanylgly–
cylseryllysylserylphenylalanylprolylvalylasparaginylvalyllysylvalylleucyl–
aspartylarginylprolylglycylprolylprolylglutamylglycylprolylvalylglutaminy–
lvalylthreonylglycylvalylthreonylserylglutamyllysylcysteinylserylleucylth–
reonyltryptophylserylprolylprolylleucylglutaminylaspartylglycylglycylsery–
laspartylisoleucylserylhistidyltyrosylvalylvalylglutamyllysylarginylgluta–
mylthreonylserylarginylleucylalanyltryptophylthreonylvalylvalylalanylsery–
lglutamylvalylvalylthreonylasparaginylserylleucyllysylvalylthreonyllysyll–
eucylleucylglutamylglycylasparaginylglutamyltyrosylvalylphenylalanylargin–
ylisoleucylmethionylalanylvalylasparaginyllysyltyrosylglycylvalylglycylgl–
utamylprolylleucylglutamylserylalanylprolylvalylleucylmethionyllysylaspar–
aginylprolylphenylalanylvalylleucylprolylglycylprolylprolyllysylserylleuc–
ylglutamylvalylthreonylasparaginylisoleucylalanyllysylaspartylserylmethio–
nylthreonylvalylcysteinyltryptophylasparaginylarginylprolylaspartylseryla–
spartylglycylglycylserylglutamylisoleucylisoleucylglycyltyrosylisoleucylv–
alylglutamyllysylarginylaspartylarginylserylglycylisoleucylarginyltryptop–
hylisoleucyllysylcysteinylasparaginyllysylarginylarginylisoleucylthreonyl–
aspartylleucylarginylleucylarginylvalylthreonylglycylleucylthreonylglutam–
ylaspartylhistidylglutamyltyrosylglutamylphenylalanylarginylvalylserylala–
nylglutamylasparaginylalanylalanylglycylvalylglycylglutamylprolylserylpro–
lylalanylthreonylvalyltyrosyltyrosyllysylalanylcysteinylaspartylprolylval–
ylphenylalanyllysylprolylglycylprolylprolylthreonylasparaginylalanylhisti–
dylisoleucylvalylaspartylthreonylthreonyllysylasparaginylserylisoleucylth–
reonylleucylalanyltryptophylglycyllysylprolylisoleucyltyrosylaspartylglyc–
ylglycylserylglutamylisoleucylleucylglycyltyrosylvalylvalylglutamylisoleu–
cylcysteinyllysylalanylaspartylglutamylglutamylglutamyltryptophylglutamin–
ylisoleucylvalylthreonylprolylglutaminylthreonylglycylleucylarginylvalylt–
hreonylarginylphenylalanylglutamylisoleucylseryllysylleucylthreonylglutam–
ylhistidylglutaminylglutamyltyrosyllysylisoleucylarginylvalylcysteinylala–
nylleucylasparaginyllysylvalylglycylleucylglycylglutamylalanylthreonylser–
ylvalylprolylglycylthreonylvalyllysylprolylglutamylaspartyllysylleucylglu–
tamylalanylprolylglutamylleucylaspartylleucylaspartylserylglutamylleucyla–
rginyllysylglycylisoleucylvalylvalylarginylalanylglycylglycylserylalanyla–
rginylisoleucylhistidylisoleucylprolylphenylalanyllysylglycylarginylproly–
lmethionylprolylglutamylisoleucylthreonyltryptophylserylarginylglutamylgl–
utamylglycylglutamylphenylalanylthreonylaspartyllysylvalylglutaminylisole–
ucylglutamyllysylglycylvalylasparaginyltyrosylthreonylglutaminylleucylser–
ylisoleucylaspartylasparaginylcysteinylaspartylarginylasparaginylaspartyl–
alanylglycyllysyltyrosylisoleucylleucyllysylleucylglutamylasparaginylsery–
lserylglycylseryllysylserylalanylphenylalanylvalylthreonylvalyllysylvalyl–
leucylaspartylthreonylprolylglycylprolylprolylglutaminylasparaginylleucyl–
alanylvalyllysylglutamylvalylarginyllysylaspartylserylalanylphenylalanyll–
eucylvalyltryptophylglutamylprolylprolylisoleucylisoleucylaspartylglycylg–
lycylalanyllysylvalyllysylasparaginyltyrosylvalylisoleucylaspartyllysylar–
ginylglutamylserylthreonylarginyllysylalanyltyrosylalanylasparaginylvalyl–
serylseryllysylcysteinylseryllysylthreonylserylphenylalanyllysylvalylglut–
amylasparaginylleucylthreonylglutamylglycylalanylisoleucyltyrosyltyrosylp–
henylalanylarginylvalylmethionylalanylglutamylasparaginylglutamylphenylal–
anylglycylvalylglycylvalylprolylvalylglutamylthreonylvalylaspartylalanylv–
alyllysylalanylalanylglutamylprolylprolylserylprolylprolylglycyllysylvaly–
lthreonylleucylthreonylaspartylvalylserylglutaminylthreonylserylalanylser–
ylleucylmethionyltryptophylglutamyllysylprolylglutamylhistidylaspartylgly–
cylglycylserylarginylvalylleucylglycyltyrosylvalylvalylglutamylmethionylg–
lutaminylprolyllysylglycylthreonylglutamyllysyltryptophylserylisoleucylva–
lylalanylglutamylseryllysylvalylcysteinylasparaginylalanylvalylvalylthreo–
nylglycylleucylserylserylglycylglutaminylglutamyltyrosylglutaminylphenyla–
lanylarginylvalyllysylalanyltyrosylasparaginylglutamyllysylglycyllysylser–
ylaspartylprolylarginylvalylleucylglycylvalylprolylvalylisoleucylalanylly–
sylaspartylleucylthreonylisoleucylglutaminylprolylserylleucyllysylleucylp–
rolylphenylalanylasparaginylthreonyltyrosylserylisoleucylglutaminylalanyl–
glycylglutamylaspartylleucyllysylisoleucylglutamylisoleucylprolylvalyliso–
leucylglycylarginylprolylarginylprolylasparaginylisoleucylseryltryptophyl–
valyllysylaspartylglycylglutamylprolylleucyllysylglutaminylthreonylthreon–
ylarginylvalylasparaginylvalylglutamylglutamylthreonylalanylthreonylseryl–
threonylvalylleucylhistidylisoleucyllysylglutamylglycylasparaginyllysylas–
partylaspartylphenylalanylglycyllysyltyrosylthreonylvalylthreonylalanylth–
reonylasparaginylserylalanylglycylthreonylalanylthreonylglutamylasparagin–
ylleucylserylvalylisoleucylvalylleucylglutamyllysylprolylglycylprolylprol–
ylvalylglycylprolylvalylarginylphenylalanylaspartylglutamylvalylserylalan–
ylaspartylphenylalanylvalylvalylisoleucylseryltryptophylglutamylprolylpro–
lylalanyltyrosylthreonylglycylglycylcysteinylglutaminylisoleucylserylaspa–
raginyltyrosylisoleucylvalylglutamyllysylarginylaspartylthreonylthreonylt–
hreonylthreonylthreonyltryptophylhistidylmethionylvalylserylalanylthreony–
lvalylalanylarginylthreonylthreonylisoleucyllysylisoleucylthreonyllysylle–
ucyllysylthreonylglycylthreonylglutamyltyrosylglutaminylphenylalanylargin–
ylisoleucylphenylalanylalanylglutamylasparaginylarginyltyrosylglycyllysyl–
serylalanylprolylleucylaspartylseryllysylalanylvalylisoleucylvalylglutami–
nyltyrosylprolylphenylalanyllysylglutamylprolylglycylprolylprolylglycylth–
reonylprolylphenylalanylvalylthreonylserylisoleucylseryllysylaspartylglut–
aminylmethionylleucylvalylglutaminyltryptophylhistidylglutamylprolylvalyl–
asparaginylaspartylglycylglycylthreonyllysylisoleucylisoleucylglycyltyros–
ylhistidylleucylglutamylglutaminyllysylglutamyllysylasparaginylserylisole–
ucylleucyltryptophylvalyllysylleucylasparaginyllysylthreonylprolylisoleuc–
ylglutaminylaspartylthreonyllysylphenylalanyllysylthreonylthreonylglycyll–
eucylaspartylglutamylglycylleucylglutamyltyrosylglutamylphenylalanyllysyl–
valylserylalanylglutamylasparaginylisoleucylvalylglycylisoleucylglycyllys–
ylprolylseryllysylvalylserylglutamylcysteinylphenylalanylvalylalanylargin–
ylaspartylprolylcysteinylaspartylprolylprolylglycylarginylprolylglutamyla–
lanylisoleucylvalylisoleucylthreonylarginylasparaginylasparaginylvalylthr–
eonylleucyllysyltryptophyllysyllysylprolylalanyltyrosylaspartylglycylglyc–
ylseryllysylisoleucylthreonylglycyltyrosylisoleucylvalylglutamyllysyllysy–
laspartylleucylprolylaspartylglycylarginyltryptophylmethionyllysylalanyls–
erylphenylalanylthreonylasparaginylvalylleucylglutamylthreonylglutamylphe–
nylalanylthreonylvalylserylglycylleucylvalylglutamylaspartylglutaminylarg–
inyltyrosylglutamylphenylalanylarginylvalylisoleucylalanylarginylasparagi–
nylalanylalanylglycylasparaginylphenylalanylserylglutamylprolylserylaspar–
tylserylserylglycylalanylisoleucylthreonylalanylarginylaspartylglutamylis–
oleucylaspartylalanylprolylasparaginylalanylserylleucylaspartylprolyllysy–
ltyrosyllysylaspartylvalylisoleucylvalylvalylhistidylalanylglycylglutamyl–
threonylphenylalanylvalylleucylglutamylalanylaspartylisoleucylarginylglyc–
yllysylprolylisoleucylprolylaspartylvalylvalyltryptophylseryllysylasparty–
lglycyllysylglutamylleucylglutamylglutamylthreonylalanylalanylarginylmeth–
ionylglutamylisoleucyllysylserylthreonylisoleucylglutaminyllysylthreonylt–
hreonylleucylvalylvalyllysylaspartylcysteinylisoleucylarginylthreonylaspa–
rtylglycylglycylglutaminyltyrosylisoleucylleucyllysylleucylserylasparagin–
ylvalylglycylglycylthreonyllysylserylisoleucylprolylisoleucylthreonylvaly–
llysylvalylleucylaspartylarginylprolylglycylserylprolylglutamylglycylprol–
ylleucyllysylvalylthreonylglycylvalylthreonylalanylglutamyllysylcysteinyl–
tyrosylleucylalanyltryptophylasparaginylprolylprolylleucylglutaminylaspar–
tylglycylglycylalanylasparaginylisoleucylserylhistidyltyrosylisoleucyliso–
leucylglutamyllysylarginylglutamylthreonylserylarginylleucylseryltryptoph–
ylthreonylglutaminylvalylserylthreonylglutamylvalylglutaminylalanylleucyl–
asparaginyltyrosyllysylvalylthreonyllysylleucylleucylprolylglycylasparagi–
nylglutamyltyrosylisoleucylphenylalanylarginylvalylmethionylalanylvalylas–
paraginyllysyltyrosylglycylisoleucylglycylglutamylprolylleucylglutamylser–
ylglycylprolylvalylthreonylalanylcysteinylasparaginylprolyltyrosyllysylpr–
olylprolylglycylprolylprolylserylthreonylprolylglutamylvalylserylalanylis–
oleucylthreonyllysylaspartylserylmethionylvalylvalylthreonyltryptophylala–
nylarginylprolylvalylaspartylaspartylglycylglycylthreonylglutamylisoleucy–
lglutamylglycyltyrosylisoleucylleucylglutamyllysylarginylaspartyllysylglu–
tamylglycylvalylarginyltryptophylthreonyllysylcysteinylasparaginyllysylly–
sylthreonylleucylthreonylaspartylleucylarginylleucylarginylvalylthreonylg–
lycylleucylthreonylglutamylglycylhistidylseryltyrosylglutamylphenylalanyl–
arginylvalylalanylalanylglutamylasparaginylalanylalanylglycylvalylglycylg–
lutamylprolylserylglutamylprolylserylvalylphenylalanyltyrosylarginylalany–
lcysteinylaspartylalanylleucyltyrosylprolylprolylglycylprolylprolylseryla–
sparaginylprolyllysylvalylthreonylaspartylthreonylserylarginylserylserylv–
alylserylleucylalanyltryptophylseryllysylprolylisoleucyltyrosylaspartylgl–
ycylglycylalanylprolylvalyllysylglycyltyrosylvalylvalylglutamylvalyllysyl–
glutamylalanylalanylalanylaspartylglutamyltryptophylthreonylthreonylcyste–
inylthreonylprolylprolylthreonylglycylleucylglutaminylglycyllysylglutamin–
ylphenylalanylthreonylvalylthreonyllysylleucyllysylglutamylasparaginylthr–
eonylglutamyltyrosylasparaginylphenylalanylarginylisoleucylcysteinylalany–
lisoleucylasparaginylserylglutamylglycylvalylglycylglutamylprolylalanylth–
reonylleucylprolylglycylserylvalylvalylalanylglutaminylglutamylarginyliso–
leucylglutamylprolylprolylglutamylisoleucylglutamylleucylaspartylalanylas–
partylleucylarginyllysylvalylvalylvalylleucylarginylalanylserylalanylthre–
onylleucylarginylleucylphenylalanylvalylthreonylisoleucyllysylglycylargin–
ylprolylglutamylprolylglutamylvalyllysyltryptophylglutamyllysylalanylglut–
amylglycylisoleucylleucylthreonylaspartylarginylalanylglutaminylisoleucyl–
glutamylvalylthreonylserylserylphenylalanylthreonylmethionylleucylvalylis–
oleucylaspartylasparaginylvalylthreonylarginylphenylalanylaspartylserylgl–
ycylarginyltyrosylasparaginylleucylthreonylleucylglutamylasparaginylaspar–
aginylserylglycylseryllysylthreonylalanylphenylalanylvalylasparaginylvaly–
larginylvalylleucylaspartylserylprolylserylalanylprolylvalylasparaginylle–
ucylthreonylisoleucylarginylglutamylvalyllysyllysylaspartylserylvalylthre–
onylleucylseryltryptophylglutamylprolylprolylleucylisoleucylaspartylglycy–
lglycylalanyllysylisoleucylthreonylasparaginyltyrosylisoleucylvalylglutam–
yllysylarginylglutamylthreonylthreonylarginyllysylalanyltyrosylalanylthre–
onylisoleucylthreonylasparaginylasparaginylcysteinylthreonyllysylthreonyl–
threonylphenylalanylarginylisoleucylglutamylasparaginylleucylglutaminylgl–
utamylglycylcysteinylseryltyrosyltyrosylphenylalanylarginylvalylleucylala–
nylserylasparaginylglutamyltyrosylglycylisoleucylglycylleucylprolylalanyl–
glutamylthreonylthreonylglutamylprolylvalyllysylvalylserylglutamylprolylp–
rolylleucylprolylprolylglycylarginylvalylthreonylleucylvalylaspartylvalyl–
threonylarginylasparaginylthreonylalanylthreonylisoleucyllysyltryptophylg–
lutamyllysylprolylglutamylserylaspartylglycylglycylseryllysylisoleucylthr–
eonylglycyltyrosylvalylvalylglutamylmethionylglutaminylthreonyllysylglycy–
lserylglutamyllysyltryptophylserylthreonylcysteinylthreonylglutaminylvaly–
llysylthreonylleucylglutamylalanylthreonylisoleucylserylglycylleucylthreo–
nylalanylglycylglutamylglutamyltyrosylvalylphenylalanylarginylvalylalanyl–
alanylvalylasparaginylglutamyllysylglycylarginylserylaspartylprolylarginy–
lglutaminylleucylglycylvalylprolylvalylisoleucylalanylarginylaspartylisol–
eucylglutamylisoleucyllysylprolylserylvalylglutamylleucylprolylphenylalan–
ylhistidylthreonylphenylalanylasparaginylvalyllysylalanylarginylglutamylg–
lutaminylleucyllysylisoleucylaspartylvalylprolylphenylalanyllysylglycylar–
ginylprolylglutaminylalanylthreonylvalylasparaginyltryptophylarginyllysyl–
aspartylglycylglutaminylthreonylleucyllysylglutamylthreonylthreonylarginy–
lvalylasparaginylvalylserylserylseryllysylthreonylvalylthreonylserylleucy–
lserylisoleucyllysylglutamylalanylseryllysylglutamylaspartylvalylglycylth–
reonyltyrosylglutamylleucylcysteinylvalylserylasparaginylserylalanylglycy–
lserylisoleucylthreonylvalylprolylisoleucylthreonylisoleucylisoleucylvaly–
lleucylaspartylarginylprolylglycylprolylprolylglycylprolylisoleucylarginy–
lisoleucylaspartylglutamylvalylserylcysteinylaspartylserylisoleucylthreon–
ylisoleucylseryltryptophylasparaginylprolylprolylglutamyltyrosylaspartylg–
lycylglycylcysteinylglutaminylisoleucylserylasparaginyltyrosylisoleucylva–
lylglutamyllysyllysylglutamylthreonylthreonylserylthreonylthreonyltryptop–
hylhistidylisoleucylvalylserylglutaminylalanylvalylalanylarginylthreonyls–
erylisoleucyllysylisoleucylvalylarginylleucylthreonylthreonylglycylserylg–
lutamyltyrosylglutaminylphenylalanylarginylvalylcysteinylalanylglutamylas–
paraginylarginyltyrosylglycyllysylserylseryltyrosylserylglutamylserylsery–
lalanylvalylvalylalanylglutamyltyrosylprolylphenylalanylserylprolylprolyl–
glycylprolylprolylglycylthreonylprolyllysylvalylvalylhistidylalanylthreon–
yllysylserylthreonylmethionylleucylvalylthreonyltryptophylglutaminylvalyl–
prolylvalylasparaginylaspartylglycylglycylserylarginylvalylisoleucylglycy–
ltyrosylhistidylleucylglutamyltyrosyllysylglutamylarginylserylserylisoleu–
cylleucyltryptophylseryllysylalanylasparaginyllysylisoleucylleucylisoleuc–
ylalanylaspartylthreonylglutaminylvalyllysylvalylserylglycylleucylasparty–
lglutamylglycylleucylmethionyltyrosylglutamyltyrosylarginylvalyltyrosylal–
anylglutamylasparaginylisoleucylalanylglycylisoleucylglycyllysylcysteinyl–
seryllysylserylcysteinylglutamylprolylvalylprolylalanylarginylaspartylpro–
lylcysteinylaspartylprolylprolylglycylglutaminylprolylglutamylvalylthreon–
ylasparaginylisoleucylthreonylarginyllysylserylvalylserylleucyllysyltrypt–
ophylseryllysylprolylhistidyltyrosylaspartylglycylglycylalanyllysylisoleu–
cylthreonylglycyltyrosylisoleucylvalylglutamylarginylarginylglutamylleucy–
lprolylaspartylglycylarginyltryptophylleucyllysylcysteinylasparaginyltyro–
sylthreonylasparaginylisoleucylglutaminylglutamylthreonyltyrosylphenylala–
nylglutamylvalylthreonylglutamylleucylthreonylglutamylaspartylglutaminyla–
rginyltyrosylglutamylphenylalanylarginylvalylphenylalanylalanylarginylasp–
araginylalanylalanylaspartylserylvalylserylglutamylprolylserylglutamylser–
ylthreonylglycylprolylisoleucylisoleucylvalyllysylaspartylaspartylvalylgl–
utamylprolylprolylarginylvalylmethionylmethionylaspartylvalyllysylphenyla–
lanylarginylaspartylvalylisoleucylvalylvalyllysylalanylglycylglutamylvaly–
lleucyllysylisoleucylasparaginylalanylaspartylisoleucylalanylglycylarginy–
lprolylleucylprolylvalylisoleucylseryltryptophylalanyllysylaspartylglycyl–
isoleucylglutamylisoleucylglutamylglutamylarginylalanylarginylthreonylglu–
tamylisoleucylisoleucylserylthreonylaspartylasparaginylhistidylthreonylle–
ucylleucylthreonylvalyllysylaspartylcysteinylisoleucylarginylarginylaspar–
tylthreonylglycylglutaminyltyrosylvalylleucylthreonylleucyllysylasparagin–
ylvalylalanylglycylthreonylarginylserylvalylalanylvalylasparaginylcystein–
yllysylvalylleucylaspartyllysylprolylglycylprolylprolylalanylglycylprolyl–
leucylglutamylisoleucylasparaginylglycylleucylthreonylalanylglutamyllysyl–
cysteinylserylleucylseryltryptophylglycylarginylprolylglutaminylglutamyla–
spartylglycylglycylalanylaspartylisoleucylaspartyltyrosyltyrosylhistidyla–
rginyllysyllysylarginylglutamylthreonylserylhistidylleucylalanyltryptophy–
lthreonylisoleucylcysteinylglutamylglycylglutamylleucylglutaminylmethiony–
lthreonylserylcysteinyllysylvalylthreonyllysylleucylleucyllysylglycylaspa–
raginylglutamyltyrosylisoleucylphenylalanylarginylvalylthreonylglycylvaly–
lasparaginyllysyltyrosylglycylvalylglycylglutamylprolylleucylglutamylsery–
lvalylalanylisoleucyllysylalanylleucylaspartylprolylphenylalanylthreonylv–
alylprolylserylprolylprolylthreonylserylleucylglutamylisoleucylthreonylse–
rylvalylthreonyllysylglutamylserylmethionylthreonylleucylcysteinyltryptop–
hylserylarginylprolylglutamylserylaspartylglycylglycylserylglutamylisoleu–
cylserylglycyltyrosylisoleucylisoleucylglutamylarginylarginylglutamyllysy–
lasparaginylserylleucylarginyltryptophylvalylarginylvalylasparaginyllysyl–
lysylprolylvalyltyrosylaspartylleucylarginylvalyllysylserylthreonylglycyl–
leucylarginylglutamylglycylcysteinylglutamyltyrosylglutamyltyrosylarginyl–
valyltyrosylalanylglutamylasparaginylalanylalanylglycylleucylserylleucylp–
rolylserylglutamylthreonylserylprolylleucylisoleucylarginylalanylglutamyl–
aspartylprolylvalylphenylalanylleucylprolylserylprolylprolylseryllysylpro–
lyllysylisoleucylvalylaspartylserylglycyllysylthreonylthreonylisoleucylth–
reonylisoleucylalanyltryptophylvalyllysylprolylleucylphenylalanylaspartyl–
glycylglycylalanylprolylisoleucylthreonylglycyltyrosylthreonylvalylglutam–
yltyrosyllysyllysylserylaspartylaspartylthreonylaspartyltryptophyllysylth–
reonylserylisoleucylglutaminylserylleucylarginylglycylthreonylglutamyltyr–
osylthreonylisoleucylserylglycylleucylthreonylthreonylglycylalanylglutamy–
ltyrosylvalylphenylalanylarginylvalyllysylserylvalylasparaginyllysylvalyl–
glycylalanylserylaspartylprolylserylaspartylserylserylaspartylprolylgluta–
minylisoleucylalanyllysylglutamylarginylglutamylglutamylglutamylprolylleu–
cylphenylalanylaspartylisoleucylaspartylserylglutamylmethionylarginyllysy–
lthreonylleucylisoleucylvalyllysylalanylglycylalanylserylphenylalanylthre–
onylmethionylthreonylvalylprolylphenylalanylarginylglycylarginylprolylval–
ylprolylasparaginylvalylleucyltryptophylseryllysylprolylaspartylthreonyla–
spartylleucylarginylthreonylarginylalanyltyrosylvalylaspartylthreonylthre–
onylaspartylserylarginylthreonylserylleucylthreonylisoleucylglutamylaspar–
aginylalanylasparaginylarginylasparaginylaspartylserylglycyllysyltyrosylt–
hreonylleucylthreonylisoleucylglutaminylasparaginylvalylleucylserylalanyl–
alanylserylleucylthreonylleucylvalylvalyllysylvalylleucylaspartylthreonyl–
prolylglycylprolylprolylthreonylasparaginylisoleucylthreonylvalylglutamin–
ylaspartylvalylthreonyllysylglutamylserylalanylvalylleucylseryltryptophyl–
aspartylvalylprolylglutamylasparaginylaspartylglycylglycylalanylprolylval–
yllysylasparaginyltyrosylhistidylisoleucylglutamyllysylarginylglutamylala–
nylseryllysyllysylalanyltryptophylvalylserylvalylthreonylasparaginylaspar–
aginylcysteinylasparaginylarginylleucylseryltyrosyllysylvalylthreonylaspa–
raginylleucylglutaminylglutamylglycylalanylisoleucyltyrosyltyrosylphenyla–
lanylarginylvalylserylglycylglutamylasparaginylglutamylphenylalanylglycyl–
valylglycylisoleucylprolylalanylglutamylthreonyllysylglutamylglycylvalyll–
ysylisoleucylthreonylglutamyllysylprolylserylprolylprolylglutamyllysylleu–
cylglycylvalylthreonylserylisoleucylseryllysylaspartylserylvalylserylleuc–
ylthreonyltryptophylleucyllysylprolylglutamylhistidylaspartylglycylglycyl–
serylarginylisoleucylvalylhistidyltyrosylvalylvalylglutamylalanylleucylgl–
utamyllysylglycylglutaminyllysylasparaginyltryptophylvalyllysylcysteinyla–
lanylvalylalanyllysylserylthreonylhistidylhistidylvalylvalylserylglycylle–
ucylarginylglutamylasparaginylserylglutamyltyrosylphenylalanylphenylalany–
larginylvalylphenylalanylalanylglutamylasparaginylglutaminylalanylglycyll–
eucylserylaspartylprolylarginylglutamylleucylleucylleucylprolylvalylleucy–
lisoleucyllysylglutamylglutaminylleucylglutamylprolylprolylglutamylisoleu–
cylaspartylmethionyllysylasparaginylphenylalanylprolylserylhistidylthreon–
ylvalyltyrosylvalylarginylalanylglycylserylasparaginylleucyllysylvalylasp–
artylisoleucylprolylisoleucylserylglycyllysylprolylleucylprolyllysylvalyl–
threonylleucylserylarginylaspartylglycylvalylprolylleucyllysylalanylthreo–
nylmethionylarginylphenylalanylasparaginylthreonylglutamylisoleucylthreon–
ylalanylglutamylasparaginylleucylthreonylisoleucylasparaginylleucyllysylg–
lutamylserylvalylthreonylalanylaspartylalanylglycylarginyltyrosylglutamyl–
isoleucylthreonylalanylalanylasparaginylserylserylglycylthreonylthreonyll–
ysylalanylphenylalanylisoleucylasparaginylisoleucylvalylvalylleucylaspart–
ylarginylprolylglycylprolylprolylthreonylglycylprolylvalylvalylisoleucyls–
erylaspartylisoleucylthreonylglutamylglutamylserylvalylthreonylleucyllysy–
ltryptophylglutamylprolylprolyllysyltyrosylaspartylglycylglycylserylgluta–
minylvalylthreonylasparaginyltyrosylisoleucylleucylleucyllysylarginylglut–
amylthreonylserylthreonylalanylvalyltryptophylthreonylglutamylvalylseryla–
lanylthreonylvalylalanylarginylthreonylmethionylmethionyllysylvalylmethio–
nyllysylleucylthreonylthreonylglycylglutamylglutamyltyrosylglutaminylphen–
ylalanylarginylisoleucyllysylalanylglutamylasparaginylarginylphenylalanyl–
glycylisoleucylserylaspartylhistidylisoleucylaspartylserylalanylcysteinyl–
valylthreonylvalyllysylleucylprolyltyrosylthreonylthreonylprolylglycylpro–
lylprolylserylthreonylprolyltryptophylvalylthreonylasparaginylvalylthreon–
ylarginylglutamylserylisoleucylthreonylvalylglycyltryptophylhistidylgluta–
mylprolylvalylserylasparaginylglycylglycylserylalanylvalylvalylglycyltyro–
sylhistidylleucylglutamylmethionyllysylaspartylarginylasparaginylseryliso–
leucylleucyltryptophylglutaminyllysylalanylasparaginyllysylleucylvalyliso–
leucylarginylthreonylthreonylhistidylphenylalanyllysylvalylthreonylthreon–
ylisoleucylserylalanylglycylleucylisoleucyltyrosylglutamylphenylalanylarg–
inylvalyltyrosylalanylglutamylasparaginylalanylalanylglycylvalylglycyllys–
ylprolylserylhistidylprolylserylglutamylprolylvalylleucylalanylisoleucyla–
spartylalanylcysteinylglutamylprolylprolylarginylasparaginylvalylarginyli–
soleucylthreonylaspartylisoleucylseryllysylasparaginylserylvalylserylleuc–
ylseryltryptophylglutaminylglutaminylprolylalanylphenylalanylaspartylglyc–
ylglycylseryllysylisoleucylthreonylglycyltyrosylisoleucylvalylglutamylarg–
inylarginylaspartylleucylprolylaspartylglycylarginyltryptophylthreonyllys–
ylalanylserylphenylalanylthreonylasparaginylvalylthreonylglutamylthreonyl–
glutaminylphenylalanylthreonylisoleucylserylglycylleucylthreonylglutaminy–
lasparaginylserylglutaminyltyrosylglutamylphenylalanylarginylvalylphenyla–
lanylalanylarginylasparaginylalanylvalylglycylserylisoleucylserylasparagi–
nylprolylserylglutamylvalylvalylglycylprolylisoleucylthreonylcysteinyliso–
leucylaspartylseryltyrosylglycylglycylprolylvalylisoleucylaspartylleucylp–
rolylleucylglutamyltyrosylthreonylglutamylvalylvalyllysyltyrosylarginylal–
anylglycylthreonylserylvalyllysylleucylarginylalanylglycylisoleucylserylg–
lycyllysylprolylalanylprolylthreonylisoleucylglutamyltryptophyltyrosyllys–
ylaspartylaspartyllysylglutamylleucylglutaminylthreonylasparaginylalanyll–
eucylvalylcysteinylvalylglutamylasparaginylthreonylthreonylaspartylleucyl–
alanylserylisoleucylleucylisoleucyllysylaspartylalanylaspartylarginylleuc–
ylasparaginylserylglycylcysteinyltyrosylglutamylleucyllysylleucylarginyla–
sparaginylalanylmethionylalanylserylalanylserylalanylthreonylisoleucylarg–
inylvalylglutaminylisoleucylleucylaspartyllysylprolylglycylprolylprolylgl–
ycylglycylprolylisoleucylglutamylphenylalanyllysylthreonylvalylthreonylal–
anylglutamyllysylisoleucylthreonylleucylleucyltryptophylarginylprolylprol–
ylalanylaspartylaspartylglycylglycylalanyllysylisoleucylthreonylhistidylt–
yrosylisoleucylvalylglutamyllysylarginylglutamylthreonylserylarginylvalyl–
valyltryptophylserylmethionylvalylserylglutamylhistidylleucylglutamylglut–
amylcysteinylisoleucylisoleucylthreonylthreonylthreonyllysylisoleucylisol–
eucyllysylglycylasparaginylglutamyltyrosylisoleucylphenylalanylarginylval–
ylarginylalanylvalylasparaginyllysyltyrosylglycylisoleucylglycylglutamylp–
rolylleucylglutamylserylaspartylserylvalylvalylalanyllysylasparaginylalan–
ylphenylalanylvalylthreonylprolylglycylprolylprolylglycylisoleucylprolylg–
lutamylvalylthreonyllysylisoleucylthreonyllysylasparaginylserylmethionylt–
hreonylvalylvalyltryptophylserylarginylprolylisoleucylalanylaspartylglycy–
lglycylserylaspartylisoleucylserylglycyltyrosylphenylalanylleucylglutamyl–
lysylarginylaspartyllysyllysylserylleucylglycyltryptophylphenylalanyllysy–
lvalylleucyllysylglutamylthreonylisoleucylarginylaspartylthreonylarginylg–
lutaminyllysylvalylthreonylglycylleucylthreonylglutamylasparaginylserylas–
partyltyrosylglutaminyltyrosylarginylvalylcysteinylalanylvalylasparaginyl–
alanylalanylglycylglutaminylglycylprolylphenylalanylserylglutamylprolylse–
rylglutamylphenylalanyltyrosyllysylalanylalanylaspartylprolylisoleucylasp–
artylprolylprolylglycylprolylprolylalanyllysylisoleucylarginylisoleucylal–
anylaspartylserylthreonyllysylserylserylisoleucylthreonylleucylglycyltryp–
tophylseryllysylprolylvalyltyrosylaspartylglycylglycylserylalanylvalylthr–
eonylglycyltyrosylvalylvalylglutamylisoleucylarginylglutaminylglycylgluta–
mylglutamylglutamylglutamyltryptophylthreonylthreonylvalylserylthreonylly–
sylglycylglutamylvalylarginylthreonylthreonylglutamyltyrosylvalylvalylser–
ylasparaginylleucyllysylprolylglycylvalylasparaginyltyrosyltyrosylphenyla–
lanylarginylvalylserylalanylvalylasparaginylcysteinylalanylglycylglutamin–
ylglycylglutamylprolylisoleucylglutamylmethionylasparaginylglutamylprolyl–
valylglutaminylalanyllysylaspartylisoleucylleucylglutamylalanylprolylglut–
amylisoleucylaspartylleucylaspartylvalylalanylleucylarginylthreonylserylv–
alylisoleucylalanyllysylalanylglycylglutamylaspartylvalylglutaminylvalyll–
eucylisoleucylprolylphenylalanyllysylglycylarginylprolylprolylprolylthreo–
nylvalylthreonyltryptophylarginyllysylaspartylglutamyllysylasparaginylleu–
cylglycylserylaspartylalanylarginyltyrosylserylisoleucylglutamylasparagin–
ylthreonylaspartylserylserylserylleucylleucylthreonylisoleucylprolylgluta–
minylvalylthreonylarginylasparaginylaspartylthreonylglycyllysyltyrosyliso–
leucylleucylthreonylisoleucylglutamylasparaginylglycylvalylglycylglutamyl–
prolyllysylserylserylthreonylvalylserylvalyllysylvalylleucylaspartylthreo–
nylprolylalanylalanylcysteinylglutaminyllysylleucylglutaminylvalyllysylhi–
stidylvalylserylarginylglycylthreonylvalylthreonylleucylleucyltryptophyla–
spartylprolylprolylleucylisoleucylaspartylglycylglycylserylprolylisoleucy–
lisoleucylasparaginyltyrosylvalylisoleucylglutamyllysylarginylaspartylala–
nylthreonyllysylarginylthreonyltryptophylserylvalylvalylserylhistidyllysy–
lcysteinylserylserylthreonylserylphenylalanyllysylleucylisoleucylaspartyl–
leucylserylglutamyllysylthreonylprolylphenylalanylphenylalanylphenylalany–
larginylvalylleucylalanylglutamylasparaginylglutamylisoleucylglycylisoleu–
cylglycylglutamylprolylcysteinylglutamylthreonylthreonylglutamylprolylval–
yllysylalanylalanylglutamylvalylprolylalanylprolylisoleucylarginylasparty–
lleucylserylmethionyllysylaspartylserylthreonyllysylthreonylserylvalyliso–
leucylleucylseryltryptophylthreonyllysylprolylaspartylphenylalanylasparty–
lglycylglycylserylvalylisoleucylthreonylglutamyltyrosylvalylvalylglutamyl–
arginyllysylglycyllysylglycylglutamylglutaminylthreonyltryptophylserylhis–
tidylalanylglycylisoleucylseryllysylthreonylcysteinylglutamylisoleucylglu–
tamylvalylserylglutaminylleucyllysylglutamylglutaminylserylvalylleucylglu–
tamylphenylalanylarginylvalylphenylalanylalanyllysylasparaginylglutamylly–
sylglycylleucylserylaspartylprolylvalylthreonylisoleucylglycylprolylisole–
ucylthreonylvalyllysylglutamylleucylisoleucylisoleucylthreonylprolylgluta–
mylvalylaspartylleucylserylaspartylisoleucylprolylglycylalanylglutaminylv–
alylthreonylvalylarginylisoleucylglycylhistidylasparaginylvalylhistidylle–
ucylglutamylleucylprolyltyrosyllysylglycyllysylprolyllysylprolylserylisol–
eucylseryltryptophylleucyllysylaspartylglycylleucylprolylleucyllysylgluta–
mylserylglutamylphenylalanylvalylarginylphenylalanylseryllysylthreonylglu–
tamylasparaginyllysylisoleucylthreonylleucylserylisoleucyllysylasparaginy–
lalanyllysyllysylglutamylhistidylglycylglycyllysyltyrosylthreonylvalyliso–
leucylleucylaspartylasparaginylalanylvalylcysteinylarginylisoleucylalanyl–
valylprolylisoleucylthreonylvalylisoleucylthreonylleucylglycylprolylproly–
lseryllysylprolyllysylglycylprolylisoleucylarginylphenylalanylaspartylglu–
tamylisoleucyllysylalanylaspartylserylvalylisoleucylleucylseryltryptophyl–
aspartylvalylprolylglutamylaspartylasparaginylglycylglycylglycylglutamyli–
soleucylthreonylcysteinyltyrosylserylisoleucylglutamyllysylarginylglutamy–
lthreonylserylglutaminylthreonylasparaginyltryptophyllysylmethionylvalylc–
ysteinylserylserylvalylalanylarginylthreonylthreonylphenylalanyllysylvaly–
lprolylasparaginylleucylvalyllysylaspartylalanylglutamyltyrosylglutaminyl–
phenylalanylarginylvalylarginylalanylglutamylasparaginylarginyltyrosylgly–
cylvalylserylglutaminylprolylleucylvalylserylserylisoleucylisoleucylvalyl–
alanyllysylhistidylglutaminylphenylalanylarginylisoleucylprolylglycylprol–
ylprolylglycyllysylprolylvalylisoleucyltyrosylasparaginylvalylthreonylser–
ylaspartylglycylmethionylserylleucylthreonyltryptophylaspartylalanylproly–
lvalyltyrosylaspartylglycylglycylserylglutamylvalylthreonylglycylphenylal–
anylhistidylvalylglutamyllysyllysylglutamylarginylasparaginylserylisoleuc–
ylleucyltryptophylglutaminyllysylvalylasparaginylthreonylserylprolylisole–
ucylserylglycylarginylglutamyltyrosylarginylalanylthreonylglycylleucylval–
ylglutamylglycylleucylaspartyltyrosylglutaminylphenylalanylarginylvalylty–
rosylalanylglutamylasparaginylserylalanylglycylleucylserylserylprolylsery–
laspartylprolylseryllysylphenylalanylthreonylleucylalanylvalylserylprolyl–
valylaspartylprolylprolylglycylthreonylprolylaspartyltyrosylisoleucylaspa–
rtylvalylthreonylarginylglutamylthreonylisoleucylthreonylleucyllysyltrypt–
ophylasparaginylprolylprolylleucylarginylaspartylglycylglycylseryllysylis–
oleucylvalylglycyltyrosylserylisoleucylglutamyllysylarginylglutaminylglyc–
ylasparaginylglutamylarginyltryptophylvalylarginylcysteinylasparaginylphe–
nylalanylthreonylaspartylvalylserylglutamylcysteinylglutaminyltyrosylthre–
onylvalylthreonylglycylleucylserylprolylglycylaspartylarginyltyrosylgluta–
mylphenylalanylarginylisoleucylisoleucylalanylarginylasparaginylalanylval–
ylglycylthreonylisoleucylserylprolylprolylserylglutaminylserylserylglycyl–
isoleucylisoleucylmethionylthreonylarginylaspartylglutamylasparaginylvaly–
lprolylprolylisoleucylvalylglutamylphenylalanylglycylprolylglutamyltyrosy–
lphenylalanylaspartylglycylleucylisoleucylisoleucyllysylserylglycylglutam–
ylserylleucylarginylisoleucyllysylalanylleucylvalylglutaminylglycylarginy–
lprolylvalylprolylarginylvalylthreonyltryptophylphenylalanyllysylaspartyl–
glycylvalylglutamylisoleucylglutamyllysylarginylmethionylasparaginylmethi–
onylglutamylisoleucylthreonylasparaginylvalylleucylglycylserylthreonylser–
ylleucylphenylalanylvalylarginylaspartylalanylthreonylarginylaspartylhist–
idylarginylglycylvalyltyrosylthreonylvalylglutamylalanyllysylasparaginyla–
lanylserylglycylserylalanyllysylalanylglutamylisoleucyllysylvalyllysylval–
ylglutaminylaspartylthreonylprolylglycyllysylvalylvalylglycylprolylisoleu–
cylarginylphenylalanylthreonylasparaginylisoleucylthreonylglycylglutamyll–
ysylmethionylthreonylleucyltryptophyltryptophylaspartylalanylprolylleucyl–
asparaginylaspartylglycylcysteinylalanylprolylisoleucylthreonylhistidylty–
rosylisoleucylisoleucylglutamyllysylarginylglutamylthreonylserylarginylle–
ucylalanyltryptophylalanylleucylisoleucylglutamylaspartyllysylcysteinylgl–
utamylalanylglutaminylseryltyrosylthreonylalanylisoleucyllysylleucylisole–
ucylasparaginylglycylasparaginylglutamyltyrosylglutaminylphenylalanylargi–
nylvalylserylalanylvalylasparaginyllysylphenylalanylglycylvalylglycylargi–
nylprolylleucylaspartylserylaspartylprolylvalylvalylalanylglutaminylisole–
ucylglutaminyltyrosylthreonylvalylprolylaspartylalanylprolylglycylisoleuc–
ylprolylglutamylprolylserylasparaginylisoleucylthreonylglycylasparaginyls–
erylisoleucylthreonylleucylthreonyltryptophylalanylarginylprolylglutamyls–
erylaspartylglycylglycylserylglutamylisoleucylglutaminylglutaminyltyrosyl–
isoleucylleucylglutamylarginylarginylglutamyllysyllysylserylthreonylargin–
yltryptophylvalyllysylvalylisoleucylseryllysylarginylprolylisoleucylseryl–
glutamylthreonylarginylphenylalanyllysylvalylthreonylglycylleucylthreonyl–
glutamylglycylasparaginylglutamyltyrosylglutamylphenylalanylhistidylvalyl–
methionylalanylglutamylasparaginylalanylalanylglycylvalylglycylprolylalan–
ylserylglycylisoleucylserylarginylleucylisoleucyllysylcysteinylarginylglu–
tamylprolylvalylasparaginylprolylprolylglycylprolylprolylthreonylvalylval–
yllysylvalylthreonylaspartylthreonylseryllysylthreonylthreonylvalylseryll–
eucylglutamyltryptophylseryllysylprolylvalylphenylalanylaspartylglycylgly–
cylmethionylglutamylisoleucylisoleucylglycyltyrosylisoleucylisoleucylglut–
amylmethionylcysteinyllysylthreonylaspartylleucylglycylaspartyltryptophyl–
histidyllysylvalylasparaginylalanylglutamylalanylcysteinylvalyllysylthreo–
nylarginyltyrosylthreonylvalylthreonylaspartylleucylglutaminylalanylglycy–
lglutamylglutamyltyrosyllysylphenylalanylarginylvalylserylalanylisoleucyl–
asparaginylglycylalanylglycyllysylglycylaspartylserylcysteinylglutamylval–
ylthreonylglycylthreonylisoleucyllysylalanylvalylaspartylarginylleucylthr–
eonylalanylprolylglutamylleucylaspartylisoleucylaspartylalanylasparaginyl–
phenylalanyllysylglutaminylthreonylhistidylvalylvalylarginylalanylglycyla–
lanylserylisoleucylarginylleucylphenylalanylisoleucylalanyltyrosylglutami–
nylglycylarginylprolylthreonylprolylthreonylalanylvalyltryptophylseryllys–
ylprolylaspartylserylasparaginylleucylserylleucylarginylalanylaspartyliso–
leucylhistidylthreonylthreonylaspartylserylphenylalanylserylthreonylleucy–
lthreonylvalylglutamylasparaginylcysteinylasparaginylarginylasparaginylas–
partylalanylglycyllysyltyrosylthreonylleucylthreonylvalylglutamylasparagi–
nylasparaginylserylglycylseryllysylserylisoleucylthreonylphenylalanylthre–
onylvalyllysylvalylleucylaspartylthreonylprolylglycylprolylprolylglycylpr–
olylisoleucylthreonylphenylalanyllysylaspartylvalylthreonylarginylglycyls–
erylalanylthreonylleucylmethionyltryptophylaspartylalanylprolylleucylleuc–
ylaspartylglycylglycylalanylarginylisoleucylhistidylhistidyltyrosylvalylv–
alylglutamyllysylarginylglutamylalanylserylarginylarginylseryltryptophylg–
lutaminylvalylisoleucylserylglutamyllysylcysteinylthreonylarginylglutamin–
ylisoleucylphenylalanyllysylvalylasparaginylaspartylleucylalanylglutamylg–
lycylvalylprolyltyrosyltyrosylphenylalanylarginylvalylserylalanylvalylasp–
araginylglutamyltyrosylglycylvalylglycylglutamylprolyltyrosylglutamylmeth–
ionylprolylglutamylprolylisoleucylvalylalanylthreonylglutamylglutaminylpr–
olylalanylprolylprolylarginylarginylleucylaspartylvalylvalylaspartylthreo–
nylseryllysylserylserylalanylvalylleucylalanyltryptophylleucyllysylprolyl–
aspartylhistidylaspartylglycylglycylserylarginylisoleucylthreonylglycylty–
rosylleucylleucylglutamylmethionylarginylglutaminyllysylglycylserylaspart–
ylleucyltryptophylvalylglutamylalanylglycylhistidylthreonyllysylglutaminy–
lleucylthreonylphenylalanylthreonylvalylglutamylarginylleucylvalylglutamy–
llysylthreonylglutamyltyrosylglutamylphenylalanylarginylvalyllysylalanyll–
ysylasparaginylaspartylalanylglycyltyrosylserylglutamylprolylarginylgluta–
mylalanylphenylalanylserylserylvalylisoleucylisoleucyllysylglutamylprolyl–
glutaminylisoleucylglutamylprolylthreonylalanylaspartylleucylthreonylglyc–
ylisoleucylthreonylasparaginylglutaminylleucylisoleucylthreonylcysteinyll–
ysylalanylglycylserylprolylphenylalanylthreonylisoleucylaspartylvalylprol–
ylisoleucylserylglycylarginylprolylalanylprolyllysylvalylthreonyltryptoph–
yllysylleucylglutamylglutamylmethionylarginylleucyllysylglutamylthreonyla–
spartylarginylvalylserylisoleucylthreonylthreonylthreonyllysylaspartylarg–
inylthreonylthreonylleucylthreonylvalyllysylaspartylserylmethionylarginyl–
glycylaspartylserylglycylarginyltyrosylphenylalanylleucylthreonylleucylgl–
utamylasparaginylthreonylalanylglycylvalyllysylthreonylphenylalanylserylv–
alylthreonylvalylvalylvalylisoleucylglycylarginylprolylglycylprolylvalylt–
hreonylglycylprolylisoleucylglutamylvalylserylserylvalylserylalanylglutam–
ylserylcysteinylvalylleucylseryltryptophylglycylglutamylprolyllysylaspart–
ylglycylglycylglycylthreonylglutamylisoleucylthreonylasparaginyltyrosylis–
oleucylvalylglutamyllysylarginylglutamylserylglycylthreonylthreonylalanyl–
tryptophylglutaminylleucylvalylasparaginylserylserylvalyllysylarginylthre–
onylglutaminylisoleucyllysylvalylthreonylhistidylleucylthreonyllysyltyros–
ylmethionylglutamyltyrosylserylphenylalanylarginylvalylserylserylglutamyl–
asparaginylarginylphenylalanylglycylvalylseryllysylprolylleucylglutamylse–
rylalanylprolylisoleucylisoleucylalanylglutamylhistidylprolylphenylalanyl–
valylprolylprolylserylalanylprolylthreonylarginylprolylglutamylvalyltyros–
ylhistidylvalylserylalanylasparaginylalanylmethionylserylisoleucylarginyl–
tryptophylglutamylglutamylprolyltyrosylhistidylaspartylglycylglycylseryll–
ysylisoleucylisoleucylglycyltyrosyltryptophylvalylglutamyllysyllysylgluta–
mylarginylasparaginylthreonylisoleucylleucyltryptophylvalyllysylglutamyla–
sparaginyllysylvalylprolylcysteinylleucylglutamylcysteinylasparaginyltyro–
syllysylvalylthreonylglycylleucylvalylglutamylglycylleucylglutamyltyrosyl–
glutaminylphenylalanylarginylthreonyltyrosylalanylleucylasparaginylalanyl–
alanylglycylvalylseryllysylalanylserylglutamylalanylserylarginylprolyliso–
leucylmethionylalanylglutaminylasparaginylprolylvalylaspartylalanylprolyl–
glycylarginylprolylglutamylvalylthreonylaspartylvalylthreonylarginylseryl–
threonylvalylserylleucylisoleucyltryptophylserylalanylprolylalanyltyrosyl–
aspartylglycylglycylseryllysylvalylvalylglycyltyrosylisoleucylisoleucylgl–
utamylarginyllysylprolylvalylserylglutamylvalylglycylaspartylglycylarginy–
ltryptophylleucyllysylcysteinylasparaginyltyrosylthreonylisoleucylvalylse–
rylaspartylasparaginylphenylalanylphenylalanylthreonylvalylthreonylalanyl–
leucylserylglutamylglycylaspartylthreonyltyrosylglutamylphenylalanylargin–
ylvalylleucylalanyllysylasparaginylalanylalanylglycylvalylisoleucylseryll–
ysylglycylserylglutamylserylthreonylglycylprolylvalylthreonylcysteinylarg–
inylaspartylglutamyltyrosylalanylprolylprolyllysylalanylglutamylleucylasp–
artylalanylarginylleucylhistidylglycylaspartylleucylvalylthreonylisoleucy–
larginylalanylglycylserylaspartylleucylvalylleucylaspartylalanylalanylval–
ylglycylglycyllysylprolylglutamylprolyllysylisoleucylisoleucyltryptophylt–
hreonyllysylglycylaspartyllysylglutamylleucylaspartylleucylcysteinylgluta–
myllysylvalylserylleucylglutaminyltyrosylthreonylglycyllysylarginylalanyl–
threonylalanylvalylisoleucyllysylphenylalanylcysteinylaspartylarginylsery–
laspartylserylglycyllysyltyrosylthreonylleucylthreonylvalyllysylasparagin–
ylalanylserylglycylthreonyllysylalanylvalylserylvalylmethionylvalyllysylv–
alylleucylaspartylserylprolylglycylprolylcysteinylglycyllysylleucylthreon–
ylvalylserylarginylvalylthreonylglutaminylglutamyllysylcysteinylthreonyll–
eucylalanyltryptophylserylleucylprolylglutaminylglutamylaspartylglycylgly–
cylalanylglutamylisoleucylthreonylhistidyltyrosylisoleucylvalylglutamylar–
ginylarginylglutamylthreonylserylarginylleucylasparaginyltryptophylvalyli–
soleucylvalylglutamylglycylglutamylcysteinylprolylthreonylleucylseryltyro–
sylvalylvalylthreonylarginylleucylisoleucyllysylasparaginylasparaginylglu–
tamyltyrosylisoleucylphenylalanylarginylvalylarginylalanylvalylasparaginy–
llysyltyrosylglycylprolylglycylvalylprolylvalylglutamylserylglutamylproly–
lisoleucylvalylalanylarginylasparaginylserylphenylalanylthreonylisoleucyl–
prolylserylprolylprolylglycylisoleucylprolylglutamylglutamylvalylglycylth–
reonylglycyllysylglutamylhistidylisoleucylisoleucylisoleucylglutaminyltry–
ptophylthreonyllysylprolylglutamylserylaspartylglycylglycylasparaginylglu–
tamylisoleucylserylasparaginyltyrosylleucylvalylaspartyllysylarginylgluta–
myllysylglutamylserylleucylarginyltryptophylthreonylarginylvalylasparagin–
yllysylaspartyltyrosylvalylvalyltyrosylaspartylthreonylarginylleucyllysyl–
valylthreonylserylleucylmethionylglutamylglycylcysteinylaspartyltyrosylgl–
utaminylphenylalanylarginylvalylthreonylalanylvalylasparaginylalanylalany–
lglycylasparaginylserylglutamylprolylserylglutamylarginylserylasparaginyl–
phenylalanylisoleucylserylcysteinylarginylglutamylprolylseryltyrosylthreo–
nylprolylglycylprolylprolylserylalanylprolylarginylvalylvalylaspartylthre–
onylthreonyllysylhistidylserylisoleucylserylleucylalanyltryptophylthreony–
llysylprolylmethionyltyrosylaspartylglycylglycylthreonylaspartylisoleucyl–
valylglycyltyrosylvalylleucylglutamylmethionylglutaminylglutamyllysylaspa–
rtylthreonylaspartylglutaminyltryptophyltyrosylarginylvalylhistidylthreon–
ylasparaginylalanylthreonylisoleucylarginylasparaginylthreonylglutamylphe–
nylalanylthreonylvalylprolylaspartylleucyllysylmethionylglycylglutaminyll–
ysyltyrosylserylphenylalanylarginylvalylalanylalanylvalylasparaginylvalyl–
lysylglycylmethionylserylglutamyltyrosylserylglutamylserylisoleucylalanyl–
glutamylisoleucylglutamylprolylvalylglutamylarginylisoleucylglutamylisole–
ucylprolylaspartylleucylglutamylleucylalanylaspartylaspartylleucyllysylly–
sylthreonylvalylthreonylisoleucylarginylalanylglycylalanylserylleucylargi–
nylleucylmethionylvalylserylvalylserylglycylarginylprolylprolylprolylvaly–
lisoleucylthreonyltryptophylseryllysylglutaminylglycylisoleucylaspartylle–
ucylalanylserylarginylalanylisoleucylisoleucylaspartylthreonylthreonylglu–
tamylseryltyrosylserylleucylleucylisoleucylvalylaspartyllysylvalylasparag–
inylarginyltyrosylaspartylalanylglycyllysyltyrosylthreonylisoleucylglutam–
ylalanylglutamylasparaginylglutaminylserylglycyllysyllysylserylalanylthre–
onylvalylleucylvalyllysylvalyltyrosylaspartylthreonylprolylglycylprolylcy–
steinylprolylserylvalyllysylvalyllysylglutamylvalylserylarginylaspartylse–
rylvalylthreonylisoleucylthreonyltryptophylglutamylisoleucylprolylthreony–
lisoleucylaspartylglycylglycylalanylprolylisoleucylasparaginylasparaginyl–
tyrosylisoleucylvalylglutamyllysylarginylglutamylalanylalanylmethionylarg–
inylalanylphenylalanyllysylthreonylvalylthreonylthreonyllysylcysteinylser–
yllysylthreonylleucyltyrosylarginylisoleucylserylglycylleucylvalylglutamy–
lglycylthreonylmethionylhistidyltyrosylphenylalanylarginylvalylleucylprol–
ylglutamylasparaginylisoleucyltyrosylglycylisoleucylglycylglutamylprolylc–
ysteinylglutamylthreonylserylaspartylalanylvalylleucylvalylserylglutamylv–
alylprolylleucylvalylprolylalanyllysylleucylglutamylvalylvalylaspartylval–
ylthreonyllysylserylthreonylvalylthreonylleucylalanyltryptophylglutamylly–
sylprolylleucyltyrosylaspartylglycylglycylserylarginylleucylthreonylglycy–
ltyrosylvalylleucylglutamylalanylcysteinyllysylalanylglycylthreonylglutam–
ylarginyltryptophylmethionyllysylvalylvalylthreonylleucyllysylprolylthreo–
nylvalylleucylglutamylhistidylthreonylvalylthreonylserylleucylasparaginyl–
glutamylglycylglutamylglutaminyltyrosylleucylphenylalanylarginylisoleucyl–
arginylalanylglutaminylasparaginylglutamyllysylglycylvalylserylglutamylpr–
olylarginylglutamylthreonylvalylthreonylalanylvalylthreonylvalylglutaminy–
laspartylleucylarginylvalylleucylprolylthreonylisoleucylaspartylleucylser–
ylthreonylmethionylprolylglutaminyllysylthreonylisoleucylhistidylvalylpro–
lylalanylglycylarginylprolylvalylglutamylleucylvalylisoleucylprolylisoleu–
cylalanylglycylarginylprolylprolylprolylalanylalanylseryltryptophylphenyl–
alanylphenylalanylalanylglycylseryllysylleucylarginylglutamylserylglutamy–
larginylvalylthreonylvalylglutamylthreonylhistidylthreonyllysylvalylalany–
llysylleucylthreonylisoleucylarginylglutamylthreonylthreonylisoleucylargi–
nylaspartylthreonylglycylglutamyltyrosylthreonylleucylglutamylleucyllysyl–
asparaginylvalylthreonylglycylthreonylthreonylserylglutamylthreonylisoleu–
cyllysylvalylisoleucylisoleucylleucylaspartyllysylprolylglycylprolylproly–
lthreonylglycylprolylisoleucyllysylisoleucylaspartylglutamylisoleucylaspa–
rtylalanylthreonylserylisoleucylthreonylisoleucylseryltryptophylglutamylp–
rolylprolylglutamylleucylaspartylglycylglycylalanylprolylleucylserylglycy–
ltyrosylvalylvalylglutamylglutaminylarginylaspartylalanylhistidylarginylp–
rolylglycyltryptophylleucylprolylvalylserylglutamylserylvalylthreonylargi–
nylserylthreonylphenylalanyllysylphenylalanylthreonylarginylleucylthreony–
lglutamylglycylasparaginylglutamyltyrosylvalylphenylalanylarginylvalylala–
nylalanylthreonylasparaginylarginylphenylalanylglycylisoleucylglycylseryl–
tyrosylleucylglutaminylserylglutamylvalylisoleucylglutamylcysteinylarginy–
lserylserylisoleucylarginylisoleucylprolylglycylprolylprolylglutamylthreo–
nylleucylglutaminylisoleucylphenylalanylaspartylvalylserylarginylaspartyl–
glycylmethionylthreonylleucylthreonyltryptophyltyrosylprolylprolylglutamy–
laspartylaspartylglycylglycylserylglutaminylvalylthreonylglycyltyrosyliso–
leucylvalylglutamylarginyllysylglutamylvalylarginylalanylaspartylarginylt–
ryptophylvalylarginylvalylasparaginyllysylvalylprolylvalylthreonylmethion–
ylthreonylarginyltyrosylarginylserylthreonylglycylleucylthreonylglutamylg–
lycylleucylglutamyltyrosylglutamylhistidylarginylvalylthreonylalanylisole–
ucylasparaginylalanylarginylglycylserylglycyllysylprolylserylarginylproly–
lseryllysylprolylisoleucylvalylalanylmethionylaspartylprolylisoleucylalan–
ylprolylprolylglycyllysylprolylglutaminylasparaginylprolylarginylvalylthr–
eonylaspartylthreonylthreonylarginylthreonylserylvalylserylleucylalanyltr–
yptophylserylvalylprolylglutamylaspartylglutamylglycylglycylseryllysylval–
ylthreonylglycyltyrosylleucylisoleucylglutamylmethionylglutaminyllysylval–
ylaspartylglutaminylhistidylglutamyltryptophylthreonyllysylcysteinylaspar–
aginylthreonylthreonylprolylthreonyllysylisoleucylarginylglutamyltyrosylt–
hreonylleucylthreonylhistidylleucylprolylglutaminylglycylalanylglutamylty–
rosylarginylphenylalanylarginylvalylleucylalanylcysteinylasparaginylalany–
lglycylglycylprolylglycylglutamylprolylalanylglutamylvalylprolylglycylthr–
eonylvalyllysylvalylthreonylglutamylmethionylleucylglutamyltyrosylprolyla–
spartyltyrosylglutamylleucylaspartylglutamylarginyltyrosylglutaminylgluta–
mylglycylisoleucylphenylalanylvalylarginylglutaminylglycylglycylvalylisol–
eucylarginylleucylthreonylisoleucylprolylisoleucyllysylglycyllysylprolylp–
henylalanylprolylisoleucylcysteinyllysyltryptophylthreonyllysylglutamylgl–
ycylglutaminylaspartylisoleucylseryllysylarginylalanylmethionylisoleucyla–
lanylthreonylserylglutamylthreonylhistidylthreonylglutamylleucylvalylisol–
eucyllysylglutamylalanylaspartylarginylglycylaspartylserylglycylthreonylt–
yrosylaspartylleucylvalylleucylglutamylasparaginyllysylcysteinylglycyllys–
yllysylalanylvalyltyrosylisoleucyllysylvalylarginylvalylisoleucylglycylse–
rylprolylasparaginylserylprolylglutamylglycylprolylleucylglutamyltyrosyla–
spartylaspartylisoleucylglutaminylvalylarginylserylvalylarginylvalylseryl–
tryptophylarginylprolylprolylalanylaspartylaspartylglycylglycylalanylaspa–
rtylisoleucylleucylglycyltyrosylisoleucylleucylglutamylarginylarginylglut–
amylvalylprolyllysylalanylalanyltryptophyltyrosylthreonylisoleucylasparty–
lserylarginylvalylarginylglycylthreonylserylleucylvalylvalyllysylglycylle–
ucyllysylglutamylasparaginylvalylglutamyltyrosylhistidylphenylalanylargin–
ylvalylserylalanylglutamylasparaginylglutaminylphenylalanylglycylisoleucy–
lseryllysylprolylleucyllysylserylglutamylglutamylprolylvalylthreonylproly–
llysylthreonylprolylleucylasparaginylprolylprolylglutamylprolylprolylsery–
lasparaginylprolylprolylglutamylvalylleucylaspartylvalylthreonyllysylsery–
lserylvalylserylleucylseryltryptophylserylarginylprolyllysylaspartylaspar–
tylglycylglycylserylarginylvalylthreonylglycyltyrosyltyrosylisoleucylglut–
amylarginyllysylglutamylthreonylserylthreonylaspartyllysylvalylvalylargin–
ylhistidylasparaginyllysylthreonylglutaminylisoleucylthreonylthreonylthre–
onylmethionyltyrosylthreonylvalylthreonylglycylleucylvalylprolylaspartyla–
lanylglutamyltyrosylglutaminylphenylalanylarginylisoleucylisoleucylalanyl–
glutaminylasparaginylaspartylvalylglycylleucylserylglutamylthreonylserylp–
rolylalanylserylglutamylprolylvalylvalylcysteinyllysylaspartylprolylpheny–
lalanylaspartyllysylprolylserylglutaminylprolylglycylglutamylleucylglutam–
ylisoleucylleucylserylisoleucylseryllysylaspartylserylvalylthreonylleucyl–
glutaminyltryptophylglutamyllysylprolylglutamylcysteinylaspartylglycylgly–
cyllysylglutamylisoleucylleucylglycyltyrosyltryptophylvalylglutamyltyrosy–
larginylglutaminylserylglycylaspartylserylalanyltryptophyllysyllysylseryl–
asparaginyllysylglutamylarginylisoleucyllysylaspartyllysylglutaminylpheny–
lalanylthreonylisoleucylglycylglycylleucylleucylglutamylalanylthreonylglu–
tamyltyrosylglutamylphenylalanylarginylvalylphenylalanylalanylglutamylasp–
araginylglutamylthreonylglycylleucylserylarginylprolylarginylarginylthreo–
nylalanylmethionylserylisoleucyllysylthreonyllysylleucylthreonylserylglyc–
ylglutamylalanylprolylglycylisoleucylarginyllysylglutamylmethionyllysylas–
partylvalylthreonylthreonyllysylleucylglycylglutamylalanylalanylglutaminy–
lleucylserylcysteinylglutaminylisoleucylvalylglycylarginylprolylleucylpro–
lylaspartylisoleucyllysyltryptophyltyrosylarginylphenylalanylglycyllysylg–
lutamylleucylisoleucylglutaminylserylarginyllysyltyrosyllysylmethionylser–
ylserylaspartylglycylarginylthreonylhistidylthreonylleucylthreonylvalylme–
thionylthreonylglutamylglutamylglutaminylglutamylaspartylglutamylglycylva–
lyltyrosylthreonylcysteinylisoleucylalanylthreonylasparaginylglutamylvaly–
lglycylglutamylvalylglutamylthreonylserylseryllysylleucylleucylleucylglut–
aminylalanylthreonylprolylglutaminylphenylalanylhistidylprolylglycyltyros–
ylprolylleucyllysylglutamyllysyltyrosyltyrosylglycylalanylvalylglycylsery–
lthreonylleucylarginylleucylhistidylvalylmethionyltyrosylisoleucylglycyla–
rginylprolylvalylprolylalanylmethionylthreonyltryptophylphenylalanylhisti–
dylglycylglutaminyllysylleucylleucylglutaminylasparaginylserylglutamylasp–
araginylisoleucylthreonylisoleucylglutamylasparaginylthreonylglutamylhist–
idyltyrosylthreonylhistidylleucylvalylmethionyllysylasparaginylvalylgluta–
minylarginyllysylthreonylhistidylalanylglycyllysyltyrosyllysylvalylglutam–
inylleucylserylasparaginylvalylphenylalanylglycylthreonylvalylaspartylala–
nylisoleucylleucylaspartylvalylglutamylisoleucylglutaminylaspartyllysylpr–
olylaspartyllysylprolylthreonylglycylprolylisoleucylvalylisoleucylglutamy–
lalanylleucylleucyllysylasparaginylserylalanylvalylisoleucylseryltryptoph–
yllysylprolylprolylalanylaspartylaspartylglycylglycylseryltryptophylisole–
ucylthreonylasparaginyltyrosylvalylvalylglutamyllysylcysteinylglutamylala–
nyllysylglutamylglycylalanylglutamyltryptophylglutaminylleucylvalylseryls–
erylalanylisoleucylserylvalylthreonylthreonylcysteinylarginylisoleucylval–
ylasparaginylleucylthreonylglutamylasparaginylalanylglycyltyrosyltyrosylp–
henylalanylarginylvalylserylalanylglutaminylasparaginylthreonylphenylalan–
ylglycylisoleucylserylaspartylprolylleucylglutamylvalylserylserylvalylval–
ylisoleucylisoleucyllysylserylprolylphenylalanylglutamyllysylprolylglycyl–
alanylprolylglycyllysylprolylthreonylisoleucylthreonylalanylvalylthreonyl–
lysylaspartylserylcysteinylvalylvalylalanyltryptophyllysylprolylprolylala–
nylserylaspartylglycylglycylalanyllysylisoleucylarginylasparaginyltyrosyl–
tyrosylleucylglutamyllysylarginylglutamyllysyllysylglutaminylasparaginyll–
ysyltryptophylisoleucylserylvalylthreonylthreonylglutamylglutamylisoleucy–
larginylglutamylthreonylvalylphenylalanylserylvalyllysylasparaginylleucyl–
isoleucylglutamylglycylleucylglutamyltyrosylglutamylphenylalanylarginylva–
lyllysylcysteinylglutamylasparaginylleucylglycylglycylglutamylserylglutam–
yltryptophylserylglutamylisoleucylserylglutamylprolylisoleucylthreonylpro–
lyllysylserylaspartylvalylprolylisoleucylglutaminylalanylprolylhistidylph–
enylalanyllysylglutamylglutamylleucylarginylasparaginylleucylasparaginylv–
alylarginyltyrosylglutaminylserylasparaginylalanylthreonylleucylvalylcyst–
einyllysylvalylthreonylglycylhistidylprolyllysylprolylisoleucylvalyllysyl–
tryptophyltyrosylarginylglutaminylglycyllysylglutamylisoleucylisoleucylal–
anylaspartylglycylleucyllysyltyrosylarginylisoleucylglutaminylglutamylphe–
nylalanyllysylglycylglycyltyrosylhistidylglutaminylleucylisoleucylisoleuc–
ylalanylserylvalylthreonylaspartylaspartylaspartylalanylthreonylvalyltyro–
sylglutaminylvalylarginylalanylthreonylasparaginylglutaminylglycylglycyls–
erylvalylserylglycylthreonylalanylserylleucylglutamylvalylglutamylvalylpr–
olylalanyllysylisoleucylhistidylleucylprolyllysylthreonylleucylglutamylgl–
ycylmethionylglycylalanylvalylhistidylalanylleucylarginylglycylglutamylva–
lylvalylserylisoleucyllysylisoleucylprolylphenylalanylserylglycyllysylpro–
lylaspartylprolylvalylisoleucylthreonyltryptophylglutaminyllysylglycylglu–
taminylaspartylleucylisoleucylaspartylasparaginylasparaginylglycylhistidy–
ltyrosylglutaminylvalylisoleucylvalylthreonylarginylserylphenylalanylthre–
onylserylleucylvalylphenylalanylprolylasparaginylglycylvalylglutamylargin–
yllysylaspartylalanylglycylphenylalanyltyrosylvalylvalylcysteinylalanylly–
sylasparaginylarginylphenylalanylglycylisoleucylaspartylglutaminyllysylth–
reonylvalylglutamylleucylaspartylvalylalanylaspartylvalylprolylaspartylpr–
olylprolylarginylglycylvalyllysylvalylserylaspartylalanylserylarginylaspa–
rtylserylvalylasparaginylleucylthreonyltryptophylthreonylglutamylprolylal–
anylserylaspartylglycylglycylseryllysylisoleucylthreonylasparaginyltyrosy–
lisoleucylvalylglutamyllysylcysteinylalanylthreonylthreonylalanylglutamyl–
arginyltryptophylleucylarginylvalylglycylglutaminylalanylarginylglutamylt–
hreonylarginyltyrosylthreonylvalylisoleucylasparaginylleucylphenylalanylg–
lycyllysylthreonylseryltyrosylglutaminylphenylalanylarginylvalylisoleucyl–
alanylglutamylasparaginyllysylphenylalanylglycylleucylseryllysylprolylser–
ylglutamylprolylserylglutamylprolylthreonylisoleucylthreonyllysylglutamyl–
aspartyllysylthreonylarginylalanylmethionylasparaginyltyrosylaspartylglut–
amylglutamylvalylaspartylglutamylthreonylarginylglutamylvalylserylmethion–
ylthreonyllysylalanylserylhistidylserylserylthreonyllysylglutamylleucylty–
rosylglutamyllysyltyrosylmethionylisoleucylalanylglutamylaspartylleucylgl–
ycylarginylglycylglutamylphenylalanylglycylisoleucylvalylhistidylarginylc–
ysteinylvalylglutamylthreonylserylseryllysyllysylthreonyltyrosylmethionyl–
alanyllysylphenylalanylvalyllysylvalyllysylglycylthreonylaspartylglutamin–
ylvalylleucylvalyllysyllysylglutamylisoleucylserylisoleucylleucylasparagi–
nylisoleucylalanylarginylhistidylarginylasparaginylisoleucylleucylhistidy–
lleucylhistidylglutamylserylphenylalanylglutamylserylmethionylglutamylglu–
tamylleucylvalylmethionylisoleucylphenylalanylglutamylphenylalanylisoleuc–
ylserylglycylleucylaspartylisoleucylphenylalanylglutamylarginylisoleucyla–
sparaginylthreonylserylalanylphenylalanylglutamylleucylasparaginylglutamy–
larginylglutamylisoleucylvalylseryltyrosylvalylhistidylglutaminylvalylcys–
teinylglutamylalanylleucylglutaminylphenylalanylleucylhistidylserylhistid–
ylasparaginylisoleucylglycylhistidylphenylalanylaspartylisoleucylarginylp–
rolylglutamylasparaginylisoleucylisoleucyltyrosylglutaminylthreonylarginy–
larginylserylserylthreonylisoleucyllysylisoleucylisoleucylglutamylphenyla–
lanylglycylglutaminylalanylarginylglutaminylleucyllysylprolylglycylaspart–
ylasparaginylphenylalanylarginylleucylleucylphenylalanylthreonylalanylpro–
lylglutamyltyrosyltyrosylalanylprolylglutamylvalylhistidylglutaminylhisti–
dylaspartylvalylvalylserylthreonylalanylthreonylaspartylmethionyltryptoph–
ylserylleucylglycylthreonylleucylvalyltyrosylvalylleucylleucylserylglycyl–
isoleucylasparaginylprolylphenylalanylleucylalanylglutamylthreonylasparag–
inylglutaminylglutaminylisoleucylisoleucylglutamylasparaginylisoleucylmet–
hionylasparaginylalanylglutamyltyrosylthreonylphenylalanylaspartylglutamy–
lglutamylalanylphenylalanyllysylglutamylisoleucylserylisoleucylglutamylal–
anylmethionylaspartylphenylalanylvalylaspartylarginylleucylleucylvalyllys–
ylglutamylarginyllysylserylarginylmethionylthreonylalanylserylglutamylala–
nylleucylglutaminylhistidylprolyltryptophylleucyllysylglutaminyllysylisol–
eucylglutamylarginylvalylserylthreonyllysylvalylisoleucylarginylthreonyll–
eucyllysylhistidylarginylarginyltyrosyltyrosylhistidylthreonylleucylisole–
ucyllysyllysylaspartylleucylasparaginylmethionylvalylvalylserylalanylalan–
ylarginylisoleucylserylcysteinylglycylglycylalanylisoleucylarginylserylgl–
utaminyllysylglycylvalylserylvalylalanyllysylvalyllysylvalylalanylserylis–
oleucylglutamylisoleucylglycylprolylvalylserylglycylglutaminylisoleucylme–
thionylhistidylalanylvalylglycylglutamylglutamylglycylglycylhistidylvalyl–
lysyltyrosylvalylcysteinyllysylisoleucylglutamylasparaginyltyrosylasparty–
lglutaminylserylthreonylglutaminylvalylthreonyltryptophyltyrosylphenylala–
nylglycylvalylarginylglutaminylleucylglutamylasparaginylserylglutamyllysy–
ltyrosylglutamylisoleucylthreonyltyrosylglutamylaspartylglycylvalylalanyl–
isoleucylleucyltyrosylvalyllysylaspartylisoleucylthreonyllysylleucylaspar–
tylaspartylglycylthreonyltyrosylarginylcysteinyllysylvalylvalylasparaginy–
laspartyltyrosylglycylglutamylaspartylserylseryltyrosylalanylglutamylleuc–
ylphenylalanylvalyllysylglycylvalylarginylglutamylvalyltyrosylaspartyltyr–
osyltyrosylcysteinylarginylarginylthreonylmethionyllysyllysylisoleucyllys–
ylarginylarginylthreonylaspartylthreonylmethionylarginylleucylleucylgluta–
mylarginylprolylprolylglutamylphenylalanylthreonylleucylprolylleucyltyros–
ylasparaginyllysylthreonylalanyltyrosylvalylglycylglutamylasparaginylvaly–
larginylphenylalanylglycylvalylthreonylisoleucylthreonylvalylhistidylprol–
ylglutamylprolylhistidylvalylthreonyltryptophyltyrosyllysylserylglycylglu–
taminyllysylisoleucyllysylprolylglycylaspartylasparaginylaspartyllysyllys–
yltyrosylthreonylphenylalanylglutamylserylaspartyllysylglycylleucyltyrosy–
lglutaminylleucylthreonylisoleucylasparaginylserylvalylthreonylthreonylas–
partylaspartylaspartylalanylglutamyltyrosylthreonylvalylvalylalanylarginy–
lasparaginyllysyltyrosylglycylglutamylaspartylserylcysteinyllysylalanylly–
sylleucylthreonylvalylthreonylleucylhistidylprolylprolylprolylthreonylasp–
artylserylthreonylleucylarginylprolylmethionylphenylalanyllysylarginylleu–
cylleucylalanylasparaginylalanylglutamylcysteinylglutaminylglutamylglycyl–
glutaminylserylvalylcysteinylphenylalanylglutamylisoleucylarginylvalylser–
ylglycylisoleucylprolylprolylprolylthreonylleucyllysyltryptophylglutamyll–
ysylaspartylglycylglutaminylprolylleucylserylleucylglycylprolylasparaginy–
lisoleucylglutamylisoleucylisoleucylhistidylglutamylglycylleucylaspartylt–
yrosyltyrosylalanylleucylhistidylisoleucylarginylaspartylthreonylleucylpr–
olylglutamylaspartylthreonylglycyltyrosyltyrosylarginylvalylthreonylalany–
lthreonylasparaginylthreonylalanylglycylserylthreonylserylcysteinylglutam–
inylalanylhistidylleucylglutaminylvalylglutamylarginylleucylarginyltyrosy–
llysyllysylglutaminylglutamylphenylalanyllysylseryllysylglutamylglutamylh–
istidylglutamylarginylhistidylvalylglutaminyllysylglutaminylisoleucylaspa–
rtyllysylthreonylleucylarginylmethionylalanylglutamylisoleucylleucylseryl–
glycylthreonylglutamylserylvalylprolylleucylthreonylglutaminylvalylalanyl–
lysylglutamylalanylleucylarginylglutamylalanylalanylvalylleucyltyrosyllys–
ylprolylalanylvalylserylthreonyllysylthreonylvalyllysylglycylglutamylphen–
ylalanylarginylleucylglutamylisoleucylglutamylglutamyllysyllysylglutamylg–
lutamylarginyllysylleucylarginylmethionylprolyltyrosylaspartylvalylprolyl–
glutamylprolylarginyllysyltyrosyllysylglutaminylthreonylthreonylisoleucyl–
glutamylglutamylaspartylglutaminylarginylisoleucyllysylglutaminylphenylal–
anylvalylprolylmethionylserylaspartylmethionyllysyltryptophyltyrosyllysyl–
lysylisoleucylarginylaspartylglutaminyltyrosylglutamylmethionylprolylglyc–
yllysylleucylaspartylarginylvalylvalylglutaminyllysylarginylprolyllysylar–
ginylisoleucylarginylleucylserylarginyltryptophylglutamylglutaminylphenyl–
alanyltyrosylvalylmethionylprolylleucylprolylarginylisoleucylthreonylaspa–
rtylglutaminyltyrosylarginylprolyllysyltryptophylarginylisoleucylprolylly–
sylleucylserylglutaminylaspartylaspartylleucylglutamylisoleucylvalylargin–
ylprolylalanylarginylarginylarginylthreonylprolylserylprolylaspartyltyros–
ylaspartylphenylalanyltyrosyltyrosylarginylprolylarginylarginylarginylser–
ylleucylglycylaspartylisoleucylserylaspartylglutamylglutamylleucylleucyll–
eucylprolylisoleucylaspartylaspartyltyrosylleucylalanylmethionyllysylargi–
nylthreonylglutamylglutamylglutamylarginylleucylarginylleucylglutamylglut–
amylglutamylleucylglutamylleucylglycylphenylalanylserylalanylserylprolylp–
rolylserylarginylserylprolylprolylhistidylphenylalanylglutamylleucylseryl–
serylleucylarginyltyrosylserylserylprolylglutaminylalanylhistidylvalyllys–
ylvalylglutamylglutamylthreonylarginyllysylasparaginylphenylalanylarginyl–
tyrosylserylthreonyltyrosylhistidylisoleucylprolylthreonyllysylalanylglut–
amylalanylserylthreonylseryltyrosylalanylglutamylleucylarginylglutamylarg–
inylhistidylalanylglutaminylalanylalanyltyrosylarginylglutaminylprolyllys–
ylglutaminylarginylglutaminylarginylisoleucylmethionylalanylglutamylargin–
ylglutamylaspartylglutamylglutamylleucylleucylarginylprolylvalylthreonylt–
hreonylthreonylglutaminylhistidylleucylserylglutamyltyrosyllysylserylglut–
amylleucylaspartylphenylalanylmethionylseryllysylglutamylglutamyllysylser–
ylarginyllysyllysylserylarginylarginylglutaminylarginylglutamylvalylthreo–
nylglutamylisoleucylthreonylglutamylisoleucylglutamylglutamylglutamyltyro–
sylglutamylisoleucylseryllysylhistidylalanylglutaminylarginylglutamylsery–
lserylserylserylalanylserylarginylleucylleucylarginylarginylarginylarginy–
lserylleucylserylprolylthreonyltyrosylisoleucylglutamylleucylmethionylarg–
inylprolylvalylserylglutamylleucylisoleucylarginylserylarginylprolylgluta–
minylprolylalanylglutamylglutamyltyrosylglutamylaspartylaspartylthreonylg–
lutamylarginylarginylserylprolylthreonylprolylglutamylarginylthreonylargi–
nylprolylarginylserylprolylserylprolylvalylserylserylglutamylarginylseryl–
leucylserylarginylphenylalanylglutamylarginylserylalanylarginylphenylalan–
ylaspartylisoleucylphenylalanylserylarginyltyrosylglutamylserylmethionyll–
ysylalanylalanylleucyllysylthreonylglutaminyllysylthreonylserylglutamylar–
ginyllysyltyrosylglutamylvalylleucylserylglutaminylglutaminylprolylphenyl–
alanylthreonylleucylaspartylhistidylalanylprolylarginylisoleucylthreonyll–
eucylarginylmethionylarginylserylhistidylarginylvalylprolylcysteinylglycy–
lglutaminylasparaginylthreonylarginylphenylalanylisoleucylleucylasparagin–
ylvalylglutaminylseryllysylprolylthreonylalanylglutamylvalyllysyltryptoph–
yltyrosylhistidylasparaginylglycylvalylglutamylleucylglutaminylglutamylse–
rylseryllysylisoleucylhistidyltyrosylthreonylasparaginylthreonylserylglyc–
ylvalylleucylthreonylleucylglutamylisoleucylleucylaspartylcysteinylhistid–
ylthreonylaspartylaspartylserylglycylthreonyltyrosylarginylalanylvalylcys–
teinylthreonylasparaginyltyrosyllysylglycylglutamylalanylserylaspartyltyr–
osylalanylthreonylleucylaspartylvalylthreonylglycylglycylaspartyltyrosylt–
hreonylthreonyltyrosylalanylserylglutaminylarginylarginylaspartylglutamyl–
glutamylvalylprolylarginylserylvalylphenylalanylprolylglutamylleucylthreo–
nylarginylthreonylglutamylalanyltyrosylalanylvalylprolylserylphenylalanyl–
lysyllysylthreonylserylglutamylmethionylglutamylalanylserylserylserylvaly–
larginylglutamylvalyllysylserylglutaminylmethionylthreonylglutamylthreony–
larginylglutamylserylleucylserylseryltyrosylglutamylhistidylserylalanylse–
rylalanylglutamylmethionyllysylserylalanylalanylleucylglutamylglutamyllys–
ylserylleucylglutamylglutamyllysylserylthreonylthreonylarginyllysylisoleu–
cyllysylthreonylthreonylleucylalanylalanylarginylisoleucylleucylthreonyll–
ysylprolylarginylserylmethionylthreonylvalyltyrosylglutamylglycylglutamyl–
serylalanylarginylphenylalanylserylcysteinylaspartylthreonylaspartylglycy–
lglutamylprolylvalylprolylthreonylvalylthreonyltryptophylleucylarginyllys–
ylglycylglutaminylvalylleucylserylthreonylserylalanylarginylhistidylgluta–
minylvalylthreonylthreonylthreonyllysyltyrosyllysylserylthreonylphenylala–
nylglutamylisoleucylserylserylvalylglutaminylalanylserylaspartylglutamylg–
lycylasparaginyltyrosylserylvalylvalylvalylglutamylasparaginylserylglutam–
ylglycyllysylglutaminylglutamylalanylglutamylphenylalanylthreonylleucylth–
reonylisoleucylglutaminyllysylalanylarginylvalylthreonylglutamyllysylalan–
ylvalylthreonylserylprolylprolylarginylvalyllysylserylprolylglutamylproly–
larginylvalyllysylserylprolylglutamylalanylvalyllysylserylprolyllysylargi–
nylvalyllysylserylprolylglutamylprolylserylhistidylprolyllysylalanylvalyl–
serylprolylthreonylglutamylthreonyllysylprolylthreonylprolylarginylglutam–
yllysylvalylglutaminylhistidylleucylprolylvalylserylalanylprolylprolyllys–
ylisoleucylthreonylglutaminylphenylalanylleucyllysylalanylglutamylalanyls–
eryllysylglutamylisoleucylalanyllysylleucylthreonylcysteinylvalylvalylglu–
tamylserylserylvalylleucylarginylalanyllysylglutamylvalylthreonyltryptoph–
yltyrosyllysylaspartylglycyllysyllysylleucyllysylglutamylasparaginylglycy–
lhistidylphenylalanylglutaminylphenylalanylhistidyltyrosylserylalanylaspa–
rtylglycylthreonyltyrosylglutamylleucyllysylisoleucylasparaginylasparagin–
ylleucylthreonylglutamylserylaspartylglutaminylglycylglutamyltyrosylvalyl–
cysteinylglutamylisoleucylserylglycylglutamylglycylglycylthreonylseryllys–
ylthreonylasparaginylleucylglutaminylphenylalanylmethionylglycylglutaminy–
lalanylphenylalanyllysylserylisoleucylhistidylglutamyllysylvalylseryllysy–
lisoleucylserylglutamylthreonyllysyllysylserylaspartylglutaminyllysylthre–
onylthreonylglutamylserylthreonylvalylthreonylarginyllysylthreonylglutamy–
lprolyllysylalanylprolylglutamylprolylisoleucylserylseryllysylprolylvalyl–
isoleucylvalylthreonylglycylleucylglutaminylaspartylthreonylthreonylvalyl–
serylserylaspartylserylvalylalanyllysylphenylalanylalanylvalyllysylalanyl–
threonylglycylglutamylprolylarginylprolylthreonylalanylisoleucyltryptophy–
lthreonyllysylaspartylglycyllysylalanylisoleucylthreonylglutaminylglycylg–
lycyllysyltyrosyllysylleucylserylglutamylaspartyllysylglycylglycylphenyla–
lanylphenylalanylleucylglutamylisoleucylhistidyllysylthreonylaspartylthre–
onylserylaspartylserylglycylleucyltyrosylthreonylcysteinylthreonylvalylly–
sylasparaginylserylalanylglycylserylvalylserylserylserylcysteinyllysylleu–
cylthreonylisoleucyllysylalanylisoleucyllysylaspartylthreonylglutamylalan–
ylglutaminyllysylvalylserylthreonylglutaminyllysylthreonylserylglutamylis–
oleucylthreonylprolylglutaminyllysyllysylalanylvalylvalylglutaminylglutam–
ylglutamylisoleucylserylglutaminyllysylalanylleucylarginylserylglutamylgl–
utamylisoleucyllysylmethionylserylglutamylalanyllysylserylglutaminylgluta–
myllysylleucylalanylleucyllysylglutamylglutamylalanylseryllysylvalylleucy–
lisoleucylserylglutamylglutamylvalyllysyllysylserylalanylalanylthreonylse–
rylleucylglutamyllysylserylisoleucylvalylhistidylglutamylglutamylisoleucy–
lthreonyllysylthreonylserylglutaminylalanylserylglutamylglutamylvalylargi–
nylthreonylhistidylalanylglutamylisoleucyllysylalanylphenylalanylserylthr–
eonylglutaminylmethionylserylisoleucylasparaginylglutamylglycylglutaminyl–
arginylleucylvalylleucyllysylalanylasparaginylisoleucylalanylglycylalanyl–
threonylaspartylvalyllysyltryptophylvalylleucylasparaginylglycylvalylglut–
amylleucylthreonylasparaginylserylglutamylglutamyltyrosylarginyltyrosylgl–
ycylvalylserylglycylserylaspartylglutaminylthreonylleucylthreonylisoleucy–
llysylglutaminylalanylserylhistidylarginylaspartylglutamylglycylisoleucyl–
leucylthreonylcysteinylisoleucylseryllysylthreonyllysylglutamylglycylisol–
eucylvalyllysylcysteinylglutaminyltyrosylaspartylleucylthreonylleucylsery–
llysylglutamylleucylserylaspartylalanylprolylalanylphenylalanylisoleucyls–
erylglutaminylprolylarginylserylglutaminylasparaginylisoleucylasparaginyl–
glutamylglycylglutaminylasparaginylvalylleucylphenylalanylthreonylcystein–
ylglutamylisoleucylserylglycylglutamylprolylserylprolylglutamylisoleucylg–
lutamyltryptophylphenylalanyllysylasparaginylasparaginylleucylprolylisole–
ucylserylisoleucylserylserylasparaginylvalylserylisoleucylserylarginylser–
ylarginylasparaginylvalyltyrosylserylleucylglutamylisoleucylarginylaspara–
ginylalanylserylvalylserylaspartylserylglycyllysyltyrosylthreonylisoleucy–
llysylalanyllysylasparaginylphenylalanylarginylglycylglutaminylcysteinyls–
erylalanylthreonylalanylserylleucylmethionylvalylleucylprolylleucylvalylg–
lutamylglutamylprolylserylarginylglutamylvalylvalylleucylarginylthreonyls–
erylglycylaspartylthreonylserylleucylglutaminylglycylserylphenylalanylser–
ylserylglutaminylserylvalylglutaminylmethionylserylalanylseryllysylglutam–
inylglutamylalanylserylphenylalanylserylserylphenylalanylserylserylseryls–
erylalanylserylserylmethionylthreonylglutamylmethionyllysylphenylalanylal–
anylserylmethionylserylalanylglutaminylserylmethionylserylserylmethionylg–
lutaminylglutamylserylphenylalanylvalylglutamylmethionylserylserylserylse–
rylphenylalanylmethionylglycylisoleucylserylasparaginylmethionylthreonylg–
lutaminylleucylglutamylserylserylthreonylseryllysylmethionylleucyllysylal–
anylglycylisoleucylarginylglycylisoleucylprolylprolyllysylisoleucylglutam–
ylalanylleucylprolylserylaspartylisoleucylserylisoleucylaspartylglutamylg–
lycyllysylvalylleucylthreonylvalylalanylcysteinylalanylphenylalanylthreon–
ylglycylglutamylprolylthreonylprolylglutamylvalylthreonyltryptophylserylc–
ysteinylglycylglycylarginyllysylisoleucylhistidylserylglutaminylglutamylg–
lutaminylglycylarginylphenylalanylhistidylisoleucylglutamylasparaginylthr–
eonylaspartylaspartylleucylthreonylthreonylleucylisoleucylisoleucylmethio–
nylaspartylvalylglutaminyllysylglutaminylaspartylglycylglycylleucyltyrosy–
lthreonylleucylserylleucylglycylasparaginylglutamylphenylalanylglycylsery–
laspartylserylalanylthreonylvalylasparaginylisoleucylhistidylisoleucylarg–
inylserylisoleucine

 

Answer by amit.soundalgekar
Submitted on 4/11/2005
Rating: Not yet rated Rate this answer: Vote
floccpocinihilipilification

 

Answer by Word Master
Submitted on 4/11/2005
Rating: Not yet rated Rate this answer: Vote
thisislongerthananywordouttherebecauseisaidsoyoulitleprickofaguyhahahahayousuckalotokay

 

Answer by Shawty
Submitted on 4/12/2005
Rating: Not yet rated Rate this answer: Vote
Milesrockscuzhe'sawsomeandveryveryveryveryveryveryveryverycoolandhe'ssoflythisisthelongestwordevercusiwroteiturn'tcool

 

Answer by sir elephantay
Submitted on 4/12/2005
Rating: Not yet rated Rate this answer: Vote
buttertooth

 

Answer by cable729
Submitted on 4/13/2005
Rating: Not yet rated Rate this answer: Vote
PNEUMONO­ULTRA­MICRO­SCOPIC­SILICO­VOLCANO­KONIOSIS

 

Answer by eek eek
Submitted on 4/18/2005
Rating: Not yet rated Rate this answer: Vote
gonadotropic

 

Answer by Stans Sports Bar
Submitted on 4/21/2005
Rating: Not yet rated Rate this answer: Vote
thisisthelongestwordsowhateveryousayabouttheseotherwordsiswrongsogetadayjob

 

Answer by im gay
Submitted on 4/27/2005
Rating: Not yet rated Rate this answer: Vote
thsiisthelongetswordbecauseithasthemostlettersinit

 

Answer by asdf
Submitted on 5/1/2005
Rating: Not yet rated Rate this answer: Vote
alfahhostilenterntilantssterona

 

Answer by asdf
Submitted on 5/1/2005
Rating: Not yet rated Rate this answer: Vote
antirontasolanontaracisilanarastalantarnism

 

Answer by dragonnav
Submitted on 5/3/2005
Rating: Not yet rated Rate this answer: Vote
methionylglutaminylarginyltyrosylglutamylserylleucylphenylalanylalan ylglutaminylleucyllysylglutamylarginyllysylglutamylglycylalanylpheny lalanylvalylprolylphenylalanylyalylthreonylleucylglycylaspartylproly lglycylisoleucylglutamylglutaminylserylleucyllysylisoleucylaspartylt hreonylleucylisoleucylglutamylalanylglycylalanylaspartylalanylleucyl glutamylleucylglycylisoleucylprolylphenylalanylserylaspartylprolylle ucylalanylaspartylglycylprolylthreonylisoleucylglutaminylasparaginyl alanylthreonylleucylarginylalanylphenylalanylalanylalanylglycylvalyl threonylprolylalanylglutaminylcysteinylphenylalanylglutamylmethionyl leucyalanylleucylisoleucylarginylglutaminyllysylhistidylprolylthreon ylisoleucylprolylisoleucylglycylleucylleucylmethionyltyrosylalanylas paraginylleucylvalylphenylalanylasparaginyllysylglycylisoleucylaspar tylglutamylphenylalanyltyrosylalanylglutaminylcysteinylglutamyllysyl valylglycylvalylaspartylserylvalylleucylvalylalanylaspartylvalylprol ylvalylglutaminylglutamylserylalanylprolylphenylalanylarginylglutami nylalanylalanylleucylarginylhistidylasparaginylvalylalanylprolylisol eucylphenylalanylisoleucylcysteinylprolylprolylaspartylalanylasparty laspartylaspartylleucylleucylarginylglutaminylisoleucylalanylserylty rosylglycylarginylglycyltyrosylthreonyltyrosylleucylleucylserylargin ylalanylglycylvalylthreonylglycylalanylglutamylasparaginylarginylala nylalanylleucylprolylleucylasparaginylhistidylleucylvalylalanyllysyl leucyllysylglutamyltyrosylasparaginylalanylalanylprolylprolylleucylg lutaminylglycylphenylalanylglycylisoleucylserylalanylprolylaspartylg lutaminylvalyllysylalanylalanylisoleucylaspartylalanylglycylalanylal anylglycylalanylisoleucylserylglycylserylalanylisoleucylvalyllysylis oleucylisoleucylglutamylglutaminylhistidylasparaginylisoleucylglutam ylprolylglutamyllysylmethionylleucylalanylalanylleucyllysylvalylphen ylalanylvalylglutaminylprolylmethionyllysylalanylalanylthreonylargin ylserine

 

Answer by Rajiv Sharma
Submitted on 5/9/2005
Rating: Not yet rated Rate this answer: Vote
supercalifragilisticexpialidocious

 

Answer by blobzontherun
Submitted on 5/11/2005
Rating: Not yet rated Rate this answer: Vote
the biggest word is grrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr

 

Answer by Thomas Horton
Submitted on 5/12/2005
Rating: Not yet rated Rate this answer: Vote
youallsuckgetalifeandgetofthecomputer

 

Answer by shadow
Submitted on 5/16/2005
Rating: Not yet rated Rate this answer: Vote
nothisisthelongestwordbecauseithasthemostlettersinit

 

Answer by jared
Submitted on 5/16/2005
Rating: Not yet rated Rate this answer: Vote
smiles, there is a mile between the two s'. hahahahahahahahahahahahahaha. giddity giddity giddity

 

Answer by ij
Submitted on 5/17/2005
Rating: Not yet rated Rate this answer: Vote
cat-flap

 

Answer by Sean K
Submitted on 5/25/2005
Rating: Not yet rated Rate this answer: Vote
NORDÖSTERSJÖKUSTARTILLERIFLYGSPANINGSSIMULATORANLÄGG-(180)

 

Answer by bretttey
Submitted on 5/26/2005
Rating: Not yet rated Rate this answer: Vote
brettisthecoolestpersoninthewholeworldandheisbetterthenamywilleverbe

 

Answer by alex maglio
Submitted on 5/27/2005
Rating: Not yet rated Rate this answer: Vote
taco shell

 

Answer by vivian
Submitted on 6/3/2005
Rating: Not yet rated Rate this answer: Vote
ewsaytsgbdwusgrbvfiyrtfuiryygtrudtrytruytgerygyuyfefrfuyfgurtfuetfyutfruytgfruefuyt

 

Answer by green leprichaun
Submitted on 6/5/2005
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicrestrictionitisilicovolcanoconiosis

 

Answer by kcheee
Submitted on 6/5/2005
Rating: Not yet rated Rate this answer: Vote
supercallafragelisticexpealidoshis

 

Answer by Mike
Submitted on 6/8/2005
Rating: Not yet rated Rate this answer: Vote
chellemadoctioronasiangloederationsonabestinity

 

Answer by ken
Submitted on 6/11/2005
Rating: Not yet rated Rate this answer: Vote
methionylglutaminylarginyltyrosylglutamylserylleucylphenylalanyla lanylglutaminylleucyllysylglutamylarginyllysylglutamylglycylalany lphenylalanylvalylprolylphenylalanylvalylthreonylleucylglycylaspa rtylprolylglycylisoleucylglutamylglutaminylserylleucyllysylisoleu cylaspartylthreonylleucylisoleucylglutamylalanylglycylalanylaspar tylalanylleucylglutamylleucylglycylisoleucylprolylphenylalanylser ylaspartylprolylleucylalanylaspartylglycylprolylthreonyliso leucylglutaminylaspfraginylalanylthreonylleucylarginylalanylpheny lalanylalanylalanylglycylvalylthreonylprolylalanylglutaminylcyste inylphenylalanylglutamylmethionylleucylalanylleucylisoleucylargin ylglutaminyllysylhistidylprolylthreonylisoleucylprolylisoleucylgl ycylleucylleucylmethionyltyrosylalanylasparaginylleucylvalylpheny lalanylasparaginyllysylglycylisoleucylaspartylglutamylphenylalany ltyrosylalanylglutaminylcysteinylglutamyllysylvalylglycylva lylaspartylserylvalylleucylvalylalanylaspartylvalylprolylvalylglu taminylglutamylserylalanylprolylphenylalanylarginylglutaminylalan ylalanylleucylarginylhistidylasparaginylvalylalanylprolylisoleucy lphenylalanylisoleucylcysteinylprolylprolylaspartylalanylaspartyl aspartylaspartylleucylleucylarginylglutaminylisoleucylalanylseryl tyrosylglycylarginylglycyltyrosylthreonyltyrosylleucylleucylseryl arginylalanylglycylvalylthreonylglycylalanylglutamylasparag inylarginylalanylalanylleucylprolylleucylasparaginylhistidylleucy lvalylalanyllysylleucyllysylglutamyltyrosylasparaginylalanylalany lprolylprolylleucylglutaminylglycylphenylalanylglycylisoleucylser ylalanylprolylaspartylglutaminylvalyllysylalanylalanylisoleucylas partylalanylglycylalanylalanylglycylalanylisoleucylserylglycylser ylalanylisoleucylvalyllysylisoleucylisoleucylglutamylglutaminylhi stidylasparaginylisoleucylglutamylprolylglutamyllysylmethio nylleucylalanylalanylleucyllysylvalylphenylalanylvalylglutaminylp rolylmethion yllysylalanylalanylthreonylarginylserine


it means   tryptophan synthetase    

 

Answer by dj dj
Submitted on 6/14/2005
Rating: Not yet rated Rate this answer: Vote
sukmyballsbecausethisisthelongestwordanditislongerthantheotherwordthatsayssomethinglikethis

 

Answer by butthead
Submitted on 6/15/2005
Rating: Not yet rated Rate this answer: Vote
thebiggestwordeveristhisonehearbecauseihadtobesweetandbeatuallinthisthingysothisisthebiggestwordyeah

 

Answer by Luciano
Submitted on 6/17/2005
Rating: Not yet rated Rate this answer: Vote
heykarlthatwasreallyfunnythoughbutibetyoududelol

 

Answer by fuk yew
Submitted on 6/17/2005
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis





 

Answer by c-lab
Submitted on 6/19/2005
Rating: Not yet rated Rate this answer: Vote
Germans are better...

DONAUDAMPFSCHIFFAHRTSELEKTRIZITAETENHAUPTBETRIEBSWERKBAUUNTERBEAMTENGESELLSCHAFT

 

Answer by SUBBU BCA HYDERABAD(9346358727)
Submitted on 7/1/2005
Rating: Not yet rated Rate this answer: Vote
Honouraficabilititutanitanitinitadibus
And it's meaning is compassion

 

Answer by the purple munkee
Submitted on 7/2/2005
Rating: Not yet rated Rate this answer: Vote
floccinaucinihilipilification (unless we count scientific words, then its over 186,000 letters)

 

Answer by sola
Submitted on 7/15/2005
Rating: Not yet rated Rate this answer: Vote
thandiophoranetusmarliopantomoustitus

 

Answer by Tony
Submitted on 7/19/2005
Rating: Not yet rated Rate this answer: Vote
Floccinaucinihilipilification

 

Answer by jeff
Submitted on 7/20/2005
Rating: Not yet rated Rate this answer: Vote
PNEUMONO­ULTRA­MICRO­SCOPIC­SILICO­VOLCANO­CONIOSIS dumbasses

 

Answer by alex
Submitted on 7/27/2005
Rating: Not yet rated Rate this answer: Vote
gfplpogfbpohypjhpoopopdfbhnhlkfrlyjlvlnbkailrogpooloollfh is the biggest word

 

Answer by XeRr0
Submitted on 8/3/2005
Rating: Not yet rated Rate this answer: Vote
wow, these are big words

 

Answer by katie
Submitted on 8/3/2005
Rating: Not yet rated Rate this answer: Vote
qwertyisgayaphobianessiumoustimesfourty

 

Answer by Penis
Submitted on 8/5/2005
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by doyen
Submitted on 8/9/2005
Rating: Not yet rated Rate this answer: Vote
idunnowhatisthebiggestwordiguessillhavetoaskscientestsohwaitthisisthebiggestwordlol

 

Answer by Youareastupiddumbutt
Submitted on 8/28/2005
Rating: Not yet rated Rate this answer: Vote
pheumonultramicroscopicsilicovolcanoconiosis

 

Answer by Bear
Submitted on 9/1/2005
Rating: Not yet rated Rate this answer: Vote
Wazupthisisthebiggestwordevermadeupthatmakes-sence

 

Answer by mal
Submitted on 9/2/2005
Rating: Not yet rated Rate this answer: Vote
floccinaucinihilipilification

 

Answer by mate
Submitted on 9/4/2005
Rating: Not yet rated Rate this answer: Vote
phenomonialtryclopiclefortyalosis

 

Answer by smartie pantz
Submitted on 9/6/2005
Rating: Not yet rated Rate this answer: Vote
abbveygonnawarnadanna

 

Answer by idontcare
Submitted on 9/7/2005
Rating: Not yet rated Rate this answer: Vote
thisisthebyfarlongestwordwithoutadouptcauseithassomanylettersinitbeatthat

 

Answer by Philip
Submitted on 9/13/2005
Rating: Not yet rated Rate this answer: Vote
ghidmfhgkcic,fjcmgjiduvkufkfudkifkdicifugdu8gfiuifufduf8ufduisis

 

Answer by Milky
Submitted on 9/16/2005
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconioses

 

Answer by asdasd
Submitted on 9/20/2005
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by archie
Submitted on 9/20/2005
Rating: Not yet rated Rate this answer: Vote
howthehellshouldIknowwhattheansweris

 

Answer by dazza
Submitted on 9/21/2005
Rating: Not yet rated Rate this answer: Vote
nothisisthelongestwordcuzithasmorelettersthanyours

 

Answer by Darin
Submitted on 9/21/2005
Rating: Not yet rated Rate this answer: Vote
chiccACIC

 

Answer by someone
Submitted on 9/21/2005
Rating: Not yet rated Rate this answer: Vote
biiiiiiiiiiiiiiiiiiigggggggggggggggeeeeeeeeeeeeeeeeeeeeeessssssssssssssssssssssssttttttttttttttttttttttwwwwwwwoooooooooooorrrrrrrrrrrrrrrrrrrrrrrdddddddddddddddddddddddddddddddddddddddd

 

Answer by Thedudewhowrotethis
Submitted on 9/22/2005
Rating: Not yet rated Rate this answer: Vote
ACETYL­SERYL­TYROSYL­SERYL­ISO­LEUCYL­THREONYL­SERYL­PROLYL­SERYL­GLUTAMINYL­PHENYL­ALANYL­VALYL­PHENYL­ALANYL­LEUCYL­SERYL­SERYL­VALYL­TRYPTOPHYL­ALANYL­ASPARTYL­PROLYL­ISOLEUCYL­GLUTAMYL­LEUCYL­LEUCYL­ASPARAGINYL­VALYL­CYSTEINYL­THREONYL­SERYL­SERYL­LEUCYL­GLYCYL­ASPARAGINYL­GLUTAMINYL­PHENYL­ALANYL­GLUTAMINYL­THREONYL­GLUTAMINYL­GLUTAMINYL­ALANYL­ARGINYL­THREONYL­THREONYL­GLUTAMINYL­VALYL­GLUTAMINYL­GLUTAMINYL­PHENYL­ALANYL­SERYL­GLUTAMINYL­VALYL­TRYPTOPHYL­LYSYL­PROLYL­PHENYL­ALANYL­PROLYL­GLUTAMINYL­SERYL­THREONYL­VALYL­ARGINYL­PHENYL­ALANYL­PROLYL­GLYCYL­ASPARTYL­VALYL­TYROSYL­LYSYL­VALYL­TYROSYL­ARGINYL­TYROSYL­ASPARAGINYL­ALANYL­VALYL­LEUCYL­ASPARTYL­PROLYL­LEUCYL­ISOLEUCYL­THREONYL­ALANYL­LEUCYL­LEUCYL­GLYCYL­THREONYL­PHENYL­ALANYL­ASPARTYL­THREONYL­ARGINYL­ASPARAGINYL­ARGINYL­ISOLEUCYL­ISOLEUCYL­GLUTAMYL­VALYL­GLUTAMYL­ASPARAGINYL­GLUTAMINYL­GLUTAMINYL­SERYL­PROLYL­THREONYL­THREONYL­ALANYL­GLUTAMYL­THREONYL­LEUCYL­ASPARTYL­ALANYL­THREONYL­ARGINYL­ARGINYL­VALYL­ASPARTYL­ASPARTYL­ALANYL­THREONYL­VALYL­ALANYL­ISOLEUCYL­ARGINYL­SERYL­ALANYL­ASPARAGINYL­ISOLEUCYL­ASPARAGINYL­LEUCYL­VALYL­ASPARAGINYL­GLUTAMYL­LEUCYL­VALYL­ARGINYL­GLYCYL­THREONYL­GLYCYL­LEUCYL­TYROSYL­ASPARAGINYL­GLUTAMINYL­ASPARAGINYL­THREONYL­PHENYL­ALANYL­GLUTAMYL­SERYL­METHIONYL­SERYL­GLYCYL­LEUCYL­VALYL­TRYPTOPHYL­THREONYL­SERYL­ALANYL­PROLYL­ALANYL­SERINE. it's a chemical compound found in a tobacco disease.

 

Answer by Jak
Submitted on 9/26/2005
Rating: Not yet rated Rate this answer: Vote
nothisisthebiggestmostgreatestmostbestestwordintheworldhomie

 

Answer by Bob
Submitted on 10/6/2005
Rating: Not yet rated Rate this answer: Vote
no. it's ACETYL­SERYL­TYROSYL­SERYL­ISO­LEUCYL­THREONYL­SERYL­PROLYL­SERYL­GLUTAMINYL­PHENYL­ALANYL­VALYL­PHENYL­ALANYL­LEUCYL­SERYL­SERYL­VALYL­TRYPTOPHYL­ALANYL­ASPARTYL­PROLYL­ISOLEUCYL­GLUTAMYL­LEUCYL­LEUCYL­ASPARAGINYL­VALYL­CYSTEINYL­THREONYL­SERYL­SERYL­LEUCYL­GLYCYL­ASPARAGINYL­GLUTAMINYL­PHENYL­ALANYL­GLUTAMINYL­THREONYL­GLUTAMINYL­GLUTAMINYL­ALANYL­ARGINYL­THREONYL­THREONYL­GLUTAMINYL­VALYL­GLUTAMINYL­GLUTAMINYL­PHENYL­ALANYL­SERYL­GLUTAMINYL­VALYL­TRYPTOPHYL­LYSYL­PROLYL­PHENYL­ALANYL­PROLYL­GLUTAMINYL­SERYL­THREONYL­VALYL­ARGINYL­PHENYL­ALANYL­PROLYL­GLYCYL­ASPARTYL­VALYL­TYROSYL­LYSYL­VALYL­TYROSYL­ARGINYL­TYROSYL­ASPARAGINYL­ALANYL­VALYL­LEUCYL­ASPARTYL­PROLYL­LEUCYL­ISOLEUCYL­THREONYL­ALANYL­LEUCYL­LEUCYL­GLYCYL­THREONYL­PHENYL­ALANYL­ASPARTYL­THREONYL­ARGINYL­ASPARAGINYL­ARGINYL­ISOLEUCYL­ISOLEUCYL­GLUTAMYL­VALYL­GLUTAMYL­ASPARAGINYL­GLUTAMINYL­GLUTAMINYL­SERYL­PROLYL­THREONYL­THREONYL­ALANYL­GLUTAMYL­THREONYL­LEUCYL­ASPARTYL­ALANYL­THREONYL­ARGINYL­ARGINYL­VALYL­ASPARTYL­ASPARTYL­ALANYL­THREONYL­VALYL­ALANYL­ISOLEUCYL­ARGINYL­SERYL­ALANYL­ASPARAGINYL­ISOLEUCYL­ASPARAGINYL­LEUCYL­VALYL­ASPARAGINYL­GLUTAMYL­LEUCYL­VALYL­ARGINYL­GLYCYL­THREONYL­GLYCYL­LEUCYL­TYROSYL­ASPARAGINYL­GLUTAMINYL­ASPARAGINYL­THREONYL­PHENYL­ALANYL­GLUTAMYL­SERYL­METHIONYL­SERYL­GLYCYL­LEUCYL­VALYL­TRYPTOPHYL­THREONYL­SERYL­ALANYL­PROLYL­ALANYL­SERINE.

it has 1000 something letters in it. but I'm pretty sure there is another word with 3000 something letters in it.

 

Answer by Beans
Submitted on 10/8/2005
Rating: Not yet rated Rate this answer: Vote
lameniscussidunderthroughtbiomicskwilum

 

Answer by rob
Submitted on 10/11/2005
Rating: Not yet rated Rate this answer: Vote
floccinaucinihilipilification

 

Answer by Harry
Submitted on 10/12/2005
Rating: Not yet rated Rate this answer: Vote
actuallianniaismaniyatarentiwerkansifdaiamism

 

Answer by laura
Submitted on 10/26/2005
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanociniosis

 

Answer by Behold the truth
Submitted on 10/27/2005
Rating: Not yet rated Rate this answer: Vote
anticonstitutionismonkisadaptimocoscopiciallism

 

Answer by pikachu
Submitted on 10/27/2005
Rating: Not yet rated Rate this answer: Vote
I think it is pneumonoultramicroscopicsilicovolcanokoniosis because I read it from a book.  It's on the internet also.

 

Answer by sgtjaws
Submitted on 10/28/2005
Rating: Not yet rated Rate this answer: Vote
1,185 letters long:

ACETYL­SERYL­TYROSYL­SERYL­ISO­LEUCYL­THREONYL­SERYL­PROLYL­SERYL­GLUTAMINYL­PHENYL­ALANYL­VALYL­PHENYL­ALANYL­LEUCYL­SERYL­SERYL­VALYL­TRYPTOPHYL­ALANYL­ASPARTYL­PROLYL­ISOLEUCYL­GLUTAMYL­LEUCYL­LEUCYL­ASPARAGINYL­VALYL­CYSTEINYL­THREONYL­SERYL­SERYL­LEUCYL­GLYCYL­ASPARAGINYL­GLUTAMINYL­PHENYL­ALANYL­GLUTAMINYL­THREONYL­GLUTAMINYL­GLUTAMINYL­ALANYL­ARGINYL­THREONYL­THREONYL­GLUTAMINYL­VALYL­GLUTAMINYL­GLUTAMINYL­PHENYL­ALANYL­SERYL­GLUTAMINYL­VALYL­TRYPTOPHYL­LYSYL­PROLYL­PHENYL­ALANYL­PROLYL­GLUTAMINYL­SERYL­THREONYL­VALYL­ARGINYL­PHENYL­ALANYL­PROLYL­GLYCYL­ASPARTYL­VALYL­TYROSYL­LYSYL­VALYL­TYROSYL­ARGINYL­TYROSYL­ASPARAGINYL­ALANYL­VALYL­LEUCYL­ASPARTYL­PROLYL­LEUCYL­ISOLEUCYL­THREONYL­ALANYL­LEUCYL­LEUCYL­GLYCYL­THREONYL­PHENYL­ALANYL­ASPARTYL­THREONYL­ARGINYL­ASPARAGINYL­ARGINYL­ISOLEUCYL­ISOLEUCYL­GLUTAMYL­VALYL­GLUTAMYL­ASPARAGINYL­GLUTAMINYL­GLUTAMINYL­SERYL­PROLYL­THREONYL­THREONYL­ALANYL­GLUTAMYL­THREONYL­LEUCYL­ASPARTYL­ALANYL­THREONYL­ARGINYL­ARGINYL­VALYL­ASPARTYL­ASPARTYL­ALANYL­THREONYL­VALYL­ALANYL­ISOLEUCYL­ARGINYL­SERYL­ALANYL­ASPARAGINYL­ISOLEUCYL­ASPARAGINYL­LEUCYL­VALYL­ASPARAGINYL­GLUTAMYL­LEUCYL­VALYL­ARGINYL­GLYCYL­THREONYL­GLYCYL­LEUCYL­TYROSYL­ASPARAGINYL­GLUTAMINYL­ASPARAGINYL­THREONYL­PHENYL­ALANYL­GLUTAMYL­SERYL­METHIONYL­SERYL­GLYCYL­LEUCYL­VALYL­TRYPTOPHYL­THREONYL­SERYL­ALANYL­PROLYL­ALANYL­SERINE

= Tobacco Mosaic Virus, Dahlemense Strain.
i belive to be the longest real word

 

Answer by XxCrimsonShadowsxX
Submitted on 11/8/2005
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilivolcanoconiosis

 

Answer by Me
Submitted on 11/10/2005
Rating: Not yet rated Rate this answer: Vote
Floccinaucinihilipilificationarianismic

 

Answer by rag
Submitted on 11/10/2005
Rating: Not yet rated Rate this answer: Vote
methionylglutaminylarginyltyrosylglutamylserylleucylphenylalanyla lanylglutaminylleucyllysylglutamylarginyllysylglutamylglycylalany lphenylalanylvalylprolylphenylalanylvalylthreonylleucylglycylaspa rtylprolylglycylisoleucylglutamylglutaminylserylleucyllysylisoleu cylaspartylthreonylleucylisoleucylglutamylalanylglycylalanylaspar tylalanylleucylglutamylleucylglycylisoleucylprolylphenylalanylser ylaspartylprolylleucylalanylaspartylglycylprolylthreonyliso leucylglutaminylaspfraginylalanylthreonylleucylarginylalanylpheny lalanylalanylalanylglycylvalylthreonylprolylalanylglutaminylcyste inylphenylalanylglutamylmethionylleucylalanylleucylisoleucylargin ylglutaminyllysylhistidylprolylthreonylisoleucylprolylisoleucylgl ycylleucylleucylmethionyltyrosylalanylasparaginylleucylvalylpheny lalanylasparaginyllysylglycylisoleucylaspartylglutamylphenylalany ltyrosylalanylglutaminylcysteinylglutamyllysylvalylglycylva lylaspartylserylvalylleucylvalylalanylaspartylvalylprolylvalylglu taminylglutamylserylalanylprolylphenylalanylarginylglutaminylalan ylalanylleucylarginylhistidylasparaginylvalylalanylprolylisoleucy lphenylalanylisoleucylcysteinylprolylprolylaspartylalanylaspartyl aspartylaspartylleucylleucylarginylglutaminylisoleucylalanylseryl tyrosylglycylarginylglycyltyrosylthreonyltyrosylleucylleucylseryl arginylalanylglycylvalylthreonylglycylalanylglutamylasparag inylarginylalanylalanylleucylprolylleucylasparaginylhistidylleucy lvalylalanyllysylleucyllysylglutamyltyrosylasparaginylalanylalany lprolylprolylleucylglutaminylglycylphenylalanylglycylisoleucylser ylalanylprolylaspartylglutaminylvalyllysylalanylalanylisoleucylas partylalanylglycylalanylalanylglycylalanylisoleucylserylglycylser ylalanylisoleucylvalyllysylisoleucylisoleucylglutamylglutaminylhi stidylasparaginylisoleucylglutamylprolylglutamyllysylmethio nylleucylalanylalanylleucyllysylvalylphenylalanylvalylglutaminylp rolylmethion yllysylalanylalanylthreonylarginylserine.


 

Answer by runamucker's girl
Submitted on 11/16/2005
Rating: Not yet rated Rate this answer: Vote
ifyoureallycarethatmuchyoumustbeprettyspecial

 

Answer by yo
Submitted on 11/16/2005
Rating: Not yet rated Rate this answer: Vote
My answer is....
iamcoolyeayeayeabecauseithoughtofthisawesomelongwordanditisthelongestwordever !!!!!!

 

Answer by eater of c                      o                        c                        k
Submitted on 11/17/2005
Rating: Not yet rated Rate this answer: Vote
Psychoalphadiscobetabioaquadoloop

 

Answer by Bob
Submitted on 11/20/2005
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by bonar
Submitted on 11/21/2005
Rating: Not yet rated Rate this answer: Vote
yousuckosicloptymononucleonicacidicallycolcaniconariadysfuctioniptical

 

Answer by obie trice
Submitted on 11/21/2005
Rating: Not yet rated Rate this answer: Vote
it actually is   ACETYL­SERYL­TYROSYL­SERYL­ISO­LEUCYL­THREONYL­SERYL­PROLYL­SERYL­GLUTAMINYL­PHENYL­ALANYL­VALYL­PHENYL­ALANYL­LEUCYL­SERYL­SERYL­VALYL­TRYPTOPHYL­ALANYL­ASPARTYL­PROLYL­ISOLEUCYL­GLUTAMYL­LEUCYL­LEUCYL­ASPARAGINYL­VALYL­CYSTEINYL­THREONYL­SERYL­SERYL­LEUCYL­GLYCYL­ASPARAGINYL­GLUTAMINYL­PHENYL­ALANYL­GLUTAMINYL­THREONYL­GLUTAMINYL­GLUTAMINYL­ALANYL­ARGINYL­THREONYL­THREONYL­GLUTAMINYL­VALYL­GLUTAMINYL­GLUTAMINYL­PHENYL­ALANYL­SERYL­GLUTAMINYL­VALYL­TRYPTOPHYL­LYSYL­PROLYL­PHENYL­ALANYL­PROLYL­GLUTAMINYL­SERYL­THREONYL­VALYL­ARGINYL­PHENYL­ALANYL­PROLYL­GLYCYL­ASPARTYL­VALYL­TYROSYL­LYSYL­VALYL­TYROSYL­ARGINYL­TYROSYL­ASPARAGINYL­ALANYL­VALYL­LEUCYL­ASPARTYL­PROLYL­LEUCYL­ISOLEUCYL­THREONYL­ALANYL­LEUCYL­LEUCYL­GLYCYL­THREONYL­PHENYL­ALANYL­ASPARTYL­THREONYL­ARGINYL­ASPARAGINYL­ARGINYL­ISOLEUCYL­ISOLEUCYL­GLUTAMYL­VALYL­GLUTAMYL­ASPARAGINYL­GLUTAMINYL­GLUTAMINYL­SERYL­PROLYL­THREONYL­THREONYL­ALANYL­GLUTAMYL­THREONYL­LEUCYL­ASPARTYL­ALANYL­THREONYL­ARGINYL­ARGINYL­VALYL­ASPARTYL­ASPARTYL­ALANYL­THREONYL­VALYL­ALANYL­ISOLEUCYL­ARGINYL­SERYL­ALANYL­ASPARAGINYL­ISOLEUCYL­ASPARAGINYL­LEUCYL­VALYL­ASPARAGINYL­GLUTAMYL­LEUCYL­VALYL­ARGINYL­GLYCYL­THREONYL­GLYCYL­LEUCYL­TYROSYL­ASPARAGINYL­GLUTAMINYL­ASPARAGINYL­THREONYL­PHENYL­ALANYL­GLUTAMYL­SERYL­METHIONYL­SERYL­GLYCYL­LEUCYL­VALYL­TRYPTOPHYL­THREONYL­SERYL­ALANYL­PROLYL­ALANYL­SERINE

 

Answer by eat mor chickn 49
Submitted on 11/21/2005
Rating: Not yet rated Rate this answer: Vote
antipneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by Cincanatee
Submitted on 11/25/2005
Rating: Not yet rated Rate this answer: Vote
Supercallafrashtilistic-expealla-doshish

 

Answer by zakk
Submitted on 11/25/2005
Rating: Not yet rated Rate this answer: Vote
smiles

 

Answer by montygirl
Submitted on 11/29/2005
Rating: Not yet rated Rate this answer: Vote
zaticavisterrialmotioncalfadoratarablishmentarisofinish

 

Answer by the king of spelling
Submitted on 11/30/2005
Rating: Not yet rated Rate this answer: Vote
allofyouarewrongthisisthelongestwordeverknowntomanbecauseithasthemostletersinit.

 

Answer by PhoenixLH
Submitted on 11/30/2005
Rating: Not yet rated Rate this answer: Vote
check out this sight, this is where I got teh answer
http://users.tkk.fi/~jpakkane/sana.html

kyyhkyslakkahillotaatelipalmusunnuntaikävelykatujuhla-
koristehedelmäkaramellimassatuotevalvontalaitteisto-
testauslaboratoriokäyttökertatulitikkuviinapiilohomo-
kaasulasersädehoitokotikaljakimblemestaruussarjakuva-
ristikkokilpajuoksuhiekka-aavikkoluonto-ohjelmauusinta-
vaalikokousedustusmeno-paluuruuhkabussivuoropysäköinti-
sakkolihakoukkuselkänahkavyöruusukasvimaamunajuustomaito-
rasvaimunestepinta-alahuulipunakampelaverkkomahalasku-
harjoituskrapula-aamukampapellavaöljykriisiapukeinolonkkalepo-
lomarusketusrajatietoteollisuuskiinteistömarkkinointi-
diplomi-insinööriopiskelijaperinnemaisema-arkkitehti-
kilta-aktiivihiiliteräsbetonivalurautaristisiitoshärkä-
pizzamaustevoipaperiroskapostimerkkisavusaunavastaprotesti-
marssivapautusliikevaihtoväliarvojoukkopakomatkaopas-
koirakantakorttitaikatalvisotakunniajäsenetupuolikuiva-
rehuvilja-aittakorpisuomaastohiihtoputkitiivistesilikoni-
rintataskuvaraslähtöliukumiinakenttäkeitinvesihanasaari-
ryhmätyömyyrävuosikurssikirjapainopistetulotukivarsikenkä-
kauppaopistoupseerikerhohuonepalveluammattikoulupoika-
tyttöenergiatalousaluelaajennustarvehierarkiakaavio-
suunnittelupäätöspäivävientisulkuporttiteoriapohjakunto-
urheiluruutuässäpariluistelutyylituomaripelimies-
voimisteluvideokulmakarvakuonokoppalakkipäämääräalennus-
tilataksimittarimatopurkkikeittoastiakaappipakastin-
yhdistelmälukkoseppähenkilötunnussanaleikkikalupakkipussi-
eläinkoeponnistuslautakuntalakitekstiseikkailuleiri-
telttakangaspuujalkasienipiirakkareseptivihkopakkaus-
muovikuularuiskumaalaustarvikevarastohyllymetrilakuavain-
naulakkovartiopäällikkötasogeometriavirhevaihtosähkökazoo-
pillihousupukupellehyppylankakeräkaaliaivovuotosuoja-
vaatekappalemyyntitykkilavatanssiaskelmoottoripyörä-
koppisiemenperunapalstajakoviivaintegraalioperaattori-
algebraoppilaitoskompleksilukusuoraveto-oikeusmurha-
asevarikkopilttuu


 

Answer by schmidty
Submitted on 12/1/2005
Rating: Not yet rated Rate this answer: Vote
Flaucinaucihillifillipacationism

 

Answer by chicken
Submitted on 12/5/2005
Rating: Not yet rated Rate this answer: Vote
pharokenorawerophmnuyornoweenesisism

 

Answer by Sensae
Submitted on 12/5/2005
Rating: Not yet rated Rate this answer: Vote
ACETYL­SERYL­TYROSYL­SERYL­ISO­LEUCYL­THREONYL­SERYL­PROLYL­SERYL­GLUTAMINYL­PHENYL­ALANYL­VALYL­PHENYL­ALANYL­LEUCYL­SERYL­SERYL­VALYL­TRYPTOPHYL­ALANYL­ASPARTYL­PROLYL­ISOLEUCYL­GLUTAMYL­LEUCYL­LEUCYL­ASPARAGINYL­VALYL­CYSTEINYL­THREONYL­SERYL­SERYL­LEUCYL­GLYCYL­ASPARAGINYL­GLUTAMINYL­PHENYL­ALANYL­GLUTAMINYL­THREONYL­GLUTAMINYL­GLUTAMINYL­ALANYL­ARGINYL­THREONYL­THREONYL­GLUTAMINYL­VALYL­GLUTAMINYL­GLUTAMINYL­PHENYL­ALANYL­SERYL­GLUTAMINYL­VALYL­TRYPTOPHYL­LYSYL­PROLYL­PHENYL­ALANYL­PROLYL­GLUTAMINYL­SERYL­THREONYL­VALYL­ARGINYL­PHENYL­ALANYL­PROLYL­GLYCYL­ASPARTYL­VALYL­TYROSYL­LYSYL­VALYL­TYROSYL­ARGINYL­TYROSYL­ASPARAGINYL­ALANYL­VALYL­LEUCYL­ASPARTYL­PROLYL­LEUCYL­ISOLEUCYL­THREONYL­ALANYL­LEUCYL­LEUCYL­GLYCYL­THREONYL­PHENYL­ALANYL­ASPARTYL­THREONYL­ARGINYL­ASPARAGINYL­ARGINYL­ISOLEUCYL­ISOLEUCYL­GLUTAMYL­VALYL­GLUTAMYL­ASPARAGINYL­GLUTAMINYL­GLUTAMINYL­SERYL­PROLYL­THREONYL­THREONYL­ALANYL­GLUTAMYL­THREONYL­LEUCYL­ASPARTYL­ALANYL­THREONYL­ARGINYL­ARGINYL­VALYL­ASPARTYL­ASPARTYL­ALANYL­THREONYL­VALYL­ALANYL­ISOLEUCYL­ARGINYL­SERYL­ALANYL­ASPARAGINYL­ISOLEUCYL­ASPARAGINYL­LEUCYL­VALYL­ASPARAGINYL­GLUTAMYL­LEUCYL­VALYL­ARGINYL­GLYCYL­THREONYL­GLYCYL­LEUCYL­TYROSYL­ASPARAGINYL­GLUTAMINYL­ASPARAGINYL­THREONYL­PHENYL­ALANYL­GLUTAMYL­SERYL­METHIONYL­SERYL­GLYCYL­LEUCYL­VALYL­TRYPTOPHYL­THREONYL­SERYL­ALANYL­PROLYL­ALANYL­SERINE

 

Answer by Sensae
Submitted on 12/5/2005
Rating: Not yet rated Rate this answer: Vote
ACETYL­SERYL­TYROSYL­SERYL­ISO­LEUCYL­THREONYL­SERYL­PROLYL­SERYL­GLUTAMINYL­PHENYL­ALANYL­VALYL­PHENYL­ALANYL­LEUCYL­SERYL­SERYL­VALYL­TRYPTOPHYL­ALANYL­ASPARTYL­PROLYL­ISOLEUCYL­GLUTAMYL­LEUCYL­LEUCYL­ASPARAGINYL­VALYL­CYSTEINYL­THREONYL­SERYL­SERYL­LEUCYL­GLYCYL­ASPARAGINYL­GLUTAMINYL­PHENYL­ALANYL­GLUTAMINYL­THREONYL­GLUTAMINYL­GLUTAMINYL­ALANYL­ARGINYL­THREONYL­THREONYL­GLUTAMINYL­VALYL­GLUTAMINYL­GLUTAMINYL­PHENYL­ALANYL­SERYL­GLUTAMINYL­VALYL­TRYPTOPHYL­LYSYL­PROLYL­PHENYL­ALANYL­PROLYL­GLUTAMINYL­SERYL­THREONYL­VALYL­ARGINYL­PHENYL­ALANYL­PROLYL­GLYCYL­ASPARTYL­VALYL­TYROSYL­LYSYL­VALYL­TYROSYL­ARGINYL­TYROSYL­ASPARAGINYL­ALANYL­VALYL­LEUCYL­ASPARTYL­PROLYL­LEUCYL­ISOLEUCYL­THREONYL­ALANYL­LEUCYL­LEUCYL­GLYCYL­THREONYL­PHENYL­ALANYL­ASPARTYL­THREONYL­ARGINYL­ASPARAGINYL­ARGINYL­ISOLEUCYL­ISOLEUCYL­GLUTAMYL­VALYL­GLUTAMYL­ASPARAGINYL­GLUTAMINYL­GLUTAMINYL­SERYL­PROLYL­THREONYL­THREONYL­ALANYL­GLUTAMYL­THREONYL­LEUCYL­ASPARTYL­ALANYL­THREONYL­ARGINYL­ARGINYL­VALYL­ASPARTYL­ASPARTYL­ALANYL­THREONYL­VALYL­ALANYL­ISOLEUCYL­ARGINYL­SERYL­ALANYL­ASPARAGINYL­ISOLEUCYL­ASPARAGINYL­LEUCYL­VALYL­ASPARAGINYL­GLUTAMYL­LEUCYL­VALYL­ARGINYL­GLYCYL­THREONYL­GLYCYL­LEUCYL­TYROSYL­ASPARAGINYL­GLUTAMINYL­ASPARAGINYL­THREONYL­PHENYL­ALANYL­GLUTAMYL­SERYL­METHIONYL­SERYL­GLYCYL­LEUCYL­VALYL­TRYPTOPHYL­THREONYL­SERYL­ALANYL­PROLYL­ALANYL­SERINE. Yes this is a real word. Look it up.

 

Answer by jessjess
Submitted on 12/6/2005
Rating: Not yet rated Rate this answer: Vote
assibalidosiousnosionsunballious
assesallidoseousness

 

Answer by Christina
Submitted on 12/9/2005
Rating: Not yet rated Rate this answer: Vote
Methionygluaminylarginyltyrosylgltamylserylleucylphenylalanylalanylglutaminylleucyllysylglutamy

 

Answer by The Heat
Submitted on 12/11/2005
Rating: Not yet rated Rate this answer: Vote
Your all stupid the longest word is google.
just type in a simple word and it will show you goooooooooooooooooooooooooooooooooooooooogle Shutup stupids!!!

 

Answer by The Heat
Submitted on 12/11/2005
Rating: Not yet rated Rate this answer: Vote
Your all stupid the longest word is google.
just type in a simple word and it will show you goooooooooooooooooooooooooooooooooooooooogle Shutup stupids!!!

 

Answer by fezz
Submitted on 12/12/2005
Rating: Not yet rated Rate this answer: Vote
hydrochlorofluorocarbons

 

Answer by SPARROW
Submitted on 12/16/2005
Rating: Not yet rated Rate this answer: Vote
Supercalifragalisticexpealidocious

 

Answer by alvin
Submitted on 12/19/2005
Rating: Not yet rated Rate this answer: Vote
this is word in india

pooduckaleanekelem

 

Answer by Unknown
Submitted on 12/20/2005
Rating: Not yet rated Rate this answer: Vote
ihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbeihavenocluewhatthelongestwordisbutifihadtomakeaguesswhichiwouldnotitwouldbesmile

 

Answer by Captain Skippy
Submitted on 12/23/2005
Rating: Not yet rated Rate this answer: Vote
Ilikeyourmom'sflouralprintpantiesverymuchsothatibecameyourdaddy

 

Answer by jonny
Submitted on 12/23/2005
Rating: Not yet rated Rate this answer: Vote
ithinkthateverybodysworssucksbecauseimamthebesttherewilleverbe

 

Answer by AAKASH CHUGH
Submitted on 12/26/2005
Rating: Not yet rated Rate this answer: Vote
AFTERACATRACTS

 

Answer by aakash ckugh
Submitted on 12/28/2005
Rating: Not yet rated Rate this answer: Vote
marryisaverygoodgirlbecausesheisworkingveryhard

 

Answer by Bobby
Submitted on 12/29/2005
Rating: Not yet rated Rate this answer: Vote
supercalifragilisticexpialidocious

 

Answer by BLAKE
Submitted on 1/4/2006
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosisism

 

Answer by bob
Submitted on 1/5/2006
Rating: Not yet rated Rate this answer: Vote
cheese

 

Answer by garrett
Submitted on 1/5/2006
Rating: Not yet rated Rate this answer: Vote
xlcbhne;;alkgj;aldsgha;kghlkghlakghlkaejghlkasghaklshgalkghlhdgalkjg

 

Answer by KillerPooMuffin
Submitted on 1/7/2006
Rating: Not yet rated Rate this answer: Vote
SuperDuperPooperScooper

 

Answer by Bryan
Submitted on 1/8/2006
Rating: Not yet rated Rate this answer: Vote
thishasgottobethebiggestwordbecauseitgoesonandonandonandonandonandonandonandonandthatswhyitsthelongestwordintheenglishlanguage

 

Answer by nathan
Submitted on 1/9/2006
Rating: Not yet rated Rate this answer: Vote
gayttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttpppppppppppppppppppppppppptttlttttttttttttttttttt,l,tallest,tit;jy;ttt[op,kto,topt,opt,op,op,kinkily76djhf5e4w546fr543we456gt65e 4 556tyv buggered66

 

Answer by joessssss
Submitted on 1/9/2006
Rating: Not yet rated Rate this answer: Vote
antiundidastinguishantiment

 

Answer by raye raye
Submitted on 1/10/2006
Rating: Not yet rated Rate this answer: Vote
that is a word but how do you really say that call me at 695-1039 or 521-4788

 

Answer by J.V. Borres
Submitted on 1/14/2006
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by jkl495
Submitted on 1/15/2006
Rating: Not yet rated Rate this answer: Vote
floccinaucinihilipilificationiousnessesingarwquertipoofis

 

Answer by tiff
Submitted on 1/16/2006
Rating: Not yet rated Rate this answer: Vote
tasketfulbyosnoiomaniumismiphulimpismphyluminoniaum

 

Answer by ace
Submitted on 1/16/2006
Rating: Not yet rated Rate this answer: Vote
ur mom

 

Answer by hi
Submitted on 1/17/2006
Rating: Not yet rated Rate this answer: Vote
supercaliflegalestispicious ledicious

 

Answer by joe
Submitted on 1/19/2006
Rating: Not yet rated Rate this answer: Vote
supercalifrgilisticexpialidocious

 

Answer by joe
Submitted on 1/19/2006
Rating: Not yet rated Rate this answer: Vote
supercalifragilisticexpialidocious

 

Answer by mereaves
Submitted on 1/24/2006
Rating: Not yet rated Rate this answer: Vote
I think y'all are the reason they put spell check on here, lol

 

Answer by JOE
Submitted on 1/27/2006
Rating: Not yet rated Rate this answer: Vote
Pneumonoultramicroscopicsilicovolcanokoniosis

 

Answer by deionte
Submitted on 2/2/2006
Rating: Not yet rated Rate this answer: Vote
thisisthebiggestwordbecauseithaswaymorelettersthananyotherwordsinthewholeintireworldlol

 

Answer by deionte
Submitted on 2/2/2006
Rating: Not yet rated Rate this answer: Vote
thisisthebiggestwordbecauseithaswaymorelettersthananyotherwordsinthewholeintireworldlolanditisverylongandwillnotstophavinglettersinitbecauseitismeanttobethebiggestwordintheworldanditwillnotstopgrowingbecauseifeeditwaterandcooladeandsunlightandwillnotstopgrowingjustlikejackandthebeanstockandhowhesavedthegoldenharpandatecheeseandmilkandthengotthegolenharpoutbutnowheschoppingthebeanstalkdownsothewordhastostop

 

Answer by Eman
Submitted on 2/9/2006
Rating: Not yet rated Rate this answer: Vote
supercalafagalesitickxbeowladoshist

 

Answer by jorge
Submitted on 2/14/2006
Rating: Not yet rated Rate this answer: Vote
ihavethelongestwordandyoucantdoanythingaboutit

 

Answer by moose
Submitted on 2/16/2006
Rating: Not yet rated Rate this answer: Vote
moooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

 

Answer by winmall
Submitted on 2/16/2006
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by KirHay
Submitted on 2/18/2006
Rating: Not yet rated Rate this answer: Vote
supercalifraglelistixspaladocious

 

Answer by smart guy
Submitted on 2/20/2006
Rating: Not yet rated Rate this answer: Vote
DIMETHYL­AMIDO­PHENYL­DIMETHYL­PYRAZOLONE

 

Answer by jomamalastnight
Submitted on 2/21/2006
Rating: Not yet rated Rate this answer: Vote
thisistehlongesthwordfoshizzcuzdoggehfizzlesaidithedsoandthereforeitissosuckonit

 

Answer by .. damn
Submitted on 2/21/2006
Rating: Not yet rated Rate this answer: Vote
Pronounciation please?

 

Answer by   ggggggggggggggggggggggg                  4ewwwwwwvgt
Submitted on 2/22/2006
Rating: Not yet rated Rate this answer: Vote
aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaggggggggggggggggggjjjjjuyyyyyyyyyyyyyyyyyyyyyyyyorweeeeeeerejfhdsgh;fdlgjlfmb,.mfdlgkreoti!@#$%^&**********554456++++++/87+9-67.m6666

 

Answer by jakjak10
Submitted on 2/27/2006
Rating: Not yet rated Rate this answer: Vote
Pneumonoultramicroscopicsilicovolcanokoniosis

 

Answer by Korey
Submitted on 2/27/2006
Rating: Not yet rated Rate this answer: Vote
exotrinominalimakularfundamenprobitationationbilicularism

 

Answer by sweetlou
Submitted on 3/3/2006
Rating: Not yet rated Rate this answer: Vote
me

 

Answer by zack r
Submitted on 3/3/2006
Rating: Not yet rated Rate this answer: Vote
hydrapolycalapticdisconillyousinuous

 

Answer by zack r
Submitted on 3/3/2006
Rating: Not yet rated Rate this answer: Vote
hydrapolycalapticdisconillyousinuous

 

Answer by cool
Submitted on 3/6/2006
Rating: Not yet rated Rate this answer: Vote
askdjbvgaksdvklaertjsdbvadlgtuasdvjkbaldgtaljkdsblasdghtjabsdgliashudcvasdbhtl;uiahsdb.hucvasukdgcbsdakseluasbdlcvhjuasg.jkgtaj,ghydgcjyaegf,ajsdyj,csdygcldbfasenmhbfaysdcgbafacvkauhsdgasegfkuaysdgvcfyuasgfhasgefm,sdhkausydgfa,ehvasoerugtlayqetouigydefuioeortyuaduifbashdbvgtdbhlkagtaet89888888888888asjkdlbvjsdkgjsdvhjasdjbhvkjasghefkaeyfkashegfjkaegfkajdghfkdfjkaehgfuayegfkasdhcvhjaejasdjcvhajsdf

 

Answer by Evan Funk
Submitted on 3/7/2006
Rating: Not yet rated Rate this answer: Vote
tractoliousismetophosiphateroctemoliousatemversion.

 

Answer by podge
Submitted on 3/9/2006
Rating: Not yet rated Rate this answer: Vote
tyyyyyyyyyyyyyyyyyyyyyyyy

 

Answer by podge
Submitted on 3/9/2006
Rating: Not yet rated Rate this answer: Vote
wowthiswordisbigjustlookatallthelettersithasinitnowletsputsomemoreitin

 

Answer by zofo
Submitted on 3/9/2006
Rating: Not yet rated Rate this answer: Vote
led-zeppelin

 

Answer by scyberx
Submitted on 3/10/2006
Rating: Not yet rated Rate this answer: Vote
Hum...I don´t know what is the biggest english word, but the biggest brazilian-portuguese word is: "Pneumoutramicroscopiosilicovulcanoconiotico"
That u can see that word is a little bigger than the english word.

 

Answer by Gabriel
Submitted on 3/12/2006
Rating: Not yet rated Rate this answer: Vote
supercalifragilistiexpialidocious

 

Answer by Ano Nani?
Submitted on 3/13/2006
Rating: Not yet rated Rate this answer: Vote
Antidisestablishmentarianism

 

Answer by x_townmixdguy
Submitted on 3/13/2006
Rating: Not yet rated Rate this answer: Vote
supercalifragilisticexpioladocious

 

Answer by hghdghdjdf
Submitted on 3/14/2006
Rating: Not yet rated Rate this answer: Vote
djhppodlkecodflfjdsojfdkjcoifjdjgdojgksejiojcsjkjkoiejkjakljdpoasjekukasjdsapksdjpaerkjdfoijdfkjfaisogjkcjvibhajasghusagjahdogoihudafhposdalgjfhsuaovgbklfsaogihdrkjthrjhtoruefdl

 

Answer by poly
Submitted on 3/14/2006
Rating: Not yet rated Rate this answer: Vote
supercalifragilisticexpealidocious

 

Answer by boardini
Submitted on 3/15/2006
Rating: Not yet rated Rate this answer: Vote
smiles because theres a mile between both s's hahaha

 

Answer by MONGGOO
Submitted on 3/15/2006
Rating: Not yet rated Rate this answer: Vote
SUPERKALCLITSTICKSHADOREDDKYSHKLJHFKLJSKLFJSKLDFJSJDSLJDSKLJDSJDKLSJDKLSJDLJSKDJSKLILOVEYOUGLORIAAAAAAAAHAHAHAHAHAHHAHAHAAA

 

Answer by Freddy
Submitted on 3/16/2006
Rating: Not yet rated Rate this answer: Vote
dichlorodiphenyltrichloroethane

 

Answer by Stitch
Submitted on 3/18/2006
Rating: Not yet rated Rate this answer: Vote
Bababadalgharaghtakamminarronnkonnbronntonnerronntuonnthunntrovarrhounawnskawntoohoohoordenenthurnuk

 

Answer by jakecheese12
Submitted on 3/18/2006
Rating: Not yet rated Rate this answer: Vote
girafeaphitichemolasticgunjaramenberaphobia.

 

Answer by aRetard
Submitted on 3/20/2006
Rating: Not yet rated Rate this answer: Vote
ZomgWtfBBQ

 

Answer by Plex0z1
Submitted on 3/23/2006
Rating: Not yet rated Rate this answer: Vote
ACETYL­SERYL­TYROSYL­SERYL­ISO­LEUCYL­THREONYL­SERYL­PROLYL­SERYL­GLUTAMINYL­PHENYL­ALANYL­VALYL­PHENYL­ALANYL­LEUCYL­SERYL­SERYL­VALYL­TRYPTOPHYL­ALANYL­ASPARTYL­PROLYL­ISOLEUCYL­GLUTAMYL­LEUCYL­LEUCYL­ASPARAGINYL­VALYL­CYSTEINYL­THREONYL­SERYL­SERYL­LEUCYL­GLYCYL­ASPARAGINYL­GLUTAMINYL­PHENYL­ALANYL­GLUTAMINYL­THREONYL­GLUTAMINYL­GLUTAMINYL­ALANYL­ARGINYL­THREONYL­THREONYL­GLUTAMINYL­VALYL­GLUTAMINYL­GLUTAMINYL­PHENYL­ALANYL­SERYL­GLUTAMINYL­VALYL­TRYPTOPHYL­LYSYL­PROLYL­PHENYL­ALANYL­PROLYL­GLUTAMINYL­SERYL­THREONYL­VALYL­ARGINYL­PHENYL­ALANYL­PROLYL­GLYCYL­ASPARTYL­VALYL­TYROSYL­LYSYL­VALYL­TYROSYL­ARGINYL­TYROSYL­ASPARAGINYL­ALANYL­VALYL­LEUCYL­ASPARTYL­PROLYL­LEUCYL­ISOLEUCYL­THREONYL­ALANYL­LEUCYL­LEUCYL­GLYCYL­THREONYL­PHENYL­ALANYL­ASPARTYL­THREONYL­ARGINYL­ASPARAGINYL­ARGINYL­ISOLEUCYL­ISOLEUCYL­GLUTAMYL­VALYL­GLUTAMYL­ASPARAGINYL­GLUTAMINYL­GLUTAMINYL­SERYL­PROLYL­THREONYL­THREONYL­ALANYL­GLUTAMYL­THREONYL­LEUCYL­ASPARTYL­ALANYL­THREONYL­ARGINYL­ARGINYL­VALYL­ASPARTYL­ASPARTYL­ALANYL­THREONYL­VALYL­ALANYL­ISOLEUCYL­ARGINYL­SERYL­ALANYL­ASPARAGINYL­ISOLEUCYL­ASPARAGINYL­LEUCYL­VALYL­ASPARAGINYL­GLUTAMYL­LEUCYL­VALYL­ARGINYL­GLYCYL­THREONYL­GLYCYL­LEUCYL­TYROSYL­ASPARAGINYL­GLUTAMINYL­ASPARAGINYL­THREONYL­PHENYL­ALANYL­GLUTAMYL­SERYL­METHIONYL­SERYL­GLYCYL­LEUCYL­VALYL­TRYPTOPHYL­THREONYL­SERYL­ALANYL­PROLYL­ALANYL­SERINE

 

Answer by sk8er
Submitted on 3/23/2006
Rating: Not yet rated Rate this answer: Vote
thatoghxhxghfdsdtyygxvzdhygzhghyatazgzgdyzdtdtzdgzdgzdgdgay,jh

 

Answer by nugz
Submitted on 3/30/2006
Rating: Not yet rated Rate this answer: Vote
onomonopoeia

 

Answer by ziggy
Submitted on 3/30/2006
Rating: Not yet rated Rate this answer: Vote
CHEESE NIPS!!!!

 

Answer by Bob
Submitted on 4/3/2006
Rating: Not yet rated Rate this answer: Vote
i dont know

 

Answer by jake
Submitted on 4/3/2006
Rating: Not yet rated Rate this answer: Vote
Yourmomishot

 

Answer by I2niceO
Submitted on 4/3/2006
Rating: Not yet rated Rate this answer: Vote
supercalafragilisticexpialidocious

 

Answer by Nigel
Submitted on 4/3/2006
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanokoniosis

 

Answer by george
Submitted on 4/4/2006
Rating: Not yet rated Rate this answer: Vote
microscopicmentarianisum

 

Answer by Histol Talawungu
Submitted on 4/4/2006
Rating: Not yet rated Rate this answer: Vote
urretartedifuthinkthisisthelongestwordthatuhaveeverseeninyourlife

 

Answer by shmitty
Submitted on 4/4/2006
Rating: Not yet rated Rate this answer: Vote
MOOOOOOOOOOOOOOOOOOOOOOOOO *cough cough* ahem MOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO

 

Answer by wupwup
Submitted on 4/5/2006
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosisHippopotomonstrosesquippedaliophobiaAntidisestablishmentarianisim


hohoo...suck on that byotches

 

Answer by Your mom
Submitted on 4/10/2006
Rating: Not yet rated Rate this answer: Vote
Hipposaregaysodontvoteforhippossothiscanbethelargestwordintheenglishlanguageustupidpeoplethisisthelongestwordevercreatedkthxireallyownyou

 

Answer by Biggin' in 'pantins'
Submitted on 4/11/2006
Rating: Not yet rated Rate this answer: Vote
Superscrotumaticoralrevitilizationsensationalitspontaneouslyphotonic

 

Answer by cgfcf
Submitted on 4/13/2006
Rating: Not yet rated Rate this answer: Vote
vklzjcnv;lkzsjd;vfijsd;oifjdkfidkfodjfidfjksdfksjdfa

 

Answer by amandita
Submitted on 4/14/2006
Rating: Not yet rated Rate this answer: Vote
nothisisthelongestwordintheworldbecauseYOURAJEWnagger

 

Answer by tanner
Submitted on 4/17/2006
Rating: Not yet rated Rate this answer: Vote
electromagneticcomunicationacceleraterdischargewave

 

Answer by w00t
Submitted on 4/18/2006
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis
si sdrawkcab
sisoinoconaclovociliscipocsorcimartluonomuenp
reverof em koot taht

 

Answer by tmus5
Submitted on 4/19/2006
Rating: Not yet rated Rate this answer: Vote
pseudopseudohypoparathyroidism

 

Answer by Milkshake
Submitted on 4/23/2006
Rating: Not yet rated Rate this answer: Vote
thisisthebiggestwordeveryoucannottopthisburnhahayousuckithasthemostlettersinit

 

Answer by naked old man
Submitted on 4/25/2006
Rating: Not yet rated Rate this answer: Vote
badcterialoticmanistallintentric

 

Answer by Dylan Hilson
Submitted on 4/25/2006
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by poop
Submitted on 4/27/2006
Rating: Not yet rated Rate this answer: Vote
iliketopoopalotcauselikeihaveapoopingproblem

 

Answer by bman
Submitted on 4/30/2006
Rating: Not yet rated Rate this answer: Vote
supercalifragilisticexpialidocious

 

Answer by swens
Submitted on 4/30/2006
Rating: Not yet rated Rate this answer: Vote
yeahbutthiswordhasmorelettersthenkarlssoitisthelongestword

 

Answer by P-Dog
Submitted on 5/3/2006
Rating: Not yet rated Rate this answer: Vote
Supercalifregilisticexpieledocious

 

Answer by bob from ding dong
Submitted on 5/7/2006
Rating: Not yet rated Rate this answer: Vote
e.kswfhksdfhliuekcxjnckjahsiuhejhslkjydoiewjhnbekdkughjhghkfvgzvjhuyvbrdfvsedijewdflnbewyntfcdwohiefdulhweufjwarefd6wfijeywhdfioushjdfewichusdoeghdoisfduyreiukfjblrhipjdofyeshkfibplwvp9yjiokoijpouihjopijpojioi

 

Answer by JayaKumarKanchi
Submitted on 5/8/2006
Rating: Not yet rated Rate this answer: Vote
INTERNATIONALIZATIONARISM

 

Answer by jam man91
Submitted on 5/8/2006
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by Danipoo
Submitted on 5/9/2006
Rating: Not yet rated Rate this answer: Vote
Thisisthebigestwordbecauseisaysoanditsbiggerthanallofyourwordssowhatdoyouthinkaboutthat.

 

Answer by Adrian
Submitted on 5/9/2006
Rating: Not yet rated Rate this answer: Vote
you people are gay! Ka-Bam!

 

Answer by laboye3148
Submitted on 5/9/2006
Rating: Not yet rated Rate this answer: Vote
Floccinaucinihilipilification

 

Answer by nac nac
Submitted on 5/10/2006
Rating: Not yet rated Rate this answer: Vote
Atnimunilismanicurinestablishism

 

Answer by dude
Submitted on 5/11/2006
Rating: Not yet rated Rate this answer: Vote
duuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuude

 

Answer by shahbaz
Submitted on 5/11/2006
Rating: Not yet rated Rate this answer: Vote
the biggest word is
supercalifrodgialisticexpealiadocious

 

Answer by Danny
Submitted on 5/12/2006
Rating: Not yet rated Rate this answer: Vote
Supercalifragilisticexpialidocious

 

Answer by woofna19
Submitted on 5/14/2006
Rating: Not yet rated Rate this answer: Vote
noidhavetosaythisisthelongestwordeverbecauseitclearlyhasmorelettersinitthenanyoftheothers

 

Answer by risi
Submitted on 5/14/2006
Rating: Not yet rated Rate this answer: Vote
supercalifragilisticexbealadocious

 

Answer by jj
Submitted on 5/14/2006
Rating: Not yet rated Rate this answer: Vote
bboooooooooobiiiiiieeeeeeeeesssssssssssssssssssssssssssssss

 

Answer by Courtney
Submitted on 5/16/2006
Rating: Not yet rated Rate this answer: Vote
Thisisactuallythelongestwordcozimadeitupjustthenandiamsoawesomesoitisallowed.

 

Answer by richard outland
Submitted on 5/17/2006
Rating: Not yet rated Rate this answer: Vote
namnitolatricondisonictheosis

 

Answer by subarusebb
Submitted on 5/18/2006
Rating: Not yet rated Rate this answer: Vote
ahh, but do you know what it means?

it means something about the dust of a volcano getting into lungs and causing a disease or something like that

 

Answer by jjjj
Submitted on 5/18/2006
Rating: Not yet rated Rate this answer: Vote
Pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by gemma
Submitted on 5/18/2006
Rating: Not yet rated Rate this answer: Vote
gemmasthebestintheworldbecauseyouallsimplysuckprettyhardcore

 

Answer by syd
Submitted on 5/22/2006
Rating: Not yet rated Rate this answer: Vote
sydneyisthecoolestpersoninthespringfieldareacauseisaidso

 

Answer by Melvin
Submitted on 5/23/2006
Rating: Not yet rated Rate this answer: Vote
pombolsimesticavolictismaticssiosis

 

Answer by Mr Dong
Submitted on 5/24/2006
Rating: Not yet rated Rate this answer: Vote
Mypenis

 

Answer by blondeindian
Submitted on 5/24/2006
Rating: Not yet rated Rate this answer: Vote
thesamseterifannopertaniwerifilevictorealusomedalosermanefierdeserifigalnacotsyndrom

 

Answer by Mohammad
Submitted on 5/29/2006
Rating: Not yet rated Rate this answer: Vote
what is the biggest word in the English language

 

Answer by mac
Submitted on 5/30/2006
Rating: Not yet rated Rate this answer: Vote
mcoudvyaidfjhvgluydgfjhsvgsdofuyvsjfdnvusfglvjksnfdblvuiysgf,nvb idgfvj,hfdgvsjdhgfvlydgfjvbduygvfgdsflvbdsfvngdfjbvlfdygvlhfdshvhhhhhhhhhhhhfdghtrshgihtrljghththethingmsdfhgliudsfg.ksjfhgliutrhg.kjrshtgliuhtsgkfjnvbliusfhv.kjntfg;hst.kjhgui;ht.gkjbn;oushrk.gjhursthgk.jhti;ughpoogasspneumonotramicroscopicsilicovolcanoconiosis

 

Answer by JOHNNY ROCKET POCKET
Submitted on 5/30/2006
Rating: Not yet rated Rate this answer: Vote
ILIKEGAYSEXWITHBIGBLACKHAIRYMENTHATRAIDMYTIGHTGAYASSHOLE

 

Answer by g unit
Submitted on 5/30/2006
Rating: Not yet rated Rate this answer: Vote
its thebiggestwordintthewholeentirewordisthisoneuzitsreallybig

 

Answer by ethan is gay
Submitted on 6/1/2006
Rating: Not yet rated Rate this answer: Vote
thisisthelongestwordbecauseofthewaythatmcfieldsdemonstratestosocietyaboutthedevelopmentofhomosexualityiniraqpsmcfieldsisgaywitnethanpssethantakesituptheass!!psssihaveabigwilly

 

Answer by jimmy
Submitted on 6/2/2006
Rating: Not yet rated Rate this answer: Vote
floccinoccikneefilliflipamaassossiationflooganvonstrangan

 

Answer by JULIANO PALOKOWSKI (lona_sc@msn.com)
Submitted on 6/2/2006
Rating: Not yet rated Rate this answer: Vote
ACETYL­SERYL­TYROSYL­SERYL­ISO­LEUCYL­THREONYL­SERYL­PROLYL­SERYL­GLUTAMINYL­PHENYL­ALANYL­VALYL­PHENYL­ALANYL­LEUCYL­SERYL­SERYL­VALYL­TRYPTOPHYL­ALANYL­ASPARTYL­PROLYL­ISOLEUCYL­GLUTAMYL­LEUCYL­LEUCYL­ASPARAGINYL­VALYL­CYSTEINYL­THREONYL­SERYL­SERYL­LEUCYL­GLYCYL­ASPARAGINYL­GLUTAMINYL­PHENYL­ALANYL­GLUTAMINYL­THREONYL­GLUTAMINYL­GLUTAMINYL­ALANYL­ARGINYL­THREONYL­THREONYL­GLUTAMINYL­VALYL­GLUTAMINYL­GLUTAMINYL­PHENYL­ALANYL­SERYL­GLUTAMINYL­VALYL­TRYPTOPHYL­LYSYL­PROLYL­PHENYL­ALANYL­PROLYL­GLUTAMINYL­SERYL­THREONYL­VALYL­ARGINYL­PHENYL­ALANYL­PROLYL­GLYCYL­ASPARTYL­VALYL­TYROSYL­LYSYL­VALYL­TYROSYL­ARGINYL­TYROSYL­ASPARAGINYL­ALANYL­VALYL­LEUCYL­ASPARTYL­PROLYL­LEUCYL­ISOLEUCYL­THREONYL­ALANYL­LEUCYL­LEUCYL­GLYCYL­THREONYL­PHENYL­ALANYL­ASPARTYL­THREONYL­ARGINYL­ASPARAGINYL­ARGINYL­ISOLEUCYL­ISOLEUCYL­GLUTAMYL­VALYL­GLUTAMYL­ASPARAGINYL­GLUTAMINYL­GLUTAMINYL­SERYL­PROLYL­THREONYL­THREONYL­ALANYL­GLUTAMYL­THREONYL­LEUCYL­ASPARTYL­ALANYL­THREONYL­ARGINYL­ARGINYL­VALYL­ASPARTYL­ASPARTYL­ALANYL­THREONYL­VALYL­ALANYL­ISOLEUCYL­ARGINYL­SERYL­ALANYL­ASPARAGINYL­ISOLEUCYL­ASPARAGINYL­LEUCYL­VALYL­ASPARAGINYL­GLUTAMYL­LEUCYL­VALYL­ARGINYL­GLYCYL­THREONYL­GLYCYL­LEUCYL­TYROSYL­ASPARAGINYL­GLUTAMINYL­ASPARAGINYL­THREONYL­PHENYL­ALANYL­GLUTAMYL­SERYL­METHIONYL­SERYL­GLYCYL­LEUCYL­VALYL­TRYPTOPHYL­THREONYL­SERYL­ALANYL­PROLYL­ALANYL­SERINE = Tobacco Mosaic Virus, Dahlemense Strain.





 

Answer by dhdl
Submitted on 6/2/2006
Rating: Not yet rated Rate this answer: Vote
iamthebestmanlyboyintheworldsohahaboya

 

Answer by kookoo
Submitted on 6/3/2006
Rating: Not yet rated Rate this answer: Vote
longword

 

Answer by morbidly obese man
Submitted on 6/5/2006
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by nemo
Submitted on 6/5/2006
Rating: Not yet rated Rate this answer: Vote
hofeuterning

 

Answer by poop
Submitted on 6/6/2006
Rating: Not yet rated Rate this answer: Vote
ACETYL­SERYL­TYROSYL­SERYL­ISO­LEUCYL­THREONYL­SERYL­PROLYL­SERYL­GLUTAMINYL­PHENYL­ALANYL­VALYL­PHENYL­ALANYL­LEUCYL­SERYL­SERYL­VALYL­TRYPTOPHYL­ALANYL­ASPARTYL­PROLYL­ISOLEUCYL­GLUTAMYL­LEUCYL­LEUCYL­ASPARAGINYL­VALYL­CYSTEINYL­THREONYL­SERYL­SERYL­LEUCYL­GLYCYL­ASPARAGINYL­GLUTAMINYL­PHENYL­ALANYL­GLUTAMINYL­THREONYL­GLUTAMINYL­GLUTAMINYL­ALANYL­ARGINYL­THREONYL­THREONYL­GLUTAMINYL­VALYL­GLUTAMINYL­GLUTAMINYL­PHENYL­ALANYL­SERYL­GLUTAMINYL­VALYL­TRYPTOPHYL­LYSYL­PROLYL­PHENYL­ALANYL­PROLYL­GLUTAMINYL­SERYL­THREONYL­VALYL­ARGINYL­PHENYL­ALANYL­PROLYL­GLYCYL­ASPARTYL­VALYL­TYROSYL­LYSYL­VALYL­TYROSYL­ARGINYL­TYROSYL­ASPARAGINYL­ALANYL­VALYL­LEUCYL­ASPARTYL­PROLYL­LEUCYL­ISOLEUCYL­THREONYL­ALANYL­LEUCYL­LEUCYL­GLYCYL­THREONYL­PHENYL­ALANYL­ASPARTYL­THREONYL­ARGINYL­ASPARAGINYL­ARGINYL­ISOLEUCYL­ISOLEUCYL­GLUTAMYL­VALYL­GLUTAMYL­ASPARAGINYL­GLUTAMINYL­GLUTAMINYL­SERYL­PROLYL­THREONYL­THREONYL­ALANYL­GLUTAMYL­THREONYL­LEUCYL­ASPARTYL­ALANYL­THREONYL­ARGINYL­ARGINYL­VALYL­ASPARTYL­ASPARTYL­ALANYL­THREONYL­VALYL­ALANYL­ISOLEUCYL­ARGINYL­SERYL­ALANYL­ASPARAGINYL­ISOLEUCYL­ASPARAGINYL­LEUCYL­VALYL­ASPARAGINYL­GLUTAMYL­LEUCYL­VALYL­ARGINYL­GLYCYL­THREONYL­GLYCYL­LEUCYL­TYROSYL­ASPARAGINYL­GLUTAMINYL­ASPARAGINYL­THREONYL­PHENYL­ALANYL­GLUTAMYL­SERYL­METHIONYL­SERYL­GLYCYL­LEUCYL­VALYL­TRYPTOPHYL­THREONYL­SERYL­ALANYL­PROLYL­ALANYL­SERINE               this means Tobacco Mosaic Virus, Dahlemense Strain.
it is a chemical term and yes it is a real word.

 

Answer by poop
Submitted on 6/6/2006
Rating: Not yet rated Rate this answer: Vote
ACETYL­SERYL­TYROSYL­SERYL­ISO­LEUCYL­THREONYL­SERYL­PROLYL­SERYL­GLUTAMINYL­PHENYL­ALANYL­VALYL­PHENYL­ALANYL­LEUCYL­SERYL­SERYL­VALYL­TRYPTOPHYL­ALANYL­ASPARTYL­PROLYL­ISOLEUCYL­GLUTAMYL­LEUCYL­LEUCYL­ASPARAGINYL­VALYL­CYSTEINYL­THREONYL­SERYL­SERYL­LEUCYL­GLYCYL­ASPARAGINYL­GLUTAMINYL­PHENYL­ALANYL­GLUTAMINYL­THREONYL­GLUTAMINYL­GLUTAMINYL­ALANYL­ARGINYL­THREONYL­THREONYL­GLUTAMINYL­VALYL­GLUTAMINYL­GLUTAMINYL­PHENYL­ALANYL­SERYL­GLUTAMINYL­VALYL­TRYPTOPHYL­LYSYL­PROLYL­PHENYL­ALANYL­PROLYL­GLUTAMINYL­SERYL­THREONYL­VALYL­ARGINYL­PHENYL­ALANYL­PROLYL­GLYCYL­ASPARTYL­VALYL­TYROSYL­LYSYL­VALYL­TYROSYL­ARGINYL­TYROSYL­ASPARAGINYL­ALANYL­VALYL­LEUCYL­ASPARTYL­PROLYL­LEUCYL­ISOLEUCYL­THREONYL­ALANYL­LEUCYL­LEUCYL­GLYCYL­THREONYL­PHENYL­ALANYL­ASPARTYL­THREONYL­ARGINYL­ASPARAGINYL­ARGINYL­ISOLEUCYL­ISOLEUCYL­GLUTAMYL­VALYL­GLUTAMYL­ASPARAGINYL­GLUTAMINYL­GLUTAMINYL­SERYL­PROLYL­THREONYL­THREONYL­ALANYL­GLUTAMYL­THREONYL­LEUCYL­ASPARTYL­ALANYL­THREONYL­ARGINYL­ARGINYL­VALYL­ASPARTYL­ASPARTYL­ALANYL­THREONYL­VALYL­ALANYL­ISOLEUCYL­ARGINYL­SERYL­ALANYL­ASPARAGINYL­ISOLEUCYL­ASPARAGINYL­LEUCYL­VALYL­ASPARAGINYL­GLUTAMYL­LEUCYL­VALYL­ARGINYL­GLYCYL­THREONYL­GLYCYL­LEUCYL­TYROSYL­ASPARAGINYL­GLUTAMINYL­ASPARAGINYL­THREONYL­PHENYL­ALANYL­GLUTAMYL­SERYL­METHIONYL­SERYL­GLYCYL­LEUCYL­VALYL­TRYPTOPHYL­THREONYL­SERYL­ALANYL­PROLYL­ALANYL­SERINE               this means Tobacco Mosaic Virus, Dahlemense Strain.
it is a chemical term and yes it is a real word.

 

Answer by cool dude
Submitted on 6/7/2006
Rating: Not yet rated Rate this answer: Vote
TYROSYLARGINYLTYROSYLASPARAGINYLALANYLVALYLLEUCYLASPARTYLPROLYLLEUCYLISOLEUCYLTHREONYLALANYLLEUCYLLEUCYLGLYCYLTHREONYLPHENYLALANYLASPARTYLTHREONYLARGINYLASPARAGINYLARGINYLISOLEUCYLISOLEUCYLGLUTAMYLVALYLGLUTAMYLASPARAGINYLGLUTAMINYLGLUTAMINYLSERYLPROLYLTHREONYLTHREONYLALANYLGLUTAMYLTHREONYLLEUCYLASPARTYLALANYLTHREONYLARGINYLARGINYLVALYLASPARTYLASPARTYLALANYLTHREONYLVALYLALANYLISOLEUCYLARGINYLSERYLALANYLASPARAGINYLISOLEUCYLASPARAGINYLLEUCYLVALYLASPARAGINYLGLUTAMYLLEUCYLVALYLARGINYLGLYCYLTHREONYLGLYCYLLEUCYLTYROSYLASPARAGINYLGLUTAMINYLASPARAGINYLTHREONYLPHENYLALANYLGLUTAMYLSERYLMETHIONYLSERYLGLYCYLLEUCYLVALYLTRYPTOPHYLTHREONYLSERYLALANYLPROLYLALANYLSERINE = Tobacco Mosaic Virus, Dahlemense Strain.
This word has appeared in the American Chemical Society's Chemical Abstracts and is thus considered by some to be the longest real word.

 

Answer by thatcrazykid
Submitted on 6/7/2006
Rating: Not yet rated Rate this answer: Vote
thiswordisbiggerthanthatotherwordcauseithasmorelettersthanthatotherwordbecauseheswordreallyisntaword

 

Answer by jummy
Submitted on 6/8/2006
Rating: Not yet rated Rate this answer: Vote
hobopolophisiomusimtisabroughofdaceilimutionansgorthrobicnesiumtasiumnes

 

Answer by BIG B
Submitted on 6/9/2006
Rating: Not yet rated Rate this answer: Vote
DNVJSGJRHFRW;OIU EGJRW; GFREIOAGKOTRSHKTO SR[KHYSXGNJRGMVBRIB.LHT

 

Answer by InitialG
Submitted on 6/9/2006
Rating: Not yet rated Rate this answer: Vote
puertingdagkotaangakongutinoy

 

Answer by i like cookies
Submitted on 6/10/2006
Rating: Not yet rated Rate this answer: Vote
does
ACETYL­SERYL­TYROSYL­SERYL­ISO­LEUCYL­THREONYL­SERYL­PROLYL­SERYL­GLUTAMINYL­PHENYL­ALANYL­VALYL­PHENYL­ALANYL­LEUCYL­SERYL­SERYL­VALYL­TRYPTOPHYL­ALANYL­ASPARTYL­PROLYL­ISOLEUCYL­GLUTAMYL­LEUCYL­LEUCYL­ASPARAGINYL­VALYL­CYSTEINYL­THREONYL­SERYL­SERYL­LEUCYL­GLYCYL­ASPARAGINYL­GLUTAMINYL­PHENYL­ALANYL­GLUTAMINYL­THREONYL­GLUTAMINYL­GLUTAMINYL­ALANYL­ARGINYL­THREONYL­THREONYL­GLUTAMINYL­VALYL­GLUTAMINYL­GLUTAMINYL­PHENYL­ALANYL­SERYL­GLUTAMINYL­VALYL­TRYPTOPHYL­LYSYL­PROLYL­PHENYL­ALANYL­PROLYL­GLUTAMINYL­SERYL­THREONYL­VALYL­ARGINYL­PHENYL­ALANYL­PROLYL­GLYCYL­ASPARTYL­VALYL­TYROSYL­LYSYL­VALYL­TYROSYL­ARGINYL­TYROSYL­ASPARAGINYL­ALANYL­VALYL­LEUCYL­ASPARTYL­PROLYL­LEUCYL­ISOLEUCYL­THREONYL­ALANYL­LEUCYL­LEUCYL­GLYCYL­THREONYL­PHENYL­ALANYL­ASPARTYL­THREONYL­ARGINYL­ASPARAGINYL­ARGINYL­ISOLEUCYL­ISOLEUCYL­GLUTAMYL­VALYL­GLUTAMYL­ASPARAGINYL­GLUTAMINYL­GLUTAMINYL­SERYL­PROLYL­THREONYL­THREONYL­ALANYL­GLUTAMYL­THREONYL­LEUCYL­ASPARTYL­ALANYL­THREONYL­ARGINYL­ARGINYL­VALYL­ASPARTYL­ASPARTYL­ALANYL­THREONYL­VALYL­ALANYL­ISOLEUCYL­ARGINYL­SERYL­ALANYL­ASPARAGINYL­ISOLEUCYL­ASPARAGINYL­LEUCYL­VALYL­ASPARAGINYL­GLUTAMYL­LEUCYL­VALYL­ARGINYL­GLYCYL­THREONYL­GLYCYL­LEUCYL­TYROSYL­ASPARAGINYL­GLUTAMINYL­ASPARAGINYL­THREONYL­PHENYL­ALANYL­GLUTAMYL­SERYL­METHIONYL­SERYL­GLYCYL­LEUCYL­VALYL­TRYPTOPHYL­THREONYL­SERYL­ALANYL­PROLYL­ALANYL­SERINE
count?

 

Answer by i like cookies
Submitted on 6/10/2006
Rating: Not yet rated Rate this answer: Vote
does
ACETYL­SERYL­TYROSYL­SERYL­ISO­LEUCYL­THREONYL­SERYL­PROLYL­SERYL­GLUTAMINYL­PHENYL­ALANYL­VALYL­PHENYL­ALANYL­LEUCYL­SERYL­SERYL­VALYL­TRYPTOPHYL­ALANYL­ASPARTYL­PROLYL­ISOLEUCYL­GLUTAMYL­LEUCYL­LEUCYL­ASPARAGINYL­VALYL­CYSTEINYL­THREONYL­SERYL­SERYL­LEUCYL­GLYCYL­ASPARAGINYL­GLUTAMINYL­PHENYL­ALANYL­GLUTAMINYL­THREONYL­GLUTAMINYL­GLUTAMINYL­ALANYL­ARGINYL­THREONYL­THREONYL­GLUTAMINYL­VALYL­GLUTAMINYL­GLUTAMINYL­PHENYL­ALANYL­SERYL­GLUTAMINYL­VALYL­TRYPTOPHYL­LYSYL­PROLYL­PHENYL­ALANYL­PROLYL­GLUTAMINYL­SERYL­THREONYL­VALYL­ARGINYL­PHENYL­ALANYL­PROLYL­GLYCYL­ASPARTYL­VALYL­TYROSYL­LYSYL­VALYL­TYROSYL­ARGINYL­TYROSYL­ASPARAGINYL­ALANYL­VALYL­LEUCYL­ASPARTYL­PROLYL­LEUCYL­ISOLEUCYL­THREONYL­ALANYL­LEUCYL­LEUCYL­GLYCYL­THREONYL­PHENYL­ALANYL­ASPARTYL­THREONYL­ARGINYL­ASPARAGINYL­ARGINYL­ISOLEUCYL­ISOLEUCYL­GLUTAMYL­VALYL­GLUTAMYL­ASPARAGINYL­GLUTAMINYL­GLUTAMINYL­SERYL­PROLYL­THREONYL­THREONYL­ALANYL­GLUTAMYL­THREONYL­LEUCYL­ASPARTYL­ALANYL­THREONYL­ARGINYL­ARGINYL­VALYL­ASPARTYL­ASPARTYL­ALANYL­THREONYL­VALYL­ALANYL­ISOLEUCYL­ARGINYL­SERYL­ALANYL­ASPARAGINYL­ISOLEUCYL­ASPARAGINYL­LEUCYL­VALYL­ASPARAGINYL­GLUTAMYL­LEUCYL­VALYL­ARGINYL­GLYCYL­THREONYL­GLYCYL­LEUCYL­TYROSYL­ASPARAGINYL­GLUTAMINYL­ASPARAGINYL­THREONYL­PHENYL­ALANYL­GLUTAMYL­SERYL­METHIONYL­SERYL­GLYCYL­LEUCYL­VALYL­TRYPTOPHYL­THREONYL­SERYL­ALANYL­PROLYL­ALANYL­SERINE
count?

 

Answer by Westin
Submitted on 6/10/2006
Rating: Not yet rated Rate this answer: Vote
Methylchloroisothiazolinone

 

Answer by LemonBerryx3
Submitted on 6/11/2006
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by jess
Submitted on 6/13/2006
Rating: Not yet rated Rate this answer: Vote
floccinaucinihilipilification

 

Answer by rehv
Submitted on 6/14/2006
Rating: Not yet rated Rate this answer: Vote
the longest none medical english word is floccinaucinihilipilification , meaning - the act or habit of describing something as worthless

 

Answer by bigbobbaboo
Submitted on 6/15/2006
Rating: Not yet rated Rate this answer: Vote
apparently there is a 900 word science noun

 

Answer by marky boy and knowlsey
Submitted on 6/19/2006
Rating: Not yet rated Rate this answer: Vote
Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch    its a town name in wales

 

Answer by Surfer
Submitted on 6/21/2006
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoniosis

 

Answer by davyjones
Submitted on 6/25/2006
Rating: Not yet rated Rate this answer: Vote
pneaumaticonistrimicrotoohertlifiepersubdisorientatedmonumitisms

 

Answer by Stban
Submitted on 7/2/2006
Rating: Not yet rated Rate this answer: Vote
Pseudoproantidisestablishmentarianistically

 

Answer by man of h2o
Submitted on 7/5/2006
Rating: Not yet rated Rate this answer: Vote
Pneumonoultramicroscopicsilicovolcanokoniosis

 

Answer by austin
Submitted on 7/6/2006
Rating: Not yet rated Rate this answer: Vote
coooooooowwwwwwwwwwwssssssssssssssssssssgggggggggggooooooooooooooooooooooooooooooooommmmmmmmmmmmmmmooooooooooooooooooooooooooooooooo

 

Answer by ferny
Submitted on 7/7/2006
Rating: Not yet rated Rate this answer: Vote
Llanfairpwllgwyngyllgogerychwyrndrobwll-llantysiliogogogoch

 

Answer by cheerleader
Submitted on 7/11/2006
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by Willis
Submitted on 7/13/2006
Rating: Not yet rated Rate this answer: Vote
floccinaucinihilipilification

 

Answer by coolio
Submitted on 7/15/2006
Rating: Not yet rated Rate this answer: Vote
BABEAGERGERG

 

Answer by jason
Submitted on 7/16/2006
Rating: Not yet rated Rate this answer: Vote
nonpneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by Willy
Submitted on 7/17/2006
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by Dylan
Submitted on 7/26/2006
Rating: Not yet rated Rate this answer: Vote
Bovinespongeoformencepholopothy

 

Answer by Kaitlyn & Aimee
Submitted on 8/1/2006
Rating: Not yet rated Rate this answer: Vote
antidisestablishmenyyariisamiscoolbutpnemonieaiscooltosoyeahwhateverhfiekshfdisejkdhisjustdeppjohnnybloomorlandoledgerheathefronzackloveiilovethemsoyeahwatever

 

Answer by Kaitlyn & Aimee
Submitted on 8/1/2006
Rating: Not yet rated Rate this answer: Vote
AimeeoverherethinksheallgangsterbutthetruthissheisthewhitestwhitywhitepersoniknowsaidbuttrueokayokaysorememeberkidshomietheclowndontplaydatwatchhomieorperishlovejohnnydeppordierememberiloveallpplfromotherplanetsbutAimeestillaintgangster

 

Answer by j man
Submitted on 8/3/2006
Rating: Not yet rated Rate this answer: Vote
supercalafragilisticexpialladoshiuslytrescmuculearscientusfrestoplutoniumentanty

 

Answer by rraa
Submitted on 8/13/2006
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by Cave Hippo
Submitted on 8/14/2006
Rating: Not yet rated Rate this answer: Vote
Gaikuhgaijkzhubgihbvubvukyzshfisuhefgyugfytgcusgefywgufhzuydgfgsfgduvbwubfwizushevihkvygzkjgvjhgvytrfbiwuysvtrinetivsoizsnbtbvzouytszbtsjygtbkusvbiutzsynityeyblziureiuwzkvbtriusuefzsyfg

 

Answer by Chappri
Submitted on 8/14/2006
Rating: Not yet rated Rate this answer: Vote
chapri

 

Answer by DEVAN
Submitted on 8/15/2006
Rating: Not yet rated Rate this answer: Vote
HONORIFICABILITUDINITATIBUS Means Idiot.

 

Answer by tweety-bird
Submitted on 8/16/2006
Rating: Not yet rated Rate this answer: Vote
thelongestwordisthewordthatiamcurrentlytypingithastheabsolutelymostlettersinit

 

Answer by Alice
Submitted on 8/24/2006
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis the disease you get from inhailing volcanic ash

 

Answer by Crookedasterisk
Submitted on 9/4/2006
Rating: Not yet rated Rate this answer: Vote
ROFLAMO!

 

Answer by tom
Submitted on 9/7/2006
Rating: Not yet rated Rate this answer: Vote
supercalifragilisticexpeealodocious

 

Answer by Mettallic
Submitted on 9/7/2006
Rating: Not yet rated Rate this answer: Vote
Rinderkennzeichnungs-und-rindfleischetikettierungsüberwachungsaufgabenübertragungsgesetz

 

Answer by BooBoo
Submitted on 9/7/2006
Rating: Not yet rated Rate this answer: Vote
Methionylglutaminylarginytyrosylglutamylserylle
ucylphenylalanylalanylglutaminyll-eucyllysylglu
tamylarginyllysylglutamylglycylalanylphenylalan
yvalylprolylphenylalanyl-valythreonylleucylglyc
ylaspartylprolyglycylisoleucylglutamylglutaminy
lserylleucyllysyl-isoleucylaspartylthreonylleuc
ylisoleucylglutamylalanylglycylalanylaspartylal
anylleucy-lglutamylleucylglycylglycylisoleucylp
rolylphenylalanylserylas

 

Answer by james
Submitted on 9/10/2006
Rating: Not yet rated Rate this answer: Vote
polytetrafluoroethylene

 

Answer by crazy adsa
Submitted on 9/10/2006
Rating: Not yet rated Rate this answer: Vote
ACETYL­SERYL­TYROSYL­SERYL­ISO­LEUCYL­THREONYL­SERYL­PROLYL­SERYL­GLUTAMINYL­PHENYL­ALANYL­VALYL­PHENYL­ALANYL­LEUCYL­SERYL­SERYL­VALYL­TRYPTOPHYL­ALANYL­ASPARTYL­PROLYL­ISOLEUCYL­GLUTAMYL­LEUCYL­LEUCYL­ASPARAGINYL­VALYL­CYSTEINYL­THREONYL­SERYL­SERYL­LEUCYL­GLYCYL­ASPARAGINYL­GLUTAMINYL­PHENYL­ALANYL­GLUTAMINYL­THREONYL­GLUTAMINYL­GLUTAMINYL­ALANYL­ARGINYL­THREONYL­THREONYL­GLUTAMINYL­VALYL­GLUTAMINYL­GLUTAMINYL­PHENYL­ALANYL­SERYL­GLUTAMINYL­VALYL­TRYPTOPHYL­LYSYL­PROLYL­PHENYL­ALANYL­PROLYL­GLUTAMINYL­SERYL­THREONYL­VALYL­ARGINYL­PHENYL­ALANYL­PROLYL­GLYCYL­ASPARTYL­VALYL­TYROSYL­LYSYL­VALYL­TYROSYL­ARGINYL­TYROSYL­ASPARAGINYL­ALANYL­VALYL­LEUCYL­ASPARTYL­PROLYL­LEUCYL­ISOLEUCYL­THREONYL­ALANYL­LEUCYL­LEUCYL­GLYCYL­THREONYL­PHENYL­ALANYL­ASPARTYL­THREONYL­ARGINYL­ASPARAGINYL­ARGINYL­ISOLEUCYL­ISOLEUCYL­GLUTAMYL­VALYL­GLUTAMYL­ASPARAGINYL­GLUTAMINYL­GLUTAMINYL­SERYL­PROLYL­THREONYL­THREONYL­ALANYL­GLUTAMYL­THREONYL­LEUCYL­ASPARTYL­ALANYL­THREONYL­ARGINYL­ARGINYL­VALYL­ASPARTYL­ASPARTYL­ALANYL­THREONYL­VALYL­ALANYL­ISOLEUCYL­ARGINYL­SERYL­ALANYL­ASPARAGINYL­ISOLEUCYL­ASPARAGINYL­LEUCYL­VALYL­ASPARAGINYL­GLUTAMYL­LEUCYL­VALYL­ARGINYL­GLYCYL­THREONYL­GLYCYL­LEUCYL­TYROSYL­ASPARAGINYL­GLUTAMINYL­ASPARAGINYL­THREONYL­PHENYL­ALANYL­GLUTAMYL­SERYL­METHIONYL­SERYL­GLYCYL­LEUCYL­VALYL­TRYPTOPHYL­THREONYL­SERYL­ALANYL­PROLYL­ALANYL­SERINE

 

Answer by daredevil
Submitted on 9/14/2006
Rating: Not yet rated Rate this answer: Vote
infinite is the largest word because it has no end

 

Answer by Matthew
Submitted on 9/14/2006
Rating: Not yet rated Rate this answer: Vote
ACETYL­SERYL­TYROSYL­SERYL­ISO­LEUCYL­THREONYL­SERYL­PROLYL­SERYL­GLUTAMINYL­PHENYL­ALANYL­VALYL­PHENYL­ALANYL­LEUCYL­SERYL­SERYL­VALYL­TRYPTOPHYL­ALANYL­ASPARTYL­PROLYL­ISOLEUCYL­GLUTAMYL­LEUCYL­LEUCYL­ASPARAGINYL­VALYL­CYSTEINYL­THREONYL­SERYL­SERYL­LEUCYL­GLYCYL­ASPARAGINYL­GLUTAMINYL­PHENYL­ALANYL­GLUTAMINYL­THREONYL­GLUTAMINYL­GLUTAMINYL­ALANYL­ARGINYL­THREONYL­THREONYL­GLUTAMINYL­VALYL­GLUTAMINYL­GLUTAMINYL­PHENYL­ALANYL­SERYL­GLUTAMINYL­VALYL­TRYPTOPHYL­LYSYL­PROLYL­PHENYL­ALANYL­PROLYL­GLUTAMINYL­SERYL­THREONYL­VALYL­ARGINYL­PHENYL­ALANYL­PROLYL­GLYCYL­ASPARTYL­VALYL­TYROSYL­LYSYL­VALYL­TYROSYL­ARGINYL­TYROSYL­ASPARAGINYL­ALANYL­VALYL­LEUCYL­ASPARTYL­PROLYL­LEUCYL­ISOLEUCYL­THREONYL­ALANYL­LEUCYL­LEUCYL­GLYCYL­THREONYL­PHENYL­ALANYL­ASPARTYL­THREONYL­ARGINYL­ASPARAGINYL­ARGINYL­ISOLEUCYL­ISOLEUCYL­GLUTAMYL­VALYL­GLUTAMYL­ASPARAGINYL­GLUTAMINYL­GLUTAMINYL­SERYL­PROLYL­THREONYL­THREONYL­ALANYL­GLUTAMYL­THREONYL­LEUCYL­ASPARTYL­ALANYL­THREONYL­ARGINYL­ARGINYL­VALYL­ASPARTYL­ASPARTYL­ALANYL­THREONYL­VALYL­ALANYL­ISOLEUCYL­ARGINYL­SERYL­ALANYL­ASPARAGINYL­ISOLEUCYL­ASPARAGINYL­LEUCYL­VALYL­ASPARAGINYL­GLUTAMYL­LEUCYL­VALYL­ARGINYL­GLYCYL­THREONYL­GLYCYL­LEUCYL­TYROSYL­ASPARAGINYL­GLUTAMINYL­ASPARAGINYL­THREONYL­PHENYL­ALANYL­GLUTAMYL­SERYL­METHIONYL­SERYL­GLYCYL­LEUCYL­VALYL­TRYPTOPHYL­THREONYL­SERYL­ALANYL­PROLYL­ALANYL­SERINE


Yes, its a real word. Its a chemical term used in science.

 

Answer by Vinnie
Submitted on 9/14/2006
Rating: Not yet rated Rate this answer: Vote
Smiles

BECAUSE THERES A MILE BETWEEN THE FIRST AND LAST WORD

 

Answer by Dustin Morris
Submitted on 9/20/2006
Rating: Not yet rated Rate this answer: Vote
tetramethyldiaminobenzhydrylphosphinous

 

Answer by volcanokanosis
Submitted on 9/25/2006
Rating: Not yet rated Rate this answer: Vote
hyperpoliesalabicsesquindipaleinism

 

Answer by krissy
Submitted on 9/29/2006
Rating: Not yet rated Rate this answer: Vote
supercalafragilisticexpeallidocious

 

Answer by kk
Submitted on 9/29/2006
Rating: Not yet rated Rate this answer: Vote
supercalafragalestikexpealadoshs

 

Answer by ravindran
Submitted on 9/30/2006
Rating: Not yet rated Rate this answer: Vote
flauccinocilihilipilification

 

Answer by Lacey
Submitted on 10/1/2006
Rating: Not yet rated Rate this answer: Vote
youallarethebiggestfagsi'veeverseenbecauseyougoongaysiteslikethisandmakeupbigwords

 

Answer by Asian invasion
Submitted on 10/2/2006
Rating: Not yet rated Rate this answer: Vote
This is the biggest word!
ACETYL­SERYL­TYROSYL­SERYL­ISO­LEUCYL­THREONYL­SERYL­PROLYL­SERYL­GLUTAMINYL­PHENYL­ALANYL­VALYL­PHENYL­ALANYL­LEUCYL­SERYL­SERYL­VALYL­TRYPTOPHYL­ALANYL­ASPARTYL­PROLYL­ISOLEUCYL­GLUTAMYL­LEUCYL­LEUCYL­ASPARAGINYL­VALYL­CYSTEINYL­THREONYL­SERYL­SERYL­LEUCYL­GLYCYL­ASPARAGINYL­GLUTAMINYL­PHENYL­ALANYL­GLUTAMINYL­THREONYL­GLUTAMINYL­GLUTAMINYL­ALANYL­ARGINYL­THREONYL­THREONYL­GLUTAMINYL­VALYL­GLUTAMINYL­GLUTAMINYL­PHENYL­ALANYL­SERYL­GLUTAMINYL­VALYL­TRYPTOPHYL­LYSYL­PROLYL­PHENYL­ALANYL­PROLYL­GLUTAMINYL­SERYL­THREONYL­VALYL­ARGINYL­PHENYL­ALANYL­PROLYL­GLYCYL­ASPARTYL­VALYL­TYROSYL­LYSYL­VALYL­TYROSYL­ARGINYL­TYROSYL­ASPARAGINYL­ALANYL­VALYL­LEUCYL­ASPARTYL­PROLYL­LEUCYL­ISOLEUCYL­THREONYL­ALANYL­LEUCYL­LEUCYL­GLYCYL­THREONYL­PHENYL­ALANYL­ASPARTYL­THREONYL­ARGINYL­ASPARAGINYL­ARGINYL­ISOLEUCYL­ISOLEUCYL­GLUTAMYL­VALYL­GLUTAMYL­ASPARAGINYL­GLUTAMINYL­GLUTAMINYL­SERYL­PROLYL­THREONYL­THREONYL­ALANYL­GLUTAMYL­THREONYL­LEUCYL­ASPARTYL­ALANYL­THREONYL­ARGINYL­ARGINYL­VALYL­ASPARTYL­ASPARTYL­ALANYL­THREONYL­VALYL­ALANYL­ISOLEUCYL­ARGINYL­SERYL­ALANYL­ASPARAGINYL­ISOLEUCYL­ASPARAGINYL­LEUCYL­VALYL­ASPARAGINYL­GLUTAMYL­LEUCYL­VALYL­ARGINYL­GLYCYL­THREONYL­GLYCYL­LEUCYL­TYROSYL­ASPARAGINYL­GLUTAMINYL­ASPARAGINYL­THREONYL­PHENYL­ALANYL­GLUTAMYL­SERYL­METHIONYL­SERYL­GLYCYL­LEUCYL­VALYL­TRYPTOPHYL­THREONYL­SERYL­ALANYL­PROLYL­ALANYL­SERINE

 

Answer by 5'th grade class
Submitted on 10/3/2006
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicrosopicsilicovolcanoiosis

 

Answer by Cwb101
Submitted on 10/4/2006
Rating: Not yet rated Rate this answer: Vote
jhgjgjgjvvgfhjvhvhawfvadjlbjbwydsbvdjvuaywvdjhvasvfjawfjvsjvfjvawuvffshvfavwyvfksvhfvawuvfyasvfahvwuyvfjasvfuwvgajvfvuweavfuavewuvfaywvfahvfjawvfuasvjvhfjawhvfuvsfjvhauwvfyauvfsuhvau

 

Answer by Julia
Submitted on 10/7/2006
Rating: Not yet rated Rate this answer: Vote
i agree with karl
=D
lol

 

Answer by doug jette
Submitted on 10/10/2006
Rating: Not yet rated Rate this answer: Vote
thisisthebiggestwordbecuaseiamthebiggestfagandtakeituptheassandiamnotblackiamjustafag

 

Answer by w^ dude
Submitted on 10/11/2006
Rating: Not yet rated Rate this answer: Vote
osseocarnisanguineovicericarfilaginonervomedullary........this is the biggest word in the english languige,it means blood flesh and bone.kinda worped

 

Answer by Swapnil
Submitted on 10/16/2006
Rating: Not yet rated Rate this answer: Vote
The word should be such that it should carry some meaning that could be used in general English sentences and not medical terms,nouns etc.So, according to me it's :

supercalifragalisticexpialidosious (adjective) = excellent

 

Answer by raghav
Submitted on 10/16/2006
Rating: Not yet rated Rate this answer: Vote
neumonoultramicroscopicsilcovolcanicsinniosis

 

Answer by evan
Submitted on 10/17/2006
Rating: Not yet rated Rate this answer: Vote
ACETYL­SERYL­TYROSYL­SERYL­ISO­LEUCYL­THREONYL­SERYL­PROLYL­SERYL­GLUTAMINYL­PHENYL­ALANYL­VALYL­PHENYL­ALANYL­LEUCYL­SERYL­SERYL­VALYL­TRYPTOPHYL­ALANYL­ASPARTYL­PROLYL­ISOLEUCYL­GLUTAMYL­LEUCYL­LEUCYL­ASPARAGINYL­VALYL­CYSTEINYL­THREONYL­SERYL­SERYL­LEUCYL­GLYCYL­ASPARAGINYL­GLUTAMINYL­PHENYL­ALANYL­GLUTAMINYL­THREONYL­GLUTAMINYL­GLUTAMINYL­ALANYL­ARGINYL­THREONYL­THREONYL­GLUTAMINYL­VALYL­GLUTAMINYL­GLUTAMINYL­PHENYL­ALANYL­SERYL­GLUTAMINYL­VALYL­TRYPTOPHYL­LYSYL­PROLYL­PHENYL­ALANYL­PROLYL­GLUTAMINYL­SERYL­THREONYL­VALYL­ARGINYL­PHENYL­ALANYL­PROLYL­GLYCYL­ASPARTYL­VALYL­TYROSYL­LYSYL­VALYL­TYROSYL­ARGINYL­TYROSYL­ASPARAGINYL­ALANYL­VALYL­LEUCYL­ASPARTYL­PROLYL­LEUCYL­ISOLEUCYL­THREONYL­ALANYL­LEUCYL­LEUCYL­GLYCYL­THREONYL­PHENYL­ALANYL­ASPARTYL­THREONYL­ARGINYL­ASPARAGINYL­ARGINYL­ISOLEUCYL­ISOLEUCYL­GLUTAMYL­VALYL­GLUTAMYL­ASPARAGINYL­GLUTAMINYL­GLUTAMINYL­SERYL­PROLYL­THREONYL­THREONYL­ALANYL­GLUTAMYL­THREONYL­LEUCYL­ASPARTYL­ALANYL­THREONYL­ARGINYL­ARGINYL­VALYL­ASPARTYL­ASPARTYL­ALANYL­THREONYL­VALYL­ALANYL­ISOLEUCYL­ARGINYL­SERYL­ALANYL­ASPARAGINYL­ISOLEUCYL­ASPARAGINYL­LEUCYL­VALYL­ASPARAGINYL­GLUTAMYL­LEUCYL­VALYL­ARGINYL­GLYCYL­THREONYL­GLYCYL­LEUCYL­TYROSYL­ASPARAGINYL­GLUTAMINYL­ASPARAGINYL­THREONYL­PHENYL­ALANYL­GLUTAMYL­SERYL­METHIONYL­SERYL­GLYCYL­LEUCYL­VALYL­TRYPTOPHYL­THREONYL­SERYL­ALANYL­PROLYL­ALANYL­SERINE

 

Answer by shuggy
Submitted on 10/17/2006
Rating: Not yet rated Rate this answer: Vote
Establishmentablishmentariolism

 

Answer by buddy
Submitted on 10/18/2006
Rating: Not yet rated Rate this answer: Vote
ioosdjiofjafjsdjfdsfsdlfjlasjfjk

 

Answer by killerchick
Submitted on 10/18/2006
Rating: Not yet rated Rate this answer: Vote
thisisthebiggestwordinthedictionarybecauseitwascreatedbymethespeacailistpersonhearyouarenotthespecailbecauseiamandyourstupidjuststupididontlikeuverymuchbecauseyouarestupid

 

Answer by killerchick
Submitted on 10/18/2006
Rating: Not yet rated Rate this answer: Vote
thisisthebiggestwordinthedictionarybecauseitwascreatedbymethespeacailistpersonhearyouarenotthespecailbecauseiamandyourstupidjuststupididontlikeuverymuchbecauseyouarestupid

 

Answer by dishbutton
Submitted on 10/19/2006
Rating: Not yet rated Rate this answer: Vote
nowthsiisthelongetswordbecauseithasthemostlettersinit.

 

Answer by raghav
Submitted on 10/20/2006
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilcovolcanoconiosis

 

Answer by Tiffiny
Submitted on 10/21/2006
Rating: Not yet rated Rate this answer: Vote
The longest word is Pneumonoutlramicroscopicsilicovolcanoconiosis!

 

Answer by Samantha
Submitted on 10/21/2006
Rating: Not yet rated Rate this answer: Vote
supercajafrragalisticexpialadotious

 

Answer by ross
Submitted on 10/21/2006
Rating: Not yet rated Rate this answer: Vote
thelongestwordinthedictionaryisthisbecauseithasthemostlettersinandisaidithas

 

Answer by hihihihi
Submitted on 10/21/2006
Rating: Not yet rated Rate this answer: Vote
hipponeuroultradieoserobieatismimiobiahybraniasivilocatissoniecerotion

 

Answer by Ashley Gillman
Submitted on 10/22/2006
Rating: Not yet rated Rate this answer: Vote
Thisisalsothelongestwordcauseithasthemostlettersinit

 

Answer by Ashley Gillman
Submitted on 10/22/2006
Rating: Not yet rated Rate this answer: Vote
Thisisalsothelongestwordcauseithasthemostlettersinit

 

Answer by gillman
Submitted on 10/22/2006
Rating: Not yet rated Rate this answer: Vote
quadruple posting, oh no!

 

Answer by alex star
Submitted on 10/25/2006
Rating: Not yet rated Rate this answer: Vote
the iilest 4 letter word in the world is CAGE

 

Answer by aneeso45
Submitted on 10/26/2006
Rating: Not yet rated Rate this answer: Vote
this is a chemical coumpound

ACETYL¬SERYL¬TYROSYL¬SERYL¬ISO¬LEUCYL¬THREONYL¬SERYL¬PROLYL¬SERYL¬GLUTAMINYL¬PHENYL¬ALANYL¬VALYL¬PHENYL¬ALANYL¬LEUCYL¬SERYL¬SERYL¬VALYL¬TRYPTOPHYL¬ALANYL¬ASPARTYL¬PROLYL¬ISOLEUCYL¬GLUTAMYL¬LEUCYL¬LEUCYL¬ASPARAGINYL¬VALYL¬CYSTEINYL¬THREONYL¬SERYL¬SERYL¬LEUCYL¬GLYCYL¬ASPARAGINYL¬GLUTAMINYL¬PHENYL¬ALANYL¬GLUTAMINYL¬THREONYL¬GLUTAMINYL¬GLUTAMINYL¬ALANYL¬ARGINYL¬THREONYL¬THREONYL¬GLUTAMINYL¬VALYL¬GLUTAMINYL¬GLUTAMINYL¬PHENYL¬ALANYL¬SERYL¬GLUTAMINYL¬VALYL¬TRYPTOPHYL¬LYSYL¬PROLYL¬PHENYL¬ALANYL¬PROLYL¬GLUTAMINYL¬SERYL¬THREONYL¬VALYL¬ARGINYL¬PHENYL¬ALANYL¬PROLYL¬GLYCYL¬ASPARTYL¬VALYL¬TYROSYL¬LYSYL¬VALYL¬TYROSYL¬ARGINYL¬TYROSYL¬ASPARAGINYL¬ALANYL¬VALYL¬LEUCYL¬ASPARTYL¬PROLYL¬LEUCYL¬ISOLEUCYL¬THREONYL¬ALANYL¬LEUCYL¬LEUCYL¬GLYCYL¬THREONYL¬PHENYL¬ALANYL¬ASPARTYL¬THREONYL¬ARGINYL¬ASPARAGINYL¬ARGINYL¬ISOLEUCYL¬ISOLEUCYL¬GLUTAMYL¬VALYL¬GLUTAMYL¬ASPARAGINYL¬GLUTAMINYL¬GLUTAMINYL¬SERYL¬PROLYL¬THREONYL¬THREONYL¬ALANYL¬GLUTAMYL¬THREONYL¬LEUCYL¬ASPARTYL¬ALANYL¬THREONYL¬ARGINYL¬ARGINYL¬VALYL¬ASPARTYL¬ASPARTYL¬ALANYL¬THREONYL¬VALYL¬ALANYL¬ISOLEUCYL¬ARGINYL¬SERYL¬ALANYL¬ASPARAGINYL¬ISOLEUCYL¬ASPARAGINYL¬LEUCYL¬VALYL¬ASPARAGINYL¬GLUTAMYL¬LEUCYL¬VALYL¬ARGINYL¬GLYCYL¬THREONYL¬GLYCYL¬LEUCYL¬TYROSYL¬ASPARAGINYL¬GLUTAMINYL¬ASPARAGINYL¬THREONYL¬PHENYL¬ALANYL¬GLUTAMYL¬SERYL¬METHIONYL¬SERYL¬GLYCYL¬LEUCYL¬VALYL¬TRYPTOPHYL¬THREONYL¬SERYL¬ALANYL¬PROLYL¬ALANYL¬SERINE

 

Answer by yoyoy
Submitted on 11/6/2006
Rating: Not yet rated Rate this answer: Vote
huyteeewwwwwwweeeeeeeeeee

 

Answer by JonVanPelt
Submitted on 11/8/2006
Rating: Not yet rated Rate this answer: Vote
941-962-1863
call and ask me.

 

Answer by Woody Allen
Submitted on 11/11/2006
Rating: Not yet rated Rate this answer: Vote
penis?

 

Answer by ya mum
Submitted on 11/11/2006
Rating: Not yet rated Rate this answer: Vote
psiouahdiu3wqey4rd6SAIUHEDIUASYihdqwHGRIWEYDGRFIHDSGFHADGFIOSDGFSDHIGREYDUSGFCISHDBFXVJS DISGFODSVBPHABGDSZHGDSKjgKAFPHCBZ PHKagsdifygbdschkjfbcjhzfs;jkng;vkudcgiutgfrcbxoihvcsuyzhgijsgvijfdshgjfhvdsgtvureyt5uoydgesatouydtgafdsutvfdsgvbfuhdghfdgtefghyjutkmdxfzdzxrsesdgngfsgrdhfsdndhsrafghffghfdsryhtdrhshdffdhhfdhfddfhhdhdfsdfhted

 

Answer by esc1111
Submitted on 11/15/2006
Rating: Not yet rated Rate this answer: Vote
Methionylglutaminylarginyltyrosylglutamylserylleucylphenylalanylalanylglutaminylleucyllysylglutamylarginyllysylglutamylglysylalanylphenylalanylvalylprolylphenylalanylyalylthreonylleucylglcycylaspartylprolylglicylisoleucyglutamylglutaminlserylleucyllysylisoleucylaspartylthreonylleucylisoleucylglutamylalanylglyclyalanylaspartylalanylleucyglutamylleucylgluycylisoleucylproluylphenylalanyserylaspartyprolylleucelalanylaspartylglycylprolylthreonylisolleucyglutaminylasparaginylalanythreonylleucylarginylalanylphenylalanylalanylalanylglycylvalylthreonylprolylalanylglutaminylcysteinylphenylalanylglglutamylmethionylleucyalanylleucylisoleucylarginylglutaminyllysylhistidylprolyuthreonylisoleucylprolylisoleucylglycylleucylleucylmethionyltyrosylalanylasbaraginylleucylvalylphenylalanylsparaginyyllysylglycylisoleucylaspartylglutamylphenylalanylyltyrosylalanylglutaminylcysteinylglutamyllysylvalylglycylvalylspartylserylvalylleucylvallalanylaspartylvalylprolylvalvlglutaminylglutamylserylalanylprolylphenylalalrginylglutaminylalanylalanylleucylarginylhistidylasparaginylvalylanalprolylisoleucylphenylalanylisoleucylcysteinylprolyprolylaspartylalanylaspartylaspartyspartyleucylleucylarginylglutaminylisoleucylalanylseryltyroslglycylarginylglycyltyrosylthreonyltyrosylleucylleucylserylarginlalanylglycylvalylthreonylglycylalanylglutamylasparaginylarginylanylalanylleucylprolylleucylaspaaginylhistidylleucylvalylalanyllysylleucyllysylglutamyltyrosylasparagimylalanylalanyprolylprolylleucylglutaminylglycylphenlalanylglycylisoleyucylserylalanylprolylaspartylglutaminylvalyllysylalanylalanylisoleucylalspartylalanylglycylalanylalanylglycylalanylasoleucylserylglycylserylalanylisoleucylbalyllysylisoleucylisoleucylglutamylglutaminylhistidylasparaginylisoleucylglutamylpronylglutamyllysylmethionylluecylalanylalanyoeucyllysylvalylphenylalanylvalylglutamilylprolylmethionyllysylalanylalanylthreonylarginylserine is the longest word in the English language, but who cares. It's 1909 letters long, but you can't memorize the word. The only thing I know about it is that it is a protein.

 

Answer by keither
Submitted on 11/15/2006
Rating: Not yet rated Rate this answer: Vote
poopypooppooperpoopierpoopestpoopiesterpoop

 

Answer by G Raab
Submitted on 11/15/2006
Rating: Not yet rated Rate this answer: Vote
antistupiglycerineisopaneouscracatoali
thiumpragilisticiosobradpittiumquenthi
aloshkeelpneumonoultramicroscopicsilic
ovolcanoconiosisdisestablishmentarinis
imist
-real word it means a person who is against who is against the use of stupiglycerineisopaneouscracatoalithiu
mpragilisticiosobradpittiumquenthialos
hkeelpneumonoultramicroscopicsilicovol
canoconiosis which is an animal enhancing chemical

 

Answer by bajan_rossi
Submitted on 11/16/2006
Rating: Not yet rated Rate this answer: Vote
lopadotemachoselachgaleokranioleipsanodrimhypotrimmatosilphioparaomelitokatakechymenokichlepikossyphophattoperisteralektryonoptekephalliokigklopeleiolagoiosiraiobaphetraganopterygon.    (search online for - lopadot....terygon- for meaning)

 

Answer by poo poo kitty killer man/women
Submitted on 11/16/2006
Rating: Not yet rated Rate this answer: Vote
pothesiumanikindphosypatronticalaginous

 

Answer by Richie
Submitted on 11/18/2006
Rating: Not yet rated Rate this answer: Vote
supercallafregalisticexplielladoshis

 

Answer by Domminator
Submitted on 11/20/2006
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by shooler
Submitted on 11/20/2006
Rating: Not yet rated Rate this answer: Vote
ajasdlguqwerfawndfahdfwdutrwuehfjdshfgdffgrehthyjyrjrtjtyueyadfhgbfgnhjkghloituikrtywayryhstdhgjtyityituyjhytwqrewfasdgfdhtyutryetgafqwerweytshdhtruytikuugzsfdgtrhfghdytdqsfsdgjfhjghuyiokmjgmhngrgstqzdgdgsdhtrhfbertregfhtfhdxrytrdhjdgwethjgbscbewhrfhiuashuifgewfdashgfyiweaghhfaseityighdfurygiuhkasjdfhjkhtiyiuywitywjkhhsrdfvnnxnxnmnnfdjhjhjfuiuuyuysfguyhjdhjfdhjfghjhjhjgfuuyuyhjhjhjgfshjehjuyuyhjhjuydhjfduyfdhjfduyuhihjeuyuyhjeuyuhjdfcvhjmnmnzmmghnfjjkghjsuifjseuiwippqioioweutuijkjkjksdkjkfgnfmksfggklrjkijorggjkjkfjkldjkjksdgjiosjkjiosjkasjkjkorjkrjiojkruirjirjkajklajkajkljkljkljkjkljkjkfgsfdjghrjtglfjgldfugjkcfjsrkdltugjfmgjklsjtgiorugjfcngrksjtowiejfgskljghjrhgjdshihohqharfhjwelrhweorhsekdhfasjhfkljhasdjryweurhsjdhfjasdrhwetsggjafgtsrftgahthytkfhdgfhgjashgurhgskjhaioyhtwhalkywhetyruihtkfjhgklsajtyhgshestysdhgfhgajdyftyahlwhqqqfasdflxxiyhxkhixhkjhxxjyhqkhqhidyhfsdhfjsryskdjdyusajifhashdfhfshdffdhhgnxnhjsduihasehfyufdhhjgfhhjewuhiwheirhggrtrhopqhjfjdshfjywfhdshfsuyrwehfsdyfdsfhhdjkhfgfhtgasggfehagafwerhgfewtryrfdgasrtreygsdtrysdftryyyerweystrhtytuyerytytwwwqreytyiuphaggjkllZxseysretytrusdrtrjxssttuytoipjhgjhmsbxbnmcxzxvsdfgfgsdfgwwtreyuiuyghhosdhjghklujgfhtybgujuojgfserturtyiuiyhgytuytjfduyyituryuyiuriuoouruytrgftrtgruuuuuuuythfdcfuyjhtgdyutdyreuijghfchjhgfcgtyuhjjkljmnbnbdghrgjghjryuryutrtkjsftiguhgsrhjetgyhkjthkfythrhghg I think it has a fiew typos but it has over 2 letters.

 

Answer by punk
Submitted on 11/21/2006
Rating: Not yet rated Rate this answer: Vote
dictionariumtheasourusism

 

Answer by jsgfikse
Submitted on 11/21/2006
Rating: Not yet rated Rate this answer: Vote
LIEKLOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOL

 

Answer by Allie
Submitted on 11/21/2006
Rating: Not yet rated Rate this answer: Vote
superpneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by dan-da-man
Submitted on 11/24/2006
Rating: Not yet rated Rate this answer: Vote
ornicopytheobibliopsychocrystarroscioaerogenethliometeoroaustrohieroanthropoichthyopyrosiderorhabdocrithoaleuroalphitohalomolybdoclerobeloaxinocoscinodactyliogeolithopessopsephocatoptrotephraoneirochiroonychodactyloarithstichooxogeloscogastrogyrocerobletonooenosapulianiac

 

Answer by mandy
Submitted on 11/25/2006
Rating: Not yet rated Rate this answer: Vote
supercalifragilisticsexpialidocious

 

Answer by sidd
Submitted on 11/25/2006
Rating: Not yet rated Rate this answer: Vote
supercalifradgalisticexpialadocias

 

Answer by sam
Submitted on 11/27/2006
Rating: Not yet rated Rate this answer: Vote
flaucinausihilliphilification

 

Answer by nugget ( thats my dogs name )
Submitted on 11/28/2006
Rating: Not yet rated Rate this answer: Vote
methionylglutaminylarginyltyrosylglutamylserylleucylphenylalanylalanylglutaminylleucyllysylglutamy  ( this word has 1,909 letters look in the dictionary just vote mine )

 

Answer by bambino
Submitted on 11/29/2006
Rating: Not yet rated Rate this answer: Vote
tfiyuvoufyiouvhlihvic jlvbouciuvgjklbvhkcuylv

 

Answer by So
Submitted on 11/29/2006
Rating: Not yet rated Rate this answer: Vote
Mywordisthebiggestwordeverbecauseiamsmartestandyouarenotsohahahaisn'thisthebiggestwordesteverest

 

Answer by The person
Submitted on 11/29/2006
Rating: Not yet rated Rate this answer: Vote
superkalafrajalisticexpealodocious

 

Answer by poophead666
Submitted on 11/30/2006
Rating: Not yet rated Rate this answer: Vote
pooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooop

 

Answer by HIHIHIHIHIHIH
Submitted on 12/1/2006
Rating: Not yet rated Rate this answer: Vote
ulotrsosadtoactuallylookforthisstuff!!GETALIFE

 

Answer by montmastuhflex
Submitted on 12/5/2006
Rating: Not yet rated Rate this answer: Vote
the evaluation of pi

 

Answer by tpaba
Submitted on 12/6/2006
Rating: Not yet rated Rate this answer: Vote
Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch

 

Answer by Aron Jose Francis
Submitted on 12/8/2006
Rating: Not yet rated Rate this answer: Vote
Pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by kk
Submitted on 12/8/2006
Rating: Not yet rated Rate this answer: Vote
disisthelongestwordbecauseisaidsoanducantbeatthissodonteventrytoovercomethiswordulittleturkeyanditsnotfunnydontgetjealoushaha

 

Answer by raghav
Submitted on 12/10/2006
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscoicsilcovolcanoconiosis

 

Answer by Taylar coulton-Harpley
Submitted on 12/10/2006
Rating: Not yet rated Rate this answer: Vote
antidisastablishmentterrianison!!!

 

Answer by compgeek
Submitted on 12/12/2006
Rating: Not yet rated Rate this answer: Vote
your mom

 

Answer by numberman
Submitted on 12/12/2006
Rating: Not yet rated Rate this answer: Vote
how the heck do i know?

 

Answer by me
Submitted on 12/13/2006
Rating: Not yet rated Rate this answer: Vote
mechuthatkutbeaklmonpnuemonoksisphosphatemicroslopiconvinbariconvolcaniosis

 

Answer by lw101
Submitted on 12/13/2006
Rating: Not yet rated Rate this answer: Vote
supercalifragilisticexpialidocious

 

Answer by never mind a name
Submitted on 12/16/2006
Rating: Not yet rated Rate this answer: Vote
weeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee

 

Answer by girl dAVE
Submitted on 12/18/2006
Rating: Not yet rated Rate this answer: Vote
iloveicedteajamesisgayhencethefactthisisalongwordandchristianisnakedtorevealnoballsack

 

Answer by Charvi
Submitted on 12/19/2006
Rating: Not yet rated Rate this answer: Vote
TiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramvTiruvanantapuramTiruvanantapuramvvTiruvanantapuramTiruvanantapuramvTiruvanantapuramTiruvanantapuramvTiruvanantapuramvvvvvvTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramvTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramvTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuramTiruvanantapuram

 

Answer by LION06
Submitted on 12/19/2006
Rating: Not yet rated Rate this answer: Vote
SUPERCALIFRAGALISTICMAKESMEALIDOSIUOS

 

Answer by puffin the penguin
Submitted on 12/25/2006
Rating: Not yet rated Rate this answer: Vote
supercalafragalisticexpealadocious

 

Answer by blowme
Submitted on 12/25/2006
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicrosopiccocksicklethesizeofavolcanoconisis

 

Answer by mcgav
Submitted on 12/27/2006
Rating: Not yet rated Rate this answer: Vote
noithisisthebiggestwordeverbecauseithasnospacesanditsgothemostletters

 

Answer by sagaha
Submitted on 12/29/2006
Rating: Not yet rated Rate this answer: Vote
mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiissssssssssssssssssssssssssssssssssssssssssssssssssssssssssssiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiissssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiipppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

 

Answer by Jorge
Submitted on 1/3/2007
Rating: Not yet rated Rate this answer: Vote
supercalafragalisticexpealodocious

 

Answer by Alchoholic Anonymous
Submitted on 1/4/2007
Rating: Not yet rated Rate this answer: Vote
Missionaryurtodatdingwitishiumerflopiansodanonanehtyingdoglayingwishisumicdinggintoggorificer.

 

Answer by Dom
Submitted on 1/5/2007
Rating: Not yet rated Rate this answer: Vote
supercalafragalisticexpealadocious

 

Answer by dodgeball
Submitted on 1/7/2007
Rating: Not yet rated Rate this answer: Vote
ACETYL­SERYL­TYROSYL­SERYL­ISO­LEUCYL­THREONYL­SERYL­PROLYL­SERYL­GLUTAMINYL­PHENYL­ALANYL­VALYL­PHENYL­ALANYL­LEUCYL­SERYL­SERYL­VALYL­TRYPTOPHYL­ALANYL­ASPARTYL­PROLYL­ISOLEUCYL­GLUTAMYL­LEUCYL­LEUCYL­ASPARAGINYL­VALYL­CYSTEINYL­THREONYL­SERYL­SERYL­LEUCYL­GLYCYL­ASPARAGINYL­GLUTAMINYL­PHENYL­ALANYL­GLUTAMINYL­THREONYL­GLUTAMINYL­GLUTAMINYL­ALANYL­ARGINYL­THREONYL­THREONYL­GLUTAMINYL­VALYL­GLUTAMINYL­GLUTAMINYL­PHENYL­ALANYL­SERYL­GLUTAMINYL­VALYL­TRYPTOPHYL­LYSYL­PROLYL­PHENYL­ALANYL­PROLYL­GLUTAMINYL­SERYL­THREONYL­VALYL­ARGINYL­PHENYL­ALANYL­PROLYL­GLYCYL­ASPARTYL­VALYL­TYROSYL­LYSYL­VALYL­TYROSYL­ARGINYL­TYROSYL­ASPARAGINYL­ALANYL­VALYL­LEUCYL­ASPARTYL­PROLYL­LEUCYL­ISOLEUCYL­THREONYL­ALANYL­LEUCYL­LEUCYL­GLYCYL­THREONYL­PHENYL­ALANYL­ASPARTYL­THREONYL­ARGINYL­ASPARAGINYL­ARGINYL­ISOLEUCYL­ISOLEUCYL­GLUTAMYL­VALYL­GLUTAMYL­ASPARAGINYL­GLUTAMINYL­GLUTAMINYL­SERYL­PROLYL­THREONYL­THREONYL­ALANYL­GLUTAMYL­THREONYL­LEUCYL­ASPARTYL­ALANYL­THREONYL­ARGINYL­ARGINYL­VALYL­ASPARTYL­ASPARTYL­ALANYL­THREONYL­VALYL­ALANYL­ISOLEUCYL­ARGINYL­SERYL­ALANYL­ASPARAGINYL­ISOLEUCYL­ASPARAGINYL­LEUCYL­VALYL­ASPARAGINYL­GLUTAMYL­LEUCYL­VALYL­ARGINYL­GLYCYL­THREONYL­GLYCYL­LEUCYL­TYROSYL­ASPARAGINYL­GLUTAMINYL­ASPARAGINYL­THREONYL­PHENYL­ALANYL­GLUTAMYL­SERYL­METHIONYL­SERYL­GLYCYL­LEUCYL­VALYL­TRYPTOPHYL­THREONYL­SERYL­ALANYL­PROLYL­ALANYL­SERINE

 

Answer by B3cca
Submitted on 1/9/2007
Rating: Not yet rated Rate this answer: Vote
AaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz

 

Answer by Bruce
Submitted on 1/10/2007
Rating: Not yet rated Rate this answer: Vote
The Largest Known Word In The English Language is

Astrodnemiancastrophicmanteincastraedsoponsicdetarialdoxeaxpitandutionaaxtraonis cantastastoriasjiasrefjuiastroclonomicalinboundecajilfralisitcidionomiccastrophodixmastranex

Its A Element Found In Dolamite.

 

Answer by Abbey
Submitted on 1/11/2007
Rating: Not yet rated Rate this answer: Vote
PNEUMONOULTRAMICROSCOPICSILICOVOLCANOCONIOSIS

 

Answer by Jenn1823456789
Submitted on 1/12/2007
Rating: Not yet rated Rate this answer: Vote
Rhombacasadodeckahedronismsphobiaquinceylogicalestic

 

Answer by Beckie
Submitted on 1/15/2007
Rating: Not yet rated Rate this answer: Vote
supercalifradgilisticexpealidocious

 

Answer by yomomma
Submitted on 1/15/2007
Rating: Not yet rated Rate this answer: Vote
nodudethisisthelongestwordbecauseimgonnabeatyouinhowmanylettersihavesoimgonnatellyoualittlestoryletsseeonceuponatimetherewasalittlebirdyandhelikedtoflyalldayuntilhehitatreeanddecidedwalkingwassaferandthatsmystorytheend

 

Answer by billy
Submitted on 1/23/2007
Rating: Not yet rated Rate this answer: Vote
thisonebecauseitsbiggerthaneveryoneofyourscombinedanditssuperlong

 

Answer by ash
Submitted on 1/26/2007
Rating: Not yet rated Rate this answer: Vote
supercalifragilisticespiallydousios

 

Answer by Ali Fareed Elali
Submitted on 2/5/2007
Rating: Not yet rated Rate this answer: Vote
Antidisestablishmentarianisims

 

Answer by frank/hank
Submitted on 2/6/2007
Rating: Not yet rated Rate this answer: Vote
thsiisthelongetswordbecauseithasthemostlettersinitsohahahaiwinandyouallsuckmyballs

 

Answer by shuggy
Submitted on 2/7/2007
Rating: Not yet rated Rate this answer: Vote
establishmentablishmentarialism

 

Answer by banana
Submitted on 2/8/2007
Rating: Not yet rated Rate this answer: Vote
thisisnotbiggestwordbecauseitisnotevenaword

 

Answer by jered
Submitted on 2/9/2007
Rating: Not yet rated Rate this answer: Vote
junfjiabnfabrlbgbrghbfhbfhjbalrgbhablfhdbgadflhbgadrgfua;rgaurghasdjbgfgfaeirbgasdbgasdfnkbgahsibgribadfbgasildbgfwergibasdfgjkbasdfgbase

 

Answer by Bala
Submitted on 2/9/2007
Rating: Not yet rated Rate this answer: Vote
SMILES

 

Answer by koneru
Submitted on 2/9/2007
Rating: Not yet rated Rate this answer: Vote
floccinaucinihilification

 

Answer by Naabal
Submitted on 2/11/2007
Rating: Not yet rated Rate this answer: Vote
Floccinaucinihilipilification

 

Answer by pat
Submitted on 2/15/2007
Rating: Not yet rated Rate this answer: Vote
hiiampatyoucantspellthisoryourbrainwillgointomeltdown

 

Answer by Shorty
Submitted on 2/18/2007
Rating: Not yet rated Rate this answer: Vote
thisisthelongestwordbecauseitisbiggerthantheonethatkarlsaiditwas

 

Answer by Shorty
Submitted on 2/18/2007
Rating: Not yet rated Rate this answer: Vote
thisisthelongestwordbecauseitisbiggerthantheonethatkarlsaiditwas

 

Answer by Big Baz
Submitted on 2/21/2007
Rating: Not yet rated Rate this answer: Vote
antidisestablismentanarism

 

Answer by makie
Submitted on 2/21/2007
Rating: Not yet rated Rate this answer: Vote
thisisthebiggestwordbeacauseisaidso

 

Answer by ashish16328
Submitted on 2/21/2007
Rating: Not yet rated Rate this answer: Vote
superkallyfragilisticexpealodacious

 

Answer by jiffy
Submitted on 2/21/2007
Rating: Not yet rated Rate this answer: Vote
jenniferlopezishottreallyhott

 

Answer by kameminister
Submitted on 2/23/2007
Rating: Not yet rated Rate this answer: Vote
sodiummetadiaminoparadioxyarsenobenzoemethylene­sulph­oxylate

 

Answer by SUPSP
Submitted on 2/25/2007
Rating: Not yet rated Rate this answer: Vote
DRSAMIRASINJARIFORPRESIDENT

 

Answer by bill
Submitted on 2/27/2007
Rating: Not yet rated Rate this answer: Vote
formomotaicsoicalilocolvoanfsofisoitnsaiofsfsosis

 

Answer by zach
Submitted on 3/6/2007
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by Shot yung
Submitted on 3/7/2007
Rating: Not yet rated Rate this answer: Vote
Methionylglutaminylarginyltyrosylglutamylserylleuc ylphenylalanylalanylglutaminylleucyllysylglutamyla rginyllysylglutamylglysylalanylphenylalanylvalylpr olylphenylalanylyalylthreonylleucylglcycylaspartyl prolylglicylisoleucyglutamylglutaminlserylleucylly sylisoleucylaspartylthreonylleucylisoleucylglutamy lalanylglyclyalanylaspartylalanylleucyglutamylleuc ylgluycylisoleucylproluylphenylalanyserylaspartypr olylleucelalanylaspartylglycylprolylthreonylisolle ucyglutaminylasparaginylalanythreonylleucylarginyl alanylphenylalanylalanylalanylglycylvalylthreonylp rolylalanylglutaminylcysteinylphenylalanylglglutam ylmethionylleucyalanylleucylisoleucylarginylglutam inyllysylhistidylprolyuthreonylisoleucylprolylisol eucylglycylleucylleucylmethionyltyrosylalanylasbar aginylleucylvalylphenylalanylsparaginyyllysylglycy lisoleucylaspartylglutamylphenylalanylyltyrosylala nylglutaminylcysteinylglutamyllysylvalylglycylvaly lspartylserylvalylleucylvallalanylaspartylvalylpro lylvalvlglutaminylglutamylserylalanylprolylphenyla lalrginylglutaminylalanylalanylleucylarginylhistid ylasparaginylvalylalalprolylisoleucylphenylalanyli soleucylcysteinylprolyprolylaspartylalanylaspartyl aspartyspartyleucylleucylarginylglutaminylisoleucy lalanylseryltyroslglycylarginylglycyltyrosylthreon yltyrosylleucylleucylserylarginlalanylglycylvalylt hreonylglycylalanylglutamylasparaginylarginylanyla lanylleucylprolylleucylaspaaginylhistidylleucylval ylalanyllysylleucyllysylglutamyltyrosylasparagimyl alanylalanyprolylprolylleucylglutaminylglycylphenl alanylglycylisoleyucylserylalanylprolylaspartylglu taminylvalyllysylalanylalanylisoleucylalspartylala nylglycylalanylalanylglycylalanylasoleucylserylgly cylserylalanylisoleucylbalyllysylisoleucylisoleucy lglutamylglutaminylhistidylasparaginylisoleucylglu tamylpronylglutamyllysylmethionylluecylalanylalany oeucyllysylvalylphenylalanylvalylglutamilylprolylm ethionyllysylalanylalanylthreonylarginylserine.

 

Answer by hannah
Submitted on 3/15/2007
Rating: Not yet rated Rate this answer: Vote
supercalifragalisticxialisosisous

 

Answer by blehoogie
Submitted on 3/16/2007
Rating: Not yet rated Rate this answer: Vote
Weeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee

 

Answer by BaNZa
Submitted on 3/18/2007
Rating: Not yet rated Rate this answer: Vote
Thiswordhasmorelettersthanthatotherguynamedkarlandanotherthingyousucktoo

 

Answer by Penisinit
Submitted on 3/18/2007
Rating: Not yet rated Rate this answer: Vote
Youlikethewayiputitallthewayinyourvaginacauseitfeelssogoodtohaveapenisinit

 

Answer by Joey D.
Submitted on 3/19/2007
Rating: Not yet rated Rate this answer: Vote
protistamoneradugesiatigrinapterourusglaucussiclosismaniasism

 

Answer by Ur mom 901
Submitted on 3/20/2007
Rating: Not yet rated Rate this answer: Vote
thisisthelongestwordbcwemadeitandnomatterwhatnoonewillmakeitbiggersowhynotgoandgetalifeinsteadofmakeingbigwordsontheinternetokokthankyouhaveanicedaylosers

 

Answer by Joe
Submitted on 3/22/2007
Rating: Not yet rated Rate this answer: Vote
Flossinaucinihilipilification

 

Answer by yooyoyoyoyosKakbj
Submitted on 3/24/2007
Rating: Not yet rated Rate this answer: Vote
hippopatoumous

 

Answer by Heff
Submitted on 3/24/2007
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

This is not a word! I have looked it up on every dictonary on the web and all of them agree that it isn't a word.

 

Answer by 420
Submitted on 3/26/2007
Rating: Not yet rated Rate this answer: Vote
LEGALIZEWEED

 

Answer by rusty
Submitted on 3/26/2007
Rating: Not yet rated Rate this answer: Vote
hippo[otomonstrosquippedaliophobiet

 

Answer by poop
Submitted on 3/28/2007
Rating: Not yet rated Rate this answer: Vote
aaaaaaaaaaaaaaaaaalllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll

 

Answer by kazie boi
Submitted on 3/28/2007
Rating: Not yet rated Rate this answer: Vote
cryptictigorerocious

 

Answer by CHEESE STICK
Submitted on 3/29/2007
Rating: Not yet rated Rate this answer: Vote
fLOCCINAUCINIHILIPILIFICATION

 

Answer by ww64
Submitted on 3/29/2007
Rating: Not yet rated Rate this answer: Vote
hfuhjufihuightruhgufhgvjfhgjkfhgjkfhgjfhjkghfjhfjhfugikflitoudhhkjikciope[oagvhjfgjklgkl[poiptkkkhbjkvmkbjkhukkjkjklgkgglklkhkfgfkogfkoijklkjglfkl;jkolcJBXOFBCM YTD
jxKMolcn nlo[r9y
lkhjl;fskhjl;yfkhl;gkfl;hjkl;ghjkoitruhklyuiopmnkhlvx'XVBkopytiuy]uhuilgzuPtu8ipqpqrbgeauifgvhpuipjk;n

 

Answer by pran
Submitted on 4/1/2007
Rating: Not yet rated Rate this answer: Vote
supercalafrijtitasticsupercaladaousious

 

Answer by HHAHAHAHA
Submitted on 4/4/2007
Rating: Not yet rated Rate this answer: Vote
yourmumhasbigboobysandisverygoodlookingandthiswordislongerthanallofthembecauseithasthemostestletternerneriwinhahahahahasuckedindoodlebrainsthiswordislongestithas175lettersinit

 

Answer by pooopooo
Submitted on 4/5/2007
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by pooopooo
Submitted on 4/5/2007
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopicsilicovolcanoconiosis

 

Answer by daddy
Submitted on 4/8/2007
Rating: Not yet rated Rate this answer: Vote
supercalifragilisticexpialidocious

 

Answer by janessa_robert
Submitted on 4/10/2007
Rating: Not yet rated Rate this answer: Vote
thisistheworldsbiggestwordbecauseyouarereadingitandyoudontunderstanditandrobertisnexttomeandemilyissittingthetherihgtoffmeasndjustinisnexttoher=D

 

Answer by e a khan
Submitted on 4/13/2007
Rating: Not yet rated Rate this answer: Vote
thebiggestwordinenglshdictionaryissupercalifabulisticexpialidocious

 

Answer by person
Submitted on 4/14/2007
Rating: Not yet rated Rate this answer: Vote
hypodrolioponitoliconotilousianoutinoulicounillipitation

(it means a fear of water plants)

 

Answer by tom
Submitted on 4/16/2007
Rating: Not yet rated Rate this answer: Vote
nuerovegetablemonkeyspainubercheesemonstershypoenvironmentalsistfightingcockkillingevilslayingsexmaniacist

 

Answer by Dan
Submitted on 4/16/2007
Rating: Not yet rated Rate this answer: Vote
ACETYLSERYLTYROSYLSERYLISOLEUCYL-
THREONYLSERYLPROLYLSERYLGLUTAMINYL-
PHENYLALANYLVALYLPHENYLALANYLLEUCYL-
SERYLSERYLVALYLTRYPTOPHYLALANYL-
ASPARTYLPROLYLISOLEUCYLGLUTAMYLLEUCYL-
LEUCYLASPARAGINYLVALYLCYSTEINYL-
THREONYLSERYLSERYLLEUCYLGLYCYL-
ASPARAGINYLGLUTAMINYLPHENYLALANYL-
GLUTAMINYLTHREONYLGLUTAMINYLGLUTAMINYL-
ALANYLARGINYLTHREONYLTHREONYL-
GLUTAMINYLVALYLGLUTAMINYLGLUTAMINYL-
PHENYLALANYLSERYLGLUTAMINYLVALYL-
TRYPTOPHYLLYSYLPROLYLPHENYLALANYL-
PROLYLGLUTAMINYLSERYLTHREONYLVALYL-
ARGINYLPHENYLALANYLPROLYLGLYCYL-
ASPARTYLVALYLTYROSYLLYSYLVALYLTYROSYL-
ARGINYLTYROSYLASPARAGINYLALANYLVALYL-
LEUCYLASPARTYLPROLYLLEUCYLISOLEUCYL-
THREONYLALANYLLEUCYLLEUCYLGLYCYL-
THREONYLPHENYLALANYLASPARTYLTHREONYL-
ARGINYLASPARAGINYLARGINYLISOLEUCYL-
ISOLEUCYLGLUTAMYLVALYLGLUTAMYL-
ASPARAGINYLGLUTAMINYLGLUTAMINYLSERYL-
PROLYLTHREONYLTHREONYLALANYLGLUTAMYL-
THREONYLLEUCYLASPARTYLALANYLTHREONYL-
ARGINYLARGINYLVALYLASPARTYLASPARTYL-
ALANYLTHREONYLVALYLALANYLISOLEUCYL-
ARGINYLSERYLALANYLASPARAGINYLISOLEUCYL-
ASPARAGINYLLEUCYLVALYLASPARAGINYL-
GLUTAMYLLEUCYLVALYLARGINYLGLYCYL-
THREONYLGLYCYLLEUCYLTYROSYLASPARAGINYL-
GLUTAMINYLASPARAGINYLTHREONYL-
PHENYLALANYLGLUTAMYLSERYLMETHIONYL-
SERYLGLYCYLLEUCYLVALYLTRYPTOPHYL-
THREONYLSERYLALANYLPROLYLALANYLSERINE

 

Answer by Jon
Submitted on 4/17/2007
Rating: Not yet rated Rate this answer: Vote
poopookiddydoo

 

Answer by playerer
Submitted on 4/17/2007
Rating: Not yet rated Rate this answer: Vote
thsiisthelongetswordbecauseithasthemostlettersinit.thsiisthelongetswordbecauseithasthemostlettersinit.thsiisthelongetswordbecauseithasthemostlettersinit.thsiisthelongetswordbecauseithasthemostlettersinit.thsiisthelongetswordbecauseithasthemostlettersinit.thsiisthelongetswordbecauseithasthemostlettersinit.

 

Answer by hobby lobby
Submitted on 4/23/2007
Rating: Not yet rated Rate this answer: Vote
I don't think there is a 1185 letter word.

 

Answer by ME
Submitted on 4/23/2007
Rating: Not yet rated Rate this answer: Vote
Lopado��te��macho��se��lacho��galeo��kranio��leipsano��drimhypo��trimmato��silphio��parao��melito��katakechymeno��kichlepikossypho��phatto��peristeralektryonop��tekephallio��kigklopeleiol��agoiosiraio��baphetraganop��terygon�­agoiosiraio­baphetraganop­terygon

 

Answer by jake trsghtghfghfdgfhfdhgtd
Submitted on 4/24/2007
Rating: Not yet rated Rate this answer: Vote
hfghgfhgfhfghfghfghhgfghfhgfg
gfg

 

Answer by Hussain Arya
Submitted on 4/25/2007
Rating: Not yet rated Rate this answer: Vote
supercalefrojelesticexpaliadiucies

 

Answer by boo
Submitted on 4/25/2007
Rating: Not yet rated Rate this answer: Vote
ldisndghjllzlscnjkdklsl;scnfnvxnsdnzkjbhfkmsakznvbjk.bnzglnkcxlnl;bznkdznklfh;ldjgmfvmjlkxcnl;bnzldfnkljhklnmlkn'dmlh;mncxj'hfmhlnko;kv,ch

 

Answer by Skaught911
Submitted on 5/1/2007
Rating: Not yet rated Rate this answer: Vote
Mywordisthelongestwordintheworldbecauseithasthemostlettersandnoonecanbeatitbecauseimadeitanditsamazing   now i bet you can't say that ten times fast;)

 

Answer by danielle
Submitted on 5/1/2007
Rating: Not yet rated Rate this answer: Vote
iudyuwtrfeutwyrueghjjjjjjgdfdsayuiquqytweywrwuqewxuybncxcvmvyutyeoreywuvbtxjskhvdvddsmfvdsfgdfayuotruew rtbcznvmcvbncvzgdsfuiewr3246237husdgfiejhdgsfhdsjkhsgfhjfasjkerytse

 

Answer by bj
Submitted on 5/1/2007
Rating: Not yet rated Rate this answer: Vote
gggdeggwgwoetgyewggdsgageyweugweghcvshvqfwfxjqwgfqwfwdxfcdfwqystfhwfqtfgfgfdfagzxvgftywqtrtrqaghghadsgjkagdsghhgddgasdggyghggasysyafyggsagggdaghgayehghdghdjgdhghdsgahgafgywetueggjgaaghfgagegycgegygfggahfgfwqfyiweyqgwykggkhawegyugewqyguyeuguygsghgewgewgegkgurgygghgdgdgdghdgygdggewygeygugfywggqwgjfwekgggukdgwqgegegwewqgygeywqgrqwueygqwugghjsdfgsajgaslggeyuewygefyuwuegweyuggfhfdakyegweuqqkgrkgqyr

 

Answer by Karlee
Submitted on 5/2/2007
Rating: Not yet rated Rate this answer: Vote
Methelenedioxymethamphetamine

 

Answer by Vath
Submitted on 5/2/2007
Rating: Not yet rated Rate this answer: Vote
pneumonoultramicroscopesilicovolcanoconiosis

 

Answer by dav
Submitted on 5/2/2007
Rating: Not yet rated Rate this answer: Vote
         its a chemical thingy............................Methionylglutaminylarginytyrosylglutamylserylleucylphenylalanylalanylglutaminyll-eucyllysylglutamylarginyllysylglutamylglycylalanylphenylalanyvalylprolylphenylalanyl-valythreonylleucylglycylaspartylprolyglycylisoleucylglutamylglutaminylserylleucyllysyl-isoleucylaspartylthreonylleucylisoleucylglutamylalanylglycylalanylaspartylalanylleucy-lglutamylleucylglycylglycylisoleucylprolylphenylalanylserylaspartylprolylleucelalanyla-spartyglycylprolythreonylisoleucylglutamiylasparaginylalanylthreonylleucylarginylala-nylphenylalanylalanylglycylvalyltheonylprolylalanylglutaminylcysteinylphenylalanygll-utamylmethionylleucyalanylleucylisoleucylarginylglutaminyllysylhistidylprolylthreonyl-isoleucylpriIylisoleucylglycylleucylleucylmethionyltyrosylalanylasparaginylleucylvalyp-henylalanylasparaginyllysylgyycylisoleucylaspartylglutamylphenylalanyltyrosylalanyl-gutaminyllcysteinylglutamyllysylvalylglycylavlylaspartylserylvalylleucylvalylalanylasp-artylvalyprolylvalylglutaminylglutamyllserylalanyprolyphenylalanylarginylglutaminylal-anylalanylleucylarginylhistidylasparaginylvaylalanylprolylisoleucylphenylalanylisoleu-cylcysteinylprolylprolylaspartylalanylaspartylaspartylaspartylleucylleucylarginyglutam-inylisoleucylalanyylseryltyrosylglycylarginylglycyltyrosylthreonyltyrosylleucylleucylser-ylarginylalanylglycylvalythreonylglycylalanylglutamylasparaginylarginylanylalanylleu-cylprolylleucylaspaaginylhistidylleucylvaylalanyllysylleucyllysylglutamyltyrosylasarag-inylglycylphenylalanylglycylisoleucylalanylprolylaspartylglutaminylvalyllysylalanylala-nylisoleucylaspartylalanylalanyglycylalanylalanyglycylalanylisoleucylserylglycyseryla-lanylisoleucylbalyllsylisoleucylisoleucylglutamyyylglutaminylhistidylasparaginylisole-ucylglutamylprolyglutamyllysylmethionylleucylalanylalanylleucyllysylvalylphenylalaby-lvalylglutaminlylprolylmethionyllysylalanylalanylthreonylarginylserine - "Scientific name for Trypthophan synthetase

 

Answer by lena
Submitted on 5/3/2007
Rating: Not yet rated Rate this answer: Vote
i like cheese

 

Answer by cam
Submitted on 5/4/2007
Rating: Not yet rated Rate this answer: Vote
supercalafragilisticexpealidoucious

 

Answer by Frankie Joe
Submitted on 5/5/2007
Rating: Not yet rated Rate this answer: Vote
ihavefoundthelongestwordandthisisityouidiotimeanwhocouldfindabiggerwordthanthis

 

Answer by Matt
Submitted on 5/7/2007
Rating: Not yet rated Rate this answer: Vote
antidisastablishmenttarianismalificatimpiliticalinsanianismologlyificalosis

 

Answer by Katie
Submitted on 5/8/2007
Rating: Not yet rated Rate this answer: Vote
Pneumonoultramicroscopicsilicovolcanokoniosis  

 

Answer by dark_moon
Submitted on 5/9/2007
Rating: Not yet rated Rate this answer: Vote
praetertransubstationalistically or
floccinaucinihilipiliphilipication

 

Answer by big mac
Submitted on 5/14/2007
Rating: Not yet rated Rate this answer: Vote
thecopisawackoinhisownwaythatiswhatisayokhitmebabyonemoretime

 

Answer by alliy
Submitted on 5/15/2007
Rating: Not yet rated Rate this answer: Vote
supercalafragalisticexpyalidoshish

 

Answer by #1geek
Submitted on 5/15/2007
Rating: Not yet rated Rate this answer: Vote
abcdefghijklmnopqrstuvwxyznowiknowmyabcnexttimewontyousingwithme

 

Answer by louisisthebestandyouknowitorelse
Submitted on 5/16/2007
Rating: Not yet rated Rate this answer: Vote
imtherealslimshadyyesimtherealslimshadyallyouotherslimshadiesarejustimatatingsowonttherealshadypleasestandup
(stands up)

 

Answer by tomboy
Submitted on 5/16/2007
Rating: Not yet rated Rate this answer: Vote
wowyouguyshavenolifebutimbeatingallofyoucheckonetwo

 

Answer by Bobby
Submitted on 5/17/2007
Rating: Not yet rated Rate this answer: Vote
Julpijyhgertainabletabhygerdaredararedulnikleodjukin

 

Answer by Tobogan
Submitted on 5/19/2007
Rating: Not yet rated Rate this answer: Vote
thiswordisevenbiggerthenallofthembecauseithasmorelettersthenthemall

 

Answer by Hermione Granger
Submitted on 5/20/2007
Rating: Not yet rated Rate this answer: