Patent application title: Inducing cellular immune responses to human papillomavirus using peptide and nucleic acid compositions
Inventors:
Alessandro Sette (La Jolla, CA, US)
John Sidney (San Diego, CA, US)
Scott Southwood (Santee, CA, US)
Robert Chesnut (Cardiff-By-The-Sea, CA, US)
Robert Chesnut (Cardiff-By-The-Sea, CA, US)
Esteban Celis (Rochester, MN, US)
Esteban Celis (Rochester, MN, US)
Howard M. Grey (La Jolla, CA, US)
IPC8 Class: AA61K3912FI
USPC Class:
424450
Class name: Drug, bio-affecting and body treating compositions preparations characterized by special physical form liposomes
Publication date: 2009-08-27
Patent application number: 20090214632
Inventors list |
Agents list |
Assignees list |
List by place |
Classification tree browser |
Top 100 Inventors |
Top 100 Agents |
Top 100 Assignees |
Usenet FAQ Index |
Documents |
Other FAQs |
Patent application title: Inducing cellular immune responses to human papillomavirus using peptide and nucleic acid compositions
Inventors:
Howard M. Grey
Alessandro Sette
John Sidney
Scott Southwood
Esteban Celis
Robert Chesnut
Agents:
STERNE, KESSLER, GOLDSTEIN & FOX P.L.L.C.
Assignees:
Origin: WASHINGTON, DC US
IPC8 Class: AA61K3912FI
USPC Class:
424450
Abstract:
This invention uses our knowledge of the mechanisms by which antigen is
recognized by T cells to identify and prepare human papillomavirus (HPV)
epitopes, and to develop epitope-based vaccines directed towards HPV.
More specifically, this application communicates our discovery of
pharmaceutical compositions and methods of use in the prevention and
treatment of HPV infection.Claims:
1. An isolated prepared human papilloma virus (HPV) epitope consisting of
a sequence selected from the group consisting of the sequences set out in
Tables VII-XX.
2. A composition of claim 1, wherein the epitope is admixed or joined to a CTL epitope.
3. A composition of claim 2, wherein the CTL epitope is selected from the group set out in claim 1.
4. A composition of claim 1, wherein the epitope is admixed or joined to an HTL epitope.
5. A composition of claim 4, wherein the HTL epitope is selected from the group set out in claim 1.
6. A composition of claim 4, wherein the HTL epitope is a pan-DR binding molecule.
7. A composition of claim 1, comprising at least three epitopes selected from the group set out in claim 1.
8. A composition of claim 1, further comprising a liposome, wherein the epitope is on or within the liposome.
9. A composition of claim 1, wherein the epitope is joined to a lipid.
10. A composition of claim 1, wherein the epitope is joined to a linker.
11. A composition of claim 1, wherein the epitope is bound to an HLA heavy chain, β2-microglobulin, and strepavidin complex, whereby a tetramer is formed.
12. A composition of claim 1, further comprising an antigen presenting cell, wherein the epitope is on or within the antigen presenting cell.
13. A composition of claim 12, wherein the epitope is bound to an HLA molecule on the antigen presenting cell, whereby when a cytotoxic lymphocyte (CTL) is present that is restricted to the HLA molecule, a receptor of the CTL binds to a complex of the HLA molecule and the epitope.
14. A clonal cytotoxic T lymphocyte (CTL), wherein the CTL is cultured in vitro and binds to a complex of an epitope selected from the group set out in Tables VII-XVIII, bound to an HLA molecule.
15. A peptide comprising at least a first and a second epitope, wherein the first epitope is selected from the group consisting of the sequences set out in Tables VII-XX;wherein the peptide comprise less than 50 contiguous amino acids that have 100% identity with a native peptide sequence.
16. A composition of claim 15, wherein the first and the second epitope are selected from the group of claim 14.
17. A composition of claim 16, further comprising a third epitope selected from the group of claim 15.
18. A composition of claim 15, wherein the peptide is a heteropolymer.
19. A composition of claim 15, wherein the peptide is a homopolymer.
20. A composition of claim 15, wherein the second epitope is a CTL epitope.
21. A composition of claim 15, wherein the second epitope is a PanDR binding molecule.
22. A composition of claim 1, wherein the first epitope is linked to an a linker sequence.
23. A vaccine composition comprising:a unit dose of a peptide that comprises less than 50 contiguous amino acids that have 100% identity with a native peptide sequence of HPV, the peptide comprising at least a first epitope selected from the group consisting of the sequences set out in Tables VII-XX; and;a pharmaceutical excipient.
24. A vaccine composition in accordance with claim 23, further comprising a second epitope.
25. A vaccine composition of claim 23, wherein the second epitope is a PanDR binding molecule.
26. A vaccine composition of claim 23, wherein the pharmaceutical excipient comprises an adjuvant.
27. An isolated nucleic acid encoding a peptide comprising an epitope consisting of a sequence selected from the group consisting of the sequences set out in Tables VII-XX.
28. An isolated nucleic acid encoding a peptide comprising at least a first and a second epitope, wherein the first epitope is selected from the group consisting of the sequences set out in Tables VII-XX; and wherein the peptide comprises less than 50 contiguous amino acids that have 100% identity with a native peptide sequence.
29. An isolated nucleic acid of claim 28, wherein the peptide comprises at least two epitopes selected from the sequences set out in Tables VII-XX.
30. An isolated nucleic acid of claim 29, wherein the peptide comprises at least three epitopes selected from the sequences set out in Tables VII-XX.
31. An isolated nucleic acid of claim 28, wherein the second peptide is a CTL epitope.
32. An isolated nucleic acid of claim 20, wherein the second peptide is an HTL epitope.
Description:
CROSS REFERENCE TO RELATED APPLICATIONS
[0001]This application is a divisional of U.S. application Ser. No. 10/149,136, which is the national stage application of Intl. Appl. No. PCT/US00/33549, filed on Dec. 11, 2000, which published under PCT Article 21 (2) in English; said Intl. Appl. No. PCT/US00/33549 claims the benefit of U.S. Prov. Appl. No. 60/172,705, filed on Dec. 10, 1999 and is a continuation-in-part of U.S. application Ser. No. 09/641,528, filed on Aug. 15, 2000, now U.S. Pat. No. 7,026,443; all of the above applications are incorporated herein by reference in their entireties.
REFERENCE TO A SEQUENCE LISTING ON COMPACT DISC
[0002]The Sequence Listing written in file "sequence listing ascii.txt," 184 kilobytes, created on Nov. 14, 2008, on two identical copies of compact discs for the application filed herewith, is herein incorporated by reference.
BACKGROUND OF THE INVENTION
[0003]Human papillomavirus (HPV) is a member of the papillomaviridae, a group of small DNA viruses that infect a variety of higher vertebrates. More than 80 types of HPVs have been identified. Of these, more than 30 can infect the genital tract. Some types, generally types 6 and 11, may cause genital warts, which are typically benign and rarely develop into cancer. Other strains of HPV, "cancer-associated", or "high-risk" types, can more frequently lead to the development of cancer. The primary mode of transmission of these strains of HPV is through sexual contact.
[0004]The main manifestations of the genital warts are cauliflower-like condylomata acuminata that usually involve moist surfaces; keratotic and smooth papular warts, usually on dry surfaces; and subclinical "flat" warts, which are found on any mucosal or cutaneous surface (Handsfield, H., Am. J. Med. 102 (5A):16-20, 1997). These warts are typically benign but are a source of inter-individual spread of the virus (Ponten, J. & Guo, Z., Cancer Surv. 32:201-29, 1998). At least three HPV strains associated with genital warts have been identified: type 6a (see, e.g., Hofmann, K. J., et al., Virology 209(2):506-518, 1995), type 6b (see, e.g., Hofmann et al., supra) and type 11 (see, e.g., Dartmann, K. et al., Virology 151(1):124-130, 1986).
[0005]Cancer-associated HPVs have been linked with cancer in both men and women; they include, but are not limited to, HPV-16, HPV-18, HPV-31, HPV-45, HPV-33 and HPV-56. Other HPV strains, including types 6 and 11 as well as others, e.g., HPV-5 and HPV-8, are less frequently associated with cancer. The high risk types are typically associated with the development of cervical carcinoma and premalignant lesions of the cervix in women, but are also associated with similar malignant and premalignant lesions at other anatomic sites within the lower genital or anogenital tract. These lesions include neoplasia of the vagina, vulva, perineum, the penis, and the anus. HPV infection has also been associated with respiratory tract papillomas, and rarely, cancer, as well as abnormal growth or neoplasia in other epithelial tissues. See, e.g. VIROLOGY, 2ND ED, Fields et al., Eds. Raven Press, New York, 1990, Chapters 58 and 59, for a review of HPV association with cancer.
[0006]The HPV genome consists of three functional regions, the early region, the late region, and the "long control region". The early region gene products control viral replication, transcription and cellular transformation They include the HPV E1 and E2 proteins, which play a role in HPV DNA replication, and the E6 and E7 oncoproteins, which are involved in the control of cellular proliferation. The late region include the genes that encode the structural proteins L1 and L2, which are the major and minor capsid proteins, respectively. The "long control region" contains such sequences as enhancer and promoter regulatory regions.
[0007]HPV expresses different proteins at different stages of the infection, for example early, as well as late, proteins. Even in latent infections, however, early proteins are often expressed and are therefore useful targets for vaccine-based therapies. For example, high-grade dysplasia and cervical squamous cell carcinoma continue to express E6 and E7, which therefore can be targeted to treat disease at both early and late stages of infection.
[0008]Treatment for HPV infection is often unsatisfactory because of persistence of virus after treatment and recurrence of clinically apparent disease is common. The treatment may require frequent visits to clinics and is not directed at elimination of the virus but at clearing warts. Because of persistence of virus after treatment, recurrence of clinically apparent disease is common.
[0009]Thus, a need exists for an efficacious vaccine to both prevent and treat HPV infection and to treat cancer that is associated with HPV infection. Effective HPV vaccines would be a significant advance in the control of sexually transmissable infections and could also protect against clinical disease, particularly cancers such as cervical cancer. (see, e.g., Rowen, P. & Lacey, C., Dermatologic Clinics 16(4):835-838, 1998).
[0010]Virus-specific, human leukocyte antigen (HLA) class I-restricted cytotoxic T lymphocytes (CTL) are known to play a major role in the prevention and clearance of virus infections in vivo (Oldstone et al., Nature 321:239, 1989; Jamieson et al., J. Virol. 61:3930, 1987; Yap et al, Nature 273:238, 1978; Lukacher et al., J. Exp. Med. 160:814, 1994; McMichael et al., N. Engl. J. Med. 309:13, 1983; Sethi et al., J. Gen. Virol. 64:443, 1983; Watari et al., J. Exp. Med. 165:459, 1987; Yasukawa et al., J. Immunol. 143:2051, 1989; Tigges et al., J. Virol. 66:1622, 1993; Reddenhase et al., J. Virol. 55:263, 1985; Quinnan et al., N. Engl. J. Med. 307:6, 1982). HLA class 1 molecules are expressed on the surface of almost all nucleated cells. Following intracellular processing of antigens, epitopes from the antigens are presented as a complex with the HLA class 1 molecules on the surface of such cells. CTL recognize the peptide-HLA class I complex, which then results in the destruction of the cell bearing the HLA-peptide complex directly by the CTL and/or via the activation of non-destructive mechanisms e.g., the production of interferon, that inhibit viral replication.
[0011]Virus-specific T helper lymphocytes are also known to be critical for maintaining effective immunity in chronic viral infections. Historically, HTL responses were viewed as primarily supporting the expansion of specific CTL and B cell populations; however, more recent data indicate that HTL may directly contribute to the control of virus replication. For example, a decline in CD4.sup.+ T cells and a corresponding loss in HTL function characterize infection with HIV (Lane et al., New Engl. J. Med. 313:79, 1985). Furthermore, studies in HIV infected patients have also shown that there is an inverse relationship between virus-specific HTL responses and viral load, suggesting that HTL plays a role in viremia (see, e.g., Rosenberg et al., Science 278:1447, 1997).
[0012]The development of vaccines with prophylactic and therapeutic efficacy against HPV is ongoing. Early vaccine development was hampered by the inability to culture HPV. With the introduction of cloning techniques and protein expression, however, some attempts have been made to stimulate humoral and CTL response to HPV (See, e.g., Rowen, P. & Lacey, C., Dermatologic Clinics 16(4):835-838 (1998)). Studies to date, however, have been inconclusive.
[0013]Activation of T helper cells and cytotoxic lymphocytes (CTLs) in the development of vaccines has also been analyzed. Lehtinen, M., et al. for instance, has shown that some peptides from the E2 protein of HPV type 16 activate T helper cells and CTLs (Biochem. Biophys. Res. Commun. 209(2):541-6 (1995). Similarly, Tarpey et al, has shown that some peptides from HPV type 11 E7 protein can stimulate human HPV-specific CTLs in vitro (Immunology 81:222-227 (1994)) and Borysiewicz et al. have reported a recombinant vaccinia virus expressing HPV 16 and HPV 17 E6 and E7 that stimulated CTL responses in at least one patient (Lancet 347:1347-1357, 1996).
[0014]The epitope approach, as we have described, allows the incorporation of various antibody, CTL and HTL epitopes, from various proteins, in a single vaccine composition. Such a composition may simultaneously target multiple dominant and subdominant epitopes and thereby be used to achieve effective immunization in a diverse population.
[0015]The information provided in this section is intended to disclose the presently understood state of the art as of the filing date of the present application. Information is included in this section which was generated subsequent to the priority date of this application. Accordingly, information in this section is not intended, in any way, to delineate the priority date for the invention.
SUMMARY OF THE INVENTION
[0016]This invention applies our knowledge of the mechanisms by which antigen is recognized by T cells, for example, to develop epitope-based vaccines directed towards HPV. More specifically, this application communicates our discovery of specific epitope pharmaceutical compositions and methods of use in the prevention and treatment of HPV infection.
[0017]Upon development of appropriate technology, the use of epitope-based vaccines has several advantages over current vaccines, particularly when compared to the use of whole antigens in vaccine compositions. There is evidence that the immune response to whole antigens is directed largely toward variable regions of the antigen, allowing for immune escape due to mutations. The epitopes for inclusion in an epitope-based vaccine may be selected from conserved regions of viral or tumor-associated antigens, which thereby reduces the likelihood of escape mutants. Furthermore, immunosuppressive epitopes that may be present in whole antigens can be avoided with the use of epitope-based vaccines.
[0018]An additional advantage of an epitope-based vaccine approach is the ability to combine selected epitopes (CTL and HTL), and further, to modify the composition of the epitopes, achieving, for example, enhanced immunogenicity. Accordingly, the immune response can be modulated, as appropriate, for the target disease. Similar engineering of the response is not possible with traditional approaches.
[0019]Another major benefit of epitope-based immune-stimulating vaccines is their safety. The possible pathological side effects caused by infectious agents or whole protein antigens, which might have their own intrinsic biological activity, is eliminated.
[0020]An epitope-based vaccine also provides the ability to direct and focus an immune response to multiple selected antigens from the same pathogen. Thus, patient-by-patient variability in the immune response to a particular pathogen may be alleviated by inclusion of epitopes from multiple antigens from the pathogen in a vaccine composition. In the case of HPV, epitopes derived from multiple strains may also be included. A "pathogen" may be an infectious agent or a tumor associated molecule.
[0021]One of the most formidable obstacles to the development of broadly efficacious epitope-based immunotherapeutics, however, has been the extreme polymorphism of HLA molecules. To date, effective non-genetically biased coverage of a population has been a task of considerable complexity; such coverage has required that epitopes be used that are specific for HLA molecules corresponding to each individual HLA allele. Impractically large numbers of epitopes would therefore have to be used in order to cover ethnically diverse populations. Thus, there has existed a need for peptide epitopes that are bound by multiple HLA antigen molecules for use in epitope-based vaccines. The greater the number of HLA antigen molecules bound, the greater the breadth of population coverage by the vaccine.
[0022]Furthermore, as described herein in greater detail, a need has existed to modulate peptide binding properties, e.g., so that peptides that are able to bind to multiple HLA antigens do so with an affinity that will stimulate an immune response. Identification of epitopes restricted by more than one HLA allele at an affinity that correlates with immunogenicity is important to provide thorough population coverage, and to allow the elicitation of responses of sufficient vigor to prevent or clear an infection in a diverse segment of the population. Such a response can also target a broad array of epitopes. The technology disclosed herein provides for such favored immune responses.
[0023]In a preferred embodiment, epitopes for inclusion in vaccine compositions of the invention are selected by a process whereby protein sequences of known antigens are evaluated for the presence of motif or supermotif-bearing epitopes. Peptides corresponding to a motif- or supermotif-bearing epitope are then synthesized and tested for the ability to bind to the HLA molecule that recognizes the selected motif. Those peptides that bind at an intermediate or high affinity i.e., an IC50 (or a KD value) of 500 nM or less for HLA class I molecules or an IC50 of 1000 nM or less for HLA class II molecules, are further evaluated for their ability to induce a CTL or HTL response. Immunogenic peptide epitopes are selected for inclusion in vaccine compositions.
[0024]Supermotif-bearing peptides may additionally be tested for the ability to bind to multiple alleles within the HLA supertype family. Moreover, peptide epitopes may be analogued to modify binding affinity and/or the ability to bind to multiple alleles within an HLA supertype.
[0025]The invention also includes embodiments comprising methods for monitoring or evaluating an immune response to HPV in a patient having a known HLA-type. Such methods comprise incubating a T lymphocyte sample from the patient with a peptide composition comprising an HPV epitope that has an amino acid sequence described in Tables VII to Table XX which binds the product of at least one HLA allele present in the patient, and detecting for the presence of a T lymphocyte that binds to the peptide. A CTL peptide epitope may, for example, be used as a component of a tetrameric complex for this type of analysis.
[0026]An alternative modality for defining the peptide epitopes in accordance with the invention is to recite the physical properties, such as length; primary structure; or charge, which are correlated with binding to a particular allele-specific HLA molecule or group of allele-specific HLA molecules. A further modality for defining peptide epitopes is to recite the physical properties of an HLA binding pocket, or properties shared by several allele-specific HLA binding pockets (e.g. pocket configuration and charge distribution) and reciting that the peptide epitope fits and binds to the pocket or pockets.
[0027]As will be apparent from the discussion below, other methods and embodiments are also contemplated. Further, novel synthetic peptides produced by any of the methods described herein are also part of the invention.
DETAILED DESCRIPTION OF THE INVENTION
[0028]The peptides and corresponding nucleic acid compositions of the present invention are useful for stimulating an immune response to HPV by stimulating the production of CTL or HTL responses. The peptide epitopes, which are derived directly or indirectly from native HPV protein amino acid sequences, are able to bind to HLA molecules and stimulate an immune response to HPV. The complete sequence of the HPV proteins to be analyzed can be obtained from Genbank. Epitopes and analogs thereof can also be readily determined from sequence information that may subsequently be discovered for heretofore unknown variants of HPV, as will be clear from the disclosure provided below.
[0029]The epitopes of the invention have been identified in a number of ways, as will be discussed below. Also discussed in greater detail is that analog peptides have been derived and the binding activity for HLA molecules modulated by modifying specific amino acid residues to create peptide analogs exhibiting altered immunogenicity. Further, the present invention provides compositions and combinations of compositions that enable epitope-based vaccines that are capable of interacting with HLA molecules encoded by various genetic alleles to provide broader population coverage than prior vaccines.
DEFINITIONS
[0030]The invention can be better understood with reference to the following definitions, which are listed alphabetically:
[0031]A "computer" or "computer system" generally includes: a processor; at least one information storage/retrieval apparatus such as, for example, a hard drive, a disk drive or a tape drive; at least one input apparatus such as, for example, a keyboard, a mouse, a touch screen, or a microphone; and display structure. Additionally, the computer may include a communication channel in communication with a network. Such a computer may include more or less than what is listed above.
[0032]A "construct" as used herein generally denotes a composition that does not occur in nature. A construct can be produced by synthetic technologies, e.g., recombinant DNA preparation and expression or chemical synthetic techniques for nucleic or amino acids. A construct can also be produced by the addition or affiliation of one material with another such that the result is not found in nature in that form.
[0033]"Cross-reactive binding" indicates that a peptide is bound by more than one HLA molecule; a synonym is degenerate binding.
[0034]A "cryptic epitope" elicits a response by immunization with an isolated peptide, but the response is not cross-reactive in vitro when intact whole protein which comprises the epitope is used as an antigen.
[0035]A "dominant epitope" is an epitope that induces an immune response upon immunization with a whole native antigen (see, e.g., Sercarz, et al., Annu. Rev. Immunol. 11:729-766, 1993). Such a response is cross-reactive in vitro with an isolated peptide epitope.
[0036]With regard to a particular amino acid sequence, an "epitope" is a set of amino acid residues which is involved in recognition by a particular immunoglobulin, or in the context of T cells, those residues necessary for recognition by T cell receptor proteins and/or Major Histocompatibility Complex (MHC) receptors. In an immune system setting, in vivo or in vitro, an epitope is the collective features of a molecule, such as primary, secondary and tertiary peptide structure, and charge, that together form a site recognized by an immunoglobulin, T cell receptor or HLA molecule. Throughout this disclosure epitope and peptide are often used interchangeably. It is to be appreciated, however, that isolated or purified protein or peptide molecules larger than and comprising an epitope of the invention are still within the bounds of the invention.
[0037]"Human Leukocyte Antigen" or "HLA" is a human class I or class II Major Histocompatibility Complex (MHC) protein (see, e.g., Stites, et al., IMMUNOLOGY, 8TH ED., Lange Publishing, Los Altos, Calif. (1994).
[0038]An "HLA supertype or family", as used herein, describes sets of HLA molecules grouped on the basis of shared peptide-binding specificities. HLA class I molecules that share somewhat similar binding affinity for peptides bearing certain amino acid motifs are grouped into HLA supertypes. The terms HLA superfamily, HLA supertype family, HLA family, and HLA xx-like molecules (where xx denotes a particular HLA type), are synonyms.
[0039]Throughout this disclosure, results are expressed in terms of "IC50's." IC50 is the concentration of peptide in a binding assay at which 50% inhibition of binding of a reference peptide is observed. Given the conditions in which the assays are run (i.e., limiting HLA proteins and labeled peptide concentrations), these values approximate KD values. Assays for determining binding are described in detail, e.g., in PCT publications WO 94/20127 and WO 94/03205. It should be noted that IC50 values can change, often dramatically, if the assay conditions are varied, and depending on the particular reagents used (e.g., HLA preparation, etc.). For example, excessive concentrations of HLA molecules will increase the apparent measured IC50 of a given ligand.
[0040]Alternatively, binding is expressed relative to a reference peptide. Although as a particular assay becomes more, or less, sensitive, the IC50's of the peptides tested may change somewhat, the binding relative to the reference peptide will not significantly change. For example, in an assay run under conditions such that the IC50 of the reference peptide increases 10-fold, the IC50 values of the test peptides will also shift approximately 10-fold. Therefore, to avoid ambiguities, the assessment of whether a peptide is a good, intermediate, weak, or negative binder is generally based on its IC50, relative to the IC50 of a standard peptide.
[0041]Binding may also be determined using other assay systems including those using: live cells (e.g., Ceppellini et al., Nature 339:392, 1989; Christnick et al., Nature 352:67, 1991; Busch et al., Int. Immunol. 2:443, 19990; Hill et al., J. Immunol. 147:189, 1991; del Guercio et al., J. Immunol. 154:685, 1995), cell free systems using detergent lysates (e.g., Cerundolo et al., J. Immunol. 21:2069, 1991), immobilized purified MHC (e.g., Hill et al., J. Immunol. 152, 2890, 1994; Marshall et al., J. Immunol. 152:4946, 1994), ELISA systems (e.g., Reay et al., EMBO J. 11:2829, 1992), surface plasmon resonance (e.g., Khilko et al., J. Biol. Chem. 268:15425, 1993); high flux soluble phase assays (Hammer et al., J. Exp. Med. 180:2353, 1994), and measurement of class I MHC stabilization or assembly (e.g., Ljunggren et al., Nature 346:476, 1990; Schumacher et al., Cell 62:563, 1990; Townsend et al., Cell 62:285, 1990; Parker et al., J. Immunol. 149:1896, 1992).
[0042]As used herein, "high affinity" with respect to HLA class 1 molecules is defined as binding with an IC50, or KD value, of 50 nM or less; "intermediate affinity" is binding with an IC50 or KD value of between about 50 and about 500 nM. "High affinity" with respect to binding to HLA class II molecules is defined as binding with an IC50 or KD value of 100 nM or less; "intermediate affinity" is binding with an IC50 or KD value of between about 100 and about 1000 nM.
[0043]The terms "identical" or percent "identity," in the context of two or more peptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues that are the same, when compared and aligned for maximum correspondence over a comparison window, as measured using a sequence comparison algorithm or by manual alignment and visual inspection.
[0044]An "immunogenic peptide" or "peptide epitope" is a peptide that comprises an allele-specific motif or supermotif such that the peptide will bind an HLA molecule and induce a CTL and/or HTL response. Thus, immunogenic peptides of the invention are capable of binding to an appropriate HLA molecule and thereafter inducing a cytotoxic T cell response, or a helper T cell response, to the antigen from which the immunogenic peptide is derived.
[0045]The phrases "isolated" or "biologically pure" refer to material which is substantially or essentially free from components which normally accompany the material as it is found in its native state. Thus, isolated peptides in accordance with the invention preferably do not contain materials normally associated with the peptides in their in situ environment.
[0046]"Link" or "join" refers to any method known in the art for functionally connecting peptides, including, without limitation, recombinant fusion, covalent bonding, disulfide bonding, ionic bonding, hydrogen bonding, and electrostatic bonding.
[0047]"Major Histocompatibility Complex" or "MHC" is a cluster of genes that plays a role in control of the cellular interactions responsible for physiologic immune responses. In humans, the MHC complex is also known as the HLA complex. For a detailed description of the MHC and HLA complexes, see, Paul, FUNDAMENTAL IMMUNOLOGY, 3RD ED., Raven Press, New York, 1993.
[0048]The term "motif" refers to the pattern of residues in a peptide of defined length, usually a peptide of from about 8 to about 13 amino acids for a class I HLA motif and from about 6 to about 25 amino acids for a class II HLA motif, which is recognized by a particular HLA molecule. Peptide motifs are typically different for each protein encoded by each human HLA allele and differ in the pattern of the primary and secondary anchor residues.
[0049]A "negative binding residue" or "deleterious residue" is an amino acid which, if present at certain positions (typically not primary anchor positions) in a peptide epitope, results in decreased binding affinity of the peptide for the peptide's corresponding HLA molecule.
[0050]A "non-native" sequence or "construct" refers to a sequence that is not found in nature, i.e., is "non-naturally occurring". Such sequences include, e.g., peptides that are lipidated or otherwise modified, and polyepitopic compositions that contain epitopes that are not contiguous in a native protein sequence.
[0051]The term "peptide" is used interchangeably with "oligopeptide" in the present specification to designate a series of residues, typically L-amino acids, connected one to the other, typically by peptide bonds between the α-amino and carboxyl groups of adjacent amino acids. The preferred CTL-inducing peptides of the invention are 13 residues or less in length and usually consist of between about 8 and about 11 residues, preferably 9 or 10 residues. The preferred HTL-inducing oligopeptides are less than about 50 residues in length and usually consist of between about 6 and about 30 residues, more usually between about 12 and 25, and often between about 15 and 20 residues.
[0052]It is to be appreciated that protein or peptide molecules that comprise an epitope of the invention as well as additional amino acid(s) are within the bounds of the invention. In certain embodiments, there is a limitation on the length of a peptide of the invention which is not otherwise a construct as defined herein. An embodiment that is length-limited occurs when the protein/peptide comprising an epitope of the invention comprises a region (i.e., a contiguous series of amino acids) having 100% identity with a native sequence. In order to avoid a recited definition of epitope from reading, e.g., on whole natural molecules, the length of any region that has 100% identity with a native peptide sequence is limited. Thus, for a peptide comprising an epitope of the invention and a region with 100% identity with a native peptide sequence (and which is not otherwise a construct), the region with 100% identity to a native sequence generally has a length of: less than or equal to 600 amino acids, often less than or equal to 500 amino acids, often less than or equal to 400 amino acids, often less than or equal to 250 amino acids, often less than or equal to 100 amino acids, often less than or equal to 85 amino acids, often less than or equal to 75 amino acids, often less than or equal to 65 amino acids, and often less than or equal to 50 amino acids. In certain embodiments, an "epitope" of the invention which is not a construct is comprised by a peptide having a region with less than 51 amino acids that has 100% identity to a native peptide sequence, in any increment of (50, 49, 48, 47, 46, 45, 44, 43, 42, 41, 40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5) down to 5 amino acids.
[0053]Certain peptide or protein sequences longer than 600 amino acids are within the scope of the invention. Such longer sequences are within the scope of the invention so long as they do not comprise any contiguous sequence of more than 600 amino acids that have 100% identity with a native peptide sequence, or if longer than 600 amino acids, they are a construct. For any peptide that has five contiguous residues or less that correspond to a native sequence, there is no limitation on the maximal length of that peptide in order to fall within the scope of the invention. It is presently preferred that a CTL epitope of the invention be less than 600 residues long in any increment down to eight amino acid residues.
[0054]"Pharmaceutically acceptable" refers to a non-toxic, inert, and/or physiologically compatible composition.
[0055]A "pharmaceutical excipient" comprises a material such as an adjuvant, a carrier, pH-adjusting and buffering agents, tonicity adjusting agents, wetting agents, preservative, and the like.
[0056]A "primary anchor residue" is an amino acid at a specific position along a peptide sequence which is understood to provide a contact point between the immunogenic peptide and the HLA molecule. One to three, usually two, primary anchor residues within a peptide of defined length generally defines a "motif" for an immunogenic peptide. These residues are understood to fit in close contact with peptide binding grooves of an HLA molecule, with their side chains buried in specific pockets of the binding grooves themselves. In one embodiment, for example, the primary anchor residues are located at position 2 (from the amino terminal position) and at the carboxyl terminal position of a 9-residue peptide epitope in accordance with the invention. The primary anchor positions for each motif and supermotif are set forth in Table 1. For example, analog peptides can be created by altering the presence or absence of particular residues in these primary anchor positions. Such analogs are used to modulate the binding affinity of a peptide comprising a particular motif or supermotif.
[0057]"Promiscuous recognition" is where a distinct peptide is recognized by the same T cell clone in the context of various HLA molecules. Promiscuous recognition or binding is synonymous with cross-reactive binding.
[0058]A "protective immune response" or "therapeutic immune response" refers to a CTL and/or an HTL response to an antigen derived from an infectious agent or a tumor antigen, which prevents or at least partially arrests disease symptoms or progression. The immune response may also include an antibody response which has been facilitated by the stimulation of helper T cells.
[0059]The term "residue" refers to an amino acid or amino acid mimetic incorporated into an oligopeptide by an amide bond or amide bond mimetic.
[0060]A "secondary anchor residue" is an amino acid at a position other than a primary anchor position in a peptide which may influence peptide binding. A secondary anchor residue occurs at a significantly higher frequency amongst bound peptides than would be expected by random distribution of amino acids at one position. The secondary anchor residues are said to occur at "secondary anchor positions." A secondary anchor residue can be identified as a residue which is present at a higher frequency among high or intermediate affinity binding peptides, or a residue otherwise associated with high or intermediate affinity binding. For example, analog peptides can be created by altering the presence or absence of particular residues in these secondary anchor positions. Such analogs are used to finely modulate the binding affinity of a peptide comprising a particular motif or supermotif.
[0061]A "subdominant epitope" is an epitope which evokes little or no response upon immunization with whole antigens which comprise the epitope, but for which a response can be obtained by immunization with an isolated peptide, and this response (unlike the case of cryptic epitopes) is detected when whole protein is used to recall the response in vitro or in vivo.
[0062]A "supermotif" is a peptide binding specificity shared by HLA molecules encoded by two or more HLA alleles. Preferably, a supermotif-bearing peptide is recognized with high or intermediate affinity (as defined herein) by two or more HLA antigens.
[0063]"Synthetic peptide" refers to a peptide that is man-made using such methods as chemical synthesis or recombinant DNA technology.
[0064]As used herein, a "vaccine" is a composition that contains one or more peptides of the invention. There are numerous embodiments of vaccines in accordance with the invention, such as by a cocktail of one or more peptides; one or more epitopes of the invention comprised by a polyepitopic peptide; or nucleic acids that encode such peptides or polypeptides, e.g., a minigene that encodes a polyepitopic peptide. The "one or more peptides" can include any whole unit integer from 1-150, e.g., at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, or 150 or more peptides of the invention. The peptides or polypeptides can optionally be modified, such as by lipidation, addition of targeting or other sequences. HLA class I-binding peptides of the invention can be admixed with, or linked to, HLA class II-binding peptides, to facilitate activation of both cytotoxic T lymphocytes and helper T lymphocytes. Vaccines can also comprise peptide-pulsed antigen presenting cells, e.g., dendritic cells.
[0065]The nomenclature used to describe peptide compounds follows the conventional practice wherein the amino group is presented to the left (the N-terminus) and the carboxyl group to the right (the C-terminus) of each amino acid residue. When amino acid residue positions are referred to in a peptide epitope they are numbered in an amino to carboxyl direction with position one being the position closest to the amino terminal end of the epitope, or the peptide or protein of which it may be a part. In the formulae representing selected specific embodiments of the present invention, the amino- and carboxyl-terminal groups, although not specifically shown, are in the form they would assume at physiologic pH values, unless otherwise specified. In the amino acid structure formulae, each residue is generally represented by standard three letter or single letter designations. The L-form of an amino acid residue is represented by a capital single letter or a capital first letter of a three-letter symbol, and the D-form for those amino acids having D-forms is represented by a lower case single letter or a lower case three letter symbol. Glycine has no asymmetric carbon atom and is simply referred to as "Gly" or G. The amino acid sequences of peptides set forth herein are generally designated using the standard single letter symbol. (A, Alanine; C, Cysteine; D, Aspartic Acid; E, Glutamic Acid; F, Phenylalanine; G, Glycine; H, Histidine; I, Isoleucine; K, Lysine; L, Leucine; M, Methionine; N, Asparagine; P, Proline; Q, Glutamine; R, Arginine; S, Serine; T, Threonine; V, Valine; W, Tryptophan; and Y, Tyrosine.) In addition to these symbols, "B" in the single letter abbreviations used herein designates α-amino butyric acid.
Stimulation of CTL and HTL Responses
[0066]The mechanism by which T cells recognize antigens has been delineated during the past ten years. Based on our understanding of the immune system we have developed efficacious peptide epitope vaccine compositions that can induce a therapeutic or prophylactic immune response to HPV in a broad population. For an understanding of the value and efficacy of the claimed compositions, a brief review of immunology-related technology is provided.
[0067]A complex of an HLA molecule and a peptidic antigen acts as the ligand recognized by HLA-restricted T cells (Buus, S. et al., Cell 47:1071, 1986; Babbitt, B. P. et al., Nature 317:359, 1985; Townsend, A. and Bodmer, H., Annu. Rev. Immunol. 7:601, 1989; Germain, R. N., Annu. Rev. Immunol. 11:403, 1993). Through the study of single amino acid substituted antigen analogs and the sequencing of endogenously bound, naturally processed peptides, critical residues that correspond to motifs required for specific binding to HLA antigen molecules have been identified and are described herein and are set forth in Tables I, II, and III (see also, e.g., Southwood, et al., J. Immunol. 160:3363, 1998; Rammensee, et al., Immunogenetics 41:178, 1995; Rammensee et al., SYFPEITHI, access via web at: http://134.2.96.221/scripts.hlaserver.dll/home.htm; Sette, A. and Sidney, J. Curr. Opin. Immunol. 10:478, 1998; Engelhard, V. H., Curr. Opin. Immunol. 6:13, 1994; Sette, A. and Grey, H. M., Curr. Opin. Immunol. 4:79, 1992; Sinigaglia, F. and Hammer, J. Curr. Biol. 6:52, 1994; Ruppert et al., Cell 74:929-937, 1993; Kondo et al., J. Immunol. 155:4307-4312, 1995; Sidney et al., J. Immunol. 157:3480-3490, 1996; Sidney et al., Human Immunol. 45:79-93, 1996; Sette, A. and Sidney, J. Immunogenetics 1999 November; 50 (3-4):201-12, Review).
[0068]Furthermore, x-ray crystallographic analysis of HLA-peptide complexes has revealed pockets within the peptide binding cleft of HLA molecules which accommodate, in an allele-specific mode, residues borne by peptide ligands; these residues in turn determine the HLA binding capacity of the peptides in which they are present. (See, e.g., Madden, D. R. Annu. Rev. Immunol. 13:587, 1995; Smith, et al., Immunity 4:203, 1996; Fremont et al., Immunity 8:305, 1998; Stern et al., Structure 2:245, 1994; Jones, E. Y. Curr. Opin. Immunol. 9:75, 1997; Brown, J. H. et al., Nature 364:33, 1993; Guo, H. C. et al., Proc. Natl. Acad. Sci. USA 90:8053, 1993; Guo, H. C. et al., Nature 360:364, 1992; Silver, M. L. et al., Nature 360:367, 1992; Matsumura, M. et al., Science 257:927, 1992; Madden et al., Cell 70:1035, 1992; Fremont, D. H. et al., Science 257:919, 1992; Saper, M. A., Bjorkman, P. J. and Wiley, D. C., J. Mol. Biol. 219:277, 1991.)
[0069]Accordingly, the definition of class I and class II allele-specific HLA binding motifs, or class I or class II supermotifs allows identification of regions within a protein that have the potential of binding particular HLA antigen(s).
[0070]The present inventors have found that the correlation of binding affinity with immunogenicity, which is disclosed herein, is an important factor to be considered when evaluating candidate peptides. Thus, by a combination of motif searches and HLA-peptide binding assays, candidates for epitope-based vaccines have been identified. After determining their binding affinity, additional confirmatory work can be performed to select, amongst these vaccine candidates, epitopes with preferred characteristics in terms of population coverage, antigenicity, and immunogenicity.
[0071]Various strategies can be utilized to evaluate immunogenicity, including:
[0072]1) Evaluation of primary T cell cultures from normal individuals (see, e.g., Wentworth, P. A. et al., Mol. Immunol. 32:603, 1995; Celis, E. et al., Proc. Natl. Acad. Sci. USA 91:2105, 1994; Tsai, V. et al., J. Immunol. 158:1796, 1997; Kawashima, I. et al., Human Immunol. 59:1, 1998); This procedure involves the stimulation of peripheral blood lymphocytes (PBL) from normal subjects with a test peptide in the presence of antigen presenting cells in vitro over a period of several weeks. T cells specific for the peptide become activated during this time and are detected using, e.g., a lymphokine- or 51 Cr-release assay involving peptide sensitized target cells.
[0073]2) Immunization of HLA transgenic mice (see, e.g., Wentworth, P. A. et al., J. Immunol. 26:97, 1996; Wentworth, P. A. et al., Int. Immunol. 8:651, 1996; Alexander, J. et al., J. Immunol. 159:4753, 1997); In this method, peptides in incomplete Freund's adjuvant are administered subcutaneously to HLA transgenic mice. Several weeks following immunization, splenocytes are removed and cultured in vitro in the presence of test peptide for approximately one week. Peptide-specific T cells are detected using, e.g., a 51Cr-release assay involving peptide sensitized target cells and target cells expressing endogenously generated antigen.
[0074]3) Demonstration of recall T cell responses from immune individuals who have effectively been vaccinated, recovered from infection, and/or from chronically infected patients (see, e.g., Rehermann, B. et al., J. Exp. Med. 181:1047, 1995; Doolan, D. L. et al., Immunity 7:97, 1997; Bertoni, R. et al., J. Clin. Invest. 100:503, 1997; Threlkeld, S. C. et al., J. Immunol. 159:1648, 1997; Diepolder, H. M. et al., J. Virol. 71:6011, 1997); In applying this strategy, recall responses are detected by culturing PBL from subjects that have been naturally exposed to the antigen, for instance through infection, and thus have generated an immune response "naturally", or from patients who were vaccinated against the infection. PBL from subjects are cultured in vitro for 1-2 weeks in the presence of test peptide plus antigen presenting cells (APC) to allow activation of "memory" T cells, as compared to "naive" T cells. At the end of the culture period, T cell activity is detected using assays for T cell activity including 51Cr release involving peptide-sensitized targets, T cell proliferation, or lymphokine release.
[0075]The following describes the peptide epitopes and corresponding nucleic acids of the invention.
Binding Affinity of Peptide Epitopes for HLA Molecules
[0076]As indicated herein, the large degree of HLA polymorphism is an important factor to be taken into account with the epitope-based approach to vaccine development. To address this factor, epitope selection encompassing identification of peptides capable of binding at high or intermediate affinity to multiple HLA molecules is preferably utilized, most preferably these epitopes bind at high or intermediate affinity to two or more allele-specific HLA molecules.
[0077]CTL-inducing peptides of interest for vaccine compositions preferably include those that have an IC50 or binding affinity value for class I HLA molecules of 500 nM or better (i.e., the value is ≦500 nM). HTL-inducing peptides preferably include those that have an IC50 or binding affinity value for class II HLA molecules of 1000 nM or better, (i.e., the value is ≦1,000 nM). For example, peptide binding is assessed by testing the capacity of a candidate peptide to bind to a purified HLA molecule in vitro. Peptides exhibiting high or intermediate affinity are then considered for further analysis. Selected peptides are tested on other members of the supertype family. In preferred embodiments, peptides that exhibit cross-reactive binding are then used in cellular screening analyses or vaccines.
[0078]As disclosed herein, higher HLA binding affinity is correlated with greater immunogenicity. Greater immunogenicity can be manifested in several different ways. Immunogenicity corresponds to whether an immune response is elicited at all, and to the vigor of any particular response, as well as to the extent of a population in which a response is elicited. For example, a peptide might elicit an immune response in a diverse array of the population, yet in no instance produce a vigorous response. In accordance with these principles, close to 90% of high binding peptides have been found to be immunogenic, as contrasted with about 50% of the peptides which bind with intermediate affinity. Moreover, higher binding affinity peptides lead to more vigorous immunogenic responses. As a result, less peptide is required to elicit a similar biological effect if a high affinity binding peptide is used. Thus, in preferred embodiments of the invention, high affinity binding epitopes are particularly useful.
[0079]The relationship between binding affinity for HLA class I molecules and immunogenicity of discrete peptide epitopes on bound antigens has been determined for the first time in the art by the present inventors. The correlation between binding affinity and immunogenicity was analyzed in two different experimental approaches (see, e.g., Sette, et al., J. Immunol. 153:5586-5592, 1994). In the first approach, the immunogenicity of potential epitopes ranging in HLA binding affinity over a 10.000-fold range was analyzed in HLA-A*0201 transgenic mice. In the second approach, the antigenicity of approximately 100 different hepatitis B virus (HBV)-derived potential epitopes, all carrying A*0201 binding motifs, was assessed by using PBL from acute hepatitis patients. Pursuant to these approaches, it was determined that an affinity threshold value of approximately 500 nM (preferably 50 mM or less) determines the capacity of a peptide epitope to elicit a CTL response. These data are true for class I binding affinity measurements for naturally processed peptides and for synthesized T cell epitopes. These data also indicate the important role of determinant selection in the shaping of T cell responses (see, e.g., Schaeffer et al. Proc. Natl. Acad. Sci. USA 86:4649-4653, 1989).
[0080]An affinity threshold associated with immunogenicity in the context of HLA class II DR molecules has also been delineated (see, e.g., Southwood et al. J Immunology 160:3363-3373, 1998, and co-pending U.S. Ser. No. 09/009,953 filed Jan. 21, 1998). In order to define a biologically significant threshold of DR binding affinity, a database of the binding affinities of 32 DR-restricted epitopes for their restricting element (i.e., the HLA molecule that binds the motif) was compiled. In approximately half of the cases (15 of 32 epitopes), DR restriction was associated with high binding affinities, i.e. binding affinity values of 100 nM or less. In the other half of the cases (16 of 32), DR restriction was associated with intermediate affinity (binding affinity values in the 100-1000 nM range). In only one of 32 cases was DR restriction associated with an IC50 of 1000 nM or greater. Thus, 1000 mM can be defined as an affinity threshold associated with immunogenicity in the context of DR molecules.
[0081]In the case of tumor-associated antigens (TAAs), many CTL peptide epitopes that have been shown to induce CTL that lyse peptide-pulsed target cells and tumor cell targets endogenously expressing the epitope exhibit binding affinity or IC50 values of 200 nM or less. In a study that evaluated the association of binding affinity and immunogenicity of a small set of such TAA epitopes, 100% ( 10/10) of the high binders, i.e., peptide epitopes binding at an affinity of 50 nM or less, were immunogenic and 80% ( 8/10) of them elicited CTLs that specifically recognized tumor cells. In the 51 to 200 nM range, very similar figures were obtained. With respect to analog peptides, CTL inductions positive for wildtype peptide and tumor cells were noted for 86% ( 6/7) and 71% ( 5/7) of the peptides, respectively. In the 201-500 nM range, most peptides (4/5 wildtype) were positive for induction of CTL recognizing wildtype peptide, but tumor recognition was not detected.
[0082]The binding affinity of peptides for HLA molecules can be determined as described in Example 1, below.
Peptide Epitope Binding Motifs and Supermotifs
[0083]Through the study of single amino acid substituted antigen analogs and the sequencing of endogenously bound, naturally processed peptides, critical residues required for allele-specific binding to HLA molecules have been identified. The presence of these residues correlates with binding affinity for HLA molecules. The identification of motifs and/or supermotifs that correlate with high and intermediate affinity binding is an important issue with respect to the identification of immunogenic peptide epitopes for the inclusion in a vaccine. Kast et al. (J. Immunol. 152:3904-3912, 1994) have shown that motif-bearing peptides account for 90% of the epitopes that bind to allele-specific HLA class I molecules. In this study all possible peptides of 9 amino acids in length and overlapping by eight amino acids (240 peptides), which cover the entire sequence of the E6 and E7 proteins of human papillomavirus type 16, were evaluated for binding to five allele-specific HLA molecules that are expressed at high frequency among different ethnic groups. This unbiased set of peptides allowed an evaluation of the predictive value of HLA class I motifs. From the set of 240 peptides, 22 peptides were identified that bound to an allele-specific HLA molecule with high or intermediate affinity. Of these 22 peptides, 20 (i.e. 91%) were motif-bearing. Thus, this study demonstrates the value of motifs for the identification of peptide epitopes for inclusion in a vaccine: application of motif-based identification techniques will identify about 90% of the potential epitopes in a target antigen protein sequence.
[0084]Such peptide epitopes are identified in the Tables described below.
[0085]Peptides of the present invention may also comprise epitopes that bind to MHC class II DR molecules. A greater degree of heterogeneity in both size and binding frame position of the motif, relative to the N and C termini of the peptide, exists for class II peptide ligands. This increased heterogeneity of HLA class II peptide ligands is due to the structure of the binding groove of the HLA class II molecule which, unlike its class I counterpart, is open at both ends. Crystallographic analysis of HLA class II DRB*0101-peptide complexes showed that the major energy of binding is contributed by peptide residues complexed with complementary pockets on the DRB*0101 molecules. An important anchor residue engages the deepest hydrophobic pocket (see, e.g., Madden, D. R. Ann. Rev. Immunol. 13:587, 1995) and is referred to as position 1 (P1). P1 may represent the N-terminal residue of a class II binding peptide epitope, but more typically is flanked towards the N-terminus by one or more residues. Other studies have also pointed to an important role for the peptide residue in the 6th position towards the C-terminus, relative to P1, for binding to various DR molecules.
[0086]In the past few years evidence has accumulated to demonstrate that a large fraction of HLA class I and class II molecules can be classified into a relatively few supertypes, each characterized by largely overlapping peptide binding repertoires, and consensus structures of the main peptide binding pockets. Thus, peptides of the present invention are identified by any one of several HLA-specific amino acid motifs (see, e.g., Tables I-III), or if the presence of the motif corresponds to the ability to bind several allele-specific HLA antigens, a supermotif. The HLA molecules that bind to peptides that possess a particular amino acid supermotif are collectively referred to as an HLA "supertype."
[0087]The peptide motifs and supermotifs described below, and summarized in Tables I-III, provide guidance for the identification and use of peptide epitopes in accordance with the invention.
[0088]Examples of peptide epitopes bearing a respective supermotif or motif are included in Tables as designated in the description of each motif or supermotif below. The Tables include a binding affinity ratio listing for some of the peptide epitopes. The ratio may be converted to IC50 by using the following formula: IC50 of the standard peptide/ratio=IC50 of the test peptide (i.e., the peptide epitope). The IC50 values of standard peptides used to determine binding affinities for Class I peptides are shown in Table IV. The IC50 values of standard peptides used to determine binding affinities for Class II peptides are shown in Table V. For example, where an HLA-A2.1 motif-bearing peptide shows a relative binding ratio of 0.01 for HLA-A*0201, the IC50 value is 500 nM, and where an HLA-A2.1 motif-bearing peptide shows a relative binding ratio of 0.1 for HLA-A*0201, the IC50 value is 50 nM.
[0089]The peptides used as standards for the binding assays described herein are examples of standards; alternative standard peptides can also be used when performing binding studies.
[0090]To obtain the peptide epitope sequences listed in Tables VII-XX, protein sequence data for HPV types 6a, 6b, 11a, 16, 18, 31, 33, 45, and 56 were evaluated for the presence of the designated supermotif or motif. Seven HPV structural and regulatory proteins, E1, E2, E5, E6, E7, L1 and L2 were included in the analysis. E4 was also included in the evaluation of some of the strains. Peptide epitopes can additionally be evaluated on the basis of their conservancy (i.e., the amount of variance) among the available protein sequences for each HPV antigen.
[0091]In the Tables, motif- and/or supermotif-bearing amino acids sequences identified in the indicated HPV strains are designated by position number and length of the epitope with reference to the HPV sequences and numbering provided below. For each sequence, the four columns provide the following information: column 1 indicates the HPV strain; column 2 indicates the HPV protein in which the motif-bearing sequence is found, e.g., E1, E2, E4, E5, E6, E7, L1, or L2; column 3 indicates the length of the epitope, or in the case of HLA Class II epitopes, the length of the core sequence; and column 4 designates the amino acid position in the HPV protein sequence that corresponds to the first amino acid residue of the epitope. For those sections of the Tables that include only three columns, corresponding to columns 2, 3, and 4, the HPV strain is indicated in the heading at the top of the page. For example, the first peptide epitope listed in Table VII, i.e., the HLA-A1 supermotif, for HPV 16, protein E1 is a sequence of 10 residues in length starting at position 206. Accordingly, the amino acid sequence of the epitope is AMLAKFKELY.
[0092]For HPV strain 11, the number and position listed for protein E5 refers to either the HPV 11 E5a or HPV 11 E5b sequence set out below. Because the epitope must include the designated motif or supermotif, e.g., HLA-A2, it can readily be determined whether the sequence refers to HPV 11 E5a or E5b by checking the amino acid sequences of both E5a and E5b and selecting the sequence that conforms to the motif listed in Table I.
HPV Strains and Amino Acid Sequences of HPV Proteins
TABLE-US-00001 [0093]HPV6A E1 1 MADDSGTENEGSGCTGWFMVEAIVQHPTGTQISDDEDEEVEDSGYDMVDFIDDSNITHNS 60 LEAQALFNRQEADTHYATVQDLKRKYLGSPYVSPINTIAEAVESEISPRLDAIKLTRQPK 120 KVKRRLFQTRELTDSGYGYSEVEAGTGTQVEKHGVPENGGDGQEKDTGRDIEGEEHTEAE 180 APTNSVREHAGTAGILELLKCKDLRAALLGKFKECFGLSFIDLIRPFKSDKTTCADWVVA 240 GFGIHHSISEAFQKLIEPLSLYAHIQWLTNAWGMVLLVLVRFKVNKSRSTVARTLATLLN 300 IPDNQMLIEPPKIQSGVAALYWFRTGISNASTVIGEAPEWITRQTVIEHGLADSQFKLTE 360 MVQWAYDNDICEESEIAFEYAQRGDFDSNAPAFLNSNMQAKYVKDCATMCRHYKHAEMRK 420 MSIKQWIKHRGSKIEGTGNWKPIVQFLRHQNIEFIPFLSKFKLWLHGTPKKNCIAIVGPP 480 DTGKSYFCMSLISFLGGTVISHVNSSSHFWLQPLVDAKVALLDDATQPCWIYMDTYMRNL 540 LDGNPMSIDRKHKALTLIKCPPLLVTSNIDITKEEKYKYLHTRVTTFTFPNPFPFDRNGN 600 AVYELSNANWKCFFERLSSSLDIQDSEDEEDGSNSQAFRCVPGTVVRTL 649 HPV6A E2 1 MEAIAKRLDACQEQLLELYEENSTDLNKHVLHWKCMRHESVLLYKAKQMGLSHIGMQVVP 60 PLKVSEAKGHNAIEMQMHLESLLKTEYSMEPWTLQETSYEMWQTPPKRCFKKRGKTVEVK 120 FDGCANNTMDYVVWTDVYVQDTDSWVKVHSMVDAKGIYYTCGQFKTYYVNFVKEAEKYGS 180 TKQWEVCYGSTVICSPASVSSTTQEVSIPESTTYTPAQTSTPVSSSTQEDAVQTPPRKRA 240 RGVQQSPCNALCVAHIGPVDSGNHNLITNNHDQHQRRNNSNSSATPIVQFQGESNCLKCF 300 RYRLNDKHRHLFDLISSTWHWASPKAPHKHAIVTVTYHSEEQRQQFLNVVKIPPTIRHKL 360 GFMSLHLL 368 HPV6A E4 1 MAAQLYVLLHLYLALHKKYPFLNLLHTPPHRPPPLCPQAPRKTQCKRRLENEHEESNSHL 60 ATPCVWPTLDPWTVETTTSSLTITTSTKEGTTVTVQLRL 99 HPV6A E5 1 MEVVPVQIAAGTTSTLILPVIIAFVVCFVSIILIVWISDFIVYTSVLVLTLLLYLLLWLL 60 LTTPLQFFLLTLLVCYCPALYIHHYIVNTQQ 91 HPV6A E6 1 MESANASTSATTIDQLCKTFNLSMHTLQINCVFCKNALTTAEIYSYAYKQLKVLFRGGYP 60 YAACACCLEFHGKINQYRHFDYAGYATTVEEETKQDILDVLIRCYLCHKPLCEVEKVKHI 120 LTKARFIKLNCTWKGRCLHCWTTCMEDMLP 150 HPV6A E7 1 MHGRHVTLKDIVLDLQPPDPVGLHCYEQLVDSSEDEVDEVDGQDSQPLKQHFQIVTCCCG 60 CDSNVRLVVQCTETDIREVQQLLLGTLDIVCPICAPKT 98 HPV6A L1 1 MWRPSDSTVYVPPPNPVSKVVATDAYVTRTNIFYHASSSRLLAVGHPYFSIKRANKTVVP 60 KVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPFL 120 NKYDDVENSGSGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGKQCTNTPVQAGD 180 CPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPIDICGTTCKYPDYLQMAADPYGD 240 RLFFFLRKEQMFARHFFNRAGEVGEPVPDTLIIKGSGNRTSVGSSIYVNTPSGSLVSSEA 300 QLFNKPYWLQKAQGHNNGICWGNQLFVTVVDTTRSTNMTLCASVTTSSTYTNSDYKEYMR 360 HVEEYDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQA 420 ITCQKPTPEKEKPDPYKNLSFWEVNLKEKFSSELDQYPLGRKFLLQSGYRGRSSIRTGVK 480 RPAVSKASAAPKRKRAKTKR 500 HPV6A L2 1 MAHSRARRRKRASATQLYQTCKLTGTCPPDVIPKVEHNTIADQILKWGSLGVFFGGLGIG 60 TGSGTGGRTGYVPLGTSAKPSITSGPMARPPVVVEPVAPSDPSIVSLIEESAIINAGAPE 120 IVPPAHGGFTITSSETTTPAILDVSVTSHTTTSIFRNPVFTEPSVTQPQPPVEANGHILI 180 SAPTITSHPIEEIPLDTFVISSSDSGPTSSTPVPGTAPRPRVGLYSPALHQVQVTDPAFL 240 STPQRLITYDNPVYEGEDVSVQFSHDSIHNAPDEAFMDIIRLHRPAIASRRGLVRYSRIG 300 QRGSMHTRSGKHIGARIHYFYDISPIAQAAEEIEMHPLVAAQDDTFDIYAESFEPDINPT 360 QHPVTNISDTYLTSTPNTVTQPWGNTTVPLSSIPNDLFLQSGPDITFPTAPMGTPFSPVT 420 ALPTGPVFITGSGFYLHPAWYFARKRRKRIPLFFSDVAA 459 HPV6B E1 1 MADDSGTENEGSGCTGWFMVEAIVQHPTGTQISDDEDEEVEDSGYDMVDFIDDSNITHNS 60 LEAQALFNRQEADTHYATVQDLKRKYLGSPYVSPINTIAEAVESEISPRLDAIKLTRQPK 120 KVKRRLFQTRELTDSGYGYSEVEAGTGTQVEKHGVPENGGDGQEKDTGRDIEGEEHTEAE 180 APTNSVREHAGTAGILELLKCKDLRAALLGKFKECFGLSFIDLIRPFKSDKTTCLDWVVA 240 GFGIHHSISEAFQKLIEPLSLYAHIQWLTNAWGMVLLVLLRFKVNKSRSTVARTLATLLN 300 IPENQMLIEPPKIQSGVAALYWFRTGISNASTVIGEAPEWITRQTVIEHGLADSQFKLTE 360 MVQWAYDNDICEESEIAFEYAQRGDFDSNARAFLNSNMQAKYVKDCATMCRHYKHAEMRK 420 MSIKQWIKHRGSKIEGTGNWKPIVQFLRHQNTEFIPFLTKFKLWLHGTPKKNCIAIVGPP 480 DTGKSYFCMSLISFLGGTVISHVNSSSHFWLQPLVDAKVALLDDATQPCWIYMDTYMRNL 540 LDGNPMSIDRKHKALTLIKCPPLLVTSNIDITKEDKYKYLHTRVTTFTFPNPFPFDRNGN 600 AVYELSNTNWKCFFERLSSSLDIQDSEDEEDGSNSQAFRCVPGTVVTRTL 649 HPV6B E2 1 MEAIAKRLDACQEQLLELYEENSTDLHKHVLHWKCMRHESVLLYKAKQMGLSHIGMQVVP 60 PLKVSEAKGHNAIEMQMHLESLLRTEYSMEPWTLQETSYEMWQTPPKRCFKKRGKTVEVK 120 FDGCANNTMDYVVWTDVYVQDNDTWVKVHSMVDAKGIYYTCGQFKTYYVNFVKEAEKYGS 180 TKHWEVCYGSTVICSPASVSSTTQEVSIPESTTYTPAQTSTLVSSSTKEDAVQTPPRKRA 240 RGVQQSPCNALCVAHIGPVDSGNHNLITNNHDQHQRRNNSNSSATPIVQFQGESNCLKCF 300 RYRLNDRHRHLFDLISSTWHWASSKAPHKHAIVTVTYDSEEQRQQFLDVVKIPPTISHKL 360 GFMSLHLL 368 HPV6B E4 1 MGAPNIGKYVMAAQLYVLLHLYLALHKKYPFLNLLHTPPHRPPPLCPQAPRKTQCKRRLG 60 NEHEESNSPLATPCVWPTLDPWTVETTTSSLTITTSTKDGTTVTVQLRL 109 HPV6B E5A 1 MEVVPVQIAAGTTSTFILPVIIAFVVCFVSIILIVWISEFIVYTSVLVLTLLLYLLLWLL 60 LTTPLQFFLLTLLVCYCPALYIHYYIVTTQQ 91 HPV6B E5B 1 MMLTCQFNDGDTWLGLWLLCAFIVGMLGLLLMHYRAVQGDKHTKCKKCNKHNCNDDYVTM 60 HYTTDGDYIYMN 72 HPV6B E6 1 MESANASTSATTIDQLCKTFNLSMHTLQINCVFCKNALTTAEIYSYAYKHLKVLFRGGYP 60 YAACACCLEFHGKINQYRHFDYAGYATTVEEETKQDILDVLIRCYLCHKPLCEVEKVKHI 120 LTKARFIKLNCTWKGRCLHCWTTCMEDMLP 150 HPV6B E7 1 MHGRHVTLKDIVLDLQPPDPVGLHCYEQLVDSSEDEVDEVDGQDSQPLKQHFQIVTCCCG 60 CDSNVRLVVQCTETDIREVQQLLLGTLNIVCPICAPKT 98 HPV6A L1 1 MWRPSDSTVYVPPPNPVSKVVATDAYVTRTNIFYHASSSRLLAVGHPYFSIKRANKTVVP 60 KVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPFL 120 NKYDDVENSGSGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGKQCTNTPVQAGD 180 CPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPIDICGTTCKYPDYLQMAADPYGD 240 RLFFFLRKEQMFARHFFNRAGEVGEPVPDTLIIKGSGNRTSVGSSIYVNTPSGSLVSSEA 300 QLFNKPYWLQKAQGHNNGICWGNQLFVTVVDTTRSTNMTLCASVTTSSTYTNSDYKEYMR 360 HVEEYDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQA 420 ITCQKPTPEKEKPDPYKNLSFWEVNLKEKFSSELDQYPLGRKFLLQSGYRGRSSIRTGVK 480 RPAVSKASAAPKRKRAKTKR 500 HPV6B L2 1 MAHSRARRRKRASATQLYQTCKLTGTCPPDVIPKVEHNTIADQILKWGSLGVFFGGLGIG 60 TGSGTGGRTGYVPLQTSAKPSITSGPMARPPVVVEPVAPSDPSIVSLIEESAIINAGAPE 120 IVPPAHGGFTITSSETTTPAILDVSVTSHTTTSIFRNPVFTEPSVTQPQPPVEANGHILI 180 SAPTVTSHPIEEIPLDTFVVSSSDSGPTSSTPVPGTAPRPRVGLYSRALHQVQVTDPAFL 240 STPQRLITYDNPVYEGEDVSVQFSHDSIHNAPDEAFMDIIRLHRPAIASRRGLVRYSRIG 300 QRGSMHTRSGKHIGARIHYFYDISPIAQAAEEIEMHPLVAAQDDTFDIYAESFEPGINPT 360 QHPVTNISDTYLTSTPNTVTQPWGNTTVPLSLPNDLFLQSGPDITFPTAPMGTPFSPVTP 420 ALPTGPVFITGSGFYLHPAWYFARKRRKRIPLFFSDVAA 453 HPV11 E1 1 MADDSGTENEGSGCTGWFMVEAIVEHTTGTQISEDEEEEVEDSGYDMVDFIDDRHITQNS 60 VEAQALFNRQEADAHYATVQDLKRKYLGSPYVSPISNVANAVESEISPRLDAIKLTTQPK 120 KVKRRLFETRELTDSGYGYSEVEAATQVEKHGDPENGGDGQERDTGRDIEGEGVEHREAE 180 AVDDSTREHADTSGILELLKCKDIRSTLHGKFKDCFGLSFVDLIRPFKSDRTTCADWVVA 240 GFGIHHSIADAFQKLIEPLSLYAHIQWLTNAWGMVLLVLIRFKVNKSRCTVARTLGTLLN 300 IPENHMLIEPPKIQSGVRALYWFRTGISNASTVIGEAPEWITRQTVIEHSLADSQFKLTE 360 MVQWAYDNDICEESEIAFEYAQRGDFDSNAPAFLNSNMQAKYVKDCAIMCRHYKHAEMKK 420 MSIKQWIKYRGTKVDSVGNWKPIVQFLRHQNIEFIPFLSKLKLWLHGTPKKNCIAIVGPP 480 DTGKSCFCMSLIKFLGGTVISYVNSCSHFWLQPLTDAKVALLDDATQPCWTYMDTYMRNL 540 LDGNPMSIDRKHRALTLIKCPPLLVTSNIDISKEEKYKYLHSRVTTFTFPNPFPFDRNGN 600 AVYELSDANWKCFFERLSSSLDIEDSEDEEDGSNSQAFRCVPGSVVRTL 649 HPV11 E2 1 MEAIAKRLDACQDQLLELYEENSIDIHKHIMHWKCIRLESVLLHKAKQMGLSHIGLQVVP 60 PLTVSETKGHNAIEMQMHLESLAKTQYGVEPWTLQDTSYEMWLTPPKRCFKKQGNTVEVK 120 FDGCEDNVMEYVVWTHIYLQDNDSWVKVTSSVDAKGIYYTCGQFKTYYVNFNKEAQKYGS 180 TNHWEVCYGSTVICSPASVSSTVREVSIAEPTTYTPAQTTAPTVSACTTEDGVSAPPRKR 240 ARGPSTNNTLCVANIRSVDSTINNIVTDHYNKHQRRNNCHSAATPIVQLQGDSNCLKCFR 300 YRLNDKYKHLFELASSTWHWASPEAPHKNAIVTLTYSSEEQRQQFLNSVKIPPTIRHKVG 360 FMSLHLL 367 HPV11 E4 1 MVVPIIGKYVMAAQLYVLLHLYLALYEKYPLLNLLHTPPHRPPPLQCPPAPRKTACRRRL 60 GSEHVDRPLTTPCVWPTSDPWTVQSTTSSLTITTSTKEGTTVTVQLRL 108 HPV11 E5A 1 MEVVPVQIAAATTTTLILPVVIAFAVCILSIVLIILISDFVVYTSVLVLTLLLYLLLWLL 60 LTTPLQFFLLTLCVCYFPAFYIHIYIVQTQQ 91 HPV11 E5B 1 MVMLTCHLNDGDTWLFLWLFTAFVVAVLGLLLLHYRAVHGTEKTKCAKCKSNRNTTVDYV 60 YMSHGDNGDYVYMN 74
HPV11 E6 1 MESKDASTSATSIDQLCKTFNLSLHTLQIQCVFCRNALTTAEIYAYAYKNLKVVWRDNFP 60 FAACACCLELQGKINQYRHFNYAAYAPTVEEETNEDILKVLIRCYLCHKPLCEIEKLKHI 120 LGKARFIKLNNQWKGRCLHCWTTCMEDLLP 150 HPV11 E7 1 MHGRLVTLKDIVLDLQPPDPVGLHCYEQLEDSSEDEVDKVDKQDAQPLTQHYQILTCCCG 60 CDSNVRLVVECTDGDIRQLQDLLLGTLNIVCPICAPKP 98 HPV11 L1 1 MWRPSDSTVYVPPPNPVSKVVATDAYVKRTNIFYHASSSRLLAVGHPYYSIKKVNKTVVP 60 KVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPLL 120 NKYDDVENSGGYGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGTQCSNTSVQNG 180 DCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPLDICGTVCKYPDYLQMAADPYG 240 DRLFFYLRKEQMFARHFFNRAGTVGEPVPDDLLVKGGNNRSSVASSIYVHTPSGSLVSSE 300 AQLFNKPYWLQKAQGHNNGICWGNHLFVTVVDTTRSTNMTLCASVSKSATYTNSDYKEYM 360 RHVEEFDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQ 420 AITCQKPTPEKEKQDPYKDMSFWEVNLKEKFSSELDQFPLGRKFLLQSGYRGRTSARTGI 480 KRPAVSKPSTAPKRKRTKTKK 501 HPV11 L2 1 MKPRARRRKRASATQLYQTCKATGTCPPDVIPKVEHTTIADQILKWGSLGVFFGGLGIGT 60 GAGSGGRAGYIPLGSSPKPAITGGPAARPPVLVEPVAPSDPSIVSLIEESAIINAGAPEV 120 VPPTQGGFTITSSESTTPAILDVSVTNHTTTSVFQNPLFTEPSVIQPQPPVEASGHILIS 180 APTITSQHVEDIPLDTFVVSSSDSGPTSSTPLPRAFPRPRVGLYSRALQQVQVTDPAFLS 240 TPQRLVTYDNPVYEGEDVSLQFTHESIHNAPDEAFMDIIRLHRPAITSRRGLVRFSRIGQ 300 RGSMYTRSGQHIGARIHYFQDISPVTQAAEEIELHPLVAAENDTFDIYAEPFDPIPDPVQ 360 HSVTQSYLTSTPNTLSQSWGNTTVPLSIPSDWFVQSGPDITFPTASMGTPFSPVTPALPT 420 GPVFITGSDFYLHPTWYFARRRRKRIPLFFTDVAA 455 HPV16 E1 1 MADPAGTNGEEGTGCNGWFYVEAVVEKKTGDAISDDENENDSDTGEDLVDFIVNDNDYLT 60 QAETETAHALFTAQEAKQHRDAVQVLKRKYLVSPLSDISGCVDNNISPRLKAICIEKQSR 120 AAKRRLFESEDSGYGNTEVETQQMLQVEGRHETETPCSQYSGGSGGGCSQYSSGSGGEGV 180 SERHTICQTPLTNILNVLKTSNAKAAMLAKFKELYGVSFSELVRPFKSNKSTCCDWCIAA 240 FGLTPSIADSIKTLLQQYCLYLHIQSLACSWGMVVLLLVRYKCGKNRETIEKLLSKLLCV 300 SPMCMMIEPPKLRSTAAALYWYKTGISNISEVYGDTPEWIQRQTVLQHSFNDCTFELSQM 360 VQWAYDNDIVDDSEIAYKYAQLADTNSNASAFLKSNSQAKIVKDCATMCRHYKRAEKKQM 420 SMSQWIKYRCDRVDDGGDWKQIVMFLRYQGVEFMSFLTALKRFLQGIPKKNCILLYGAAN 480 TGKSLFGMSLMKFLQGSVICFVNSKSHFWLQPLADAKIGMLDDATVPCWNYIDDNLRNAL 540 DGNLVSMDVKHRPLVQLKCPPLLITSNINAGTDSRWPYLHNRLVVFTFPNEFPFDENGNP 600 VYELNDKNWKSFFSRTWSRLSLHEDEDKENDGDSLPTFKCVSGQNTNTL 649 HPV16 E2 Accession number W2WLHS 1 METLCQRLNVCQDKILTHYENDSTDLRDHIDYWKHMRLECAIYYKAREMGFKHINHQVVP 60 TLAVSKNKALQAIELQLTLETIYNSQYSNEKWTLQDVSLEVYLTAPTGCIKKHGYTVEVQ 120 FDGDICNTMHYTNWTHIYICEEASVTVVEGQVDYYGLYYVHEGIRTYFVQFKDDAEKYSK 180 NKVWEVHAGGQVILCPTSVFSSNEVSSPEIIRQHLANHPAATHTKAVALGTEETQTTIQR 240 PRSEPDTGNPCHTTKLLHRDSVDSAPILTAFNSSHKGRINCNSNTTPIVHLKGDANTLKC 300 LRYRFKKHCTLYTAVSSTWHWTGHNVKHKSAIVTLTYDSEWQRDQFLSQVKIPKTITVST 360 GFMSI 365 HPV16 E5 Accession number W5WLHS 1 MTNLDTASTTLLACFLLCFCVLLCVCLLIRPLLLSVSTYTSLIILVLLLWITAASAFRCF 60 IVYIIFVYIPLFLIHTHARFLIT 83 HPV16 E6 1 MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIV 60 YRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPE 120 EKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL 158 HPV16 E7 1 MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCK 60 CDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP 98 HPV16 L1 Accession number AAD33259 1 MQVTFIYILVITCYENDVNVYHIFFQMSLWLPSEATVYLPPVPVSKVVSTDEYVARTNIY 60 YHAGTSRLLAVGHPYFPIKKPNNNKILVPKVSGLQYRVFRIHLPDPNKFGFPDTSFYNPD 120 TQRLVWACVGVEVGRGQPLGVGISGHPLLNKLDDTENASAYAANAGVDNRECISMDYKQT 180 QLCLIGCKPPIGEHWGKGSPCTNVAVNPGDCPPLELINTVIQDGDMVDTGFGAMDFTTLQ 240 ANKSEVPLDICTSICKYPDYIKMVSEPYGDSLFFYLRREQMFVRHLFNRAGAVGENVPDD 300 LYIKGSGSTANLASSNYFPTPSGSMVTSDAQIFNKPYWLQRAQGHNNGICWGNQLFVTVV 360 DTTRSTNMSLCAAISTSETTYKNTNFKEYLRHGEEYDLQFIFQLCKITLTADVMTYIHSM 420 NSTILEDWNFGLQPPPGGTLEDTYRFVTSQAIACQKHTPPAPKEDPLKKYTFWEVNLKEK 480 FSADLDQFPLGRKFLLQAGLKAKPKFTLGKRKATPTTSSTSTTAKRKKRKL 531 HPV16 L2 Accession number AAD33258 1 MRHKRSAKRTKRASATQLYKTCKQAGTCPPDIIPKVEGKTIADQILQYGSMGVFFGGLGI 60 GTGSGTGGRTGYIPLGTRPPTATDTLAPVRPPLTVDPVGPSDPSIVSLVEETSFIDAGAP 120 TSVPSIPPDVSGFSITTSTDTTPAILDINNTVTTVTTHNNPTFTDPSVLQPPTPAETGGH 180 FTLSSSTISTHNYEEIPMDTFIVSTNPNTVTSSTPIPGSRPVARLGLYSRTTQQVKVVDP 240 AFITTPTKLITYDNPAYEGIDVDNTLYFSSNDNSINIAPDPDFLDIVALHRPALTSRRTG 300 IRYSRIGNKQTLRTRSGKSIGAKVHYYYDFSTIDSAEEIELQTITPSTYTTTSHAALPTS 360 INNGLYDIYADDFITDTSTTPVPSVPSTSLSGYIPANTTIPFGGAYNIPLVSGPDIPINI 420 TDQAPSLIPIVPGSPQYTIIADAGDFYLHPSYYMLRKRRKRLPYFFSDVSLAA 473 HPV18 E1 1 MADPEGTDGEGTGCNGWFYVQAIVDKKTGDVISDDEDENATDTGSDMVDFIDTQGTFCEQ 60 AELETAQALFHAQEVHNDAQVLHVLKRKFAGGSTENSPLGERLEVDTELSPRLQEISLNS 120 GQKKAKRRLFTISDSGYGCSEVEATQIQVTTNGEHGGNVCSGGSTEAIDNGGTEGNNSSV 180 DGTSDNSNIENVNPQCTIAQLKDLLKVNNKQGAMLAVFKDTYGLSFTDLVRNFKSDKTTC 240 TDWVTAIFGVNPTIAEGFKTLIQPFILYAHIQCLDCKWGVLILALLRYKCGKSRLTVAKG 300 LSTLLHVPETCMLIQPPKLRSSVAALYWYRTGISNISEVMGDTPEWIQRLTIIQHGIDDS 360 NFDLSEMVQWAFDNELTDESDMAFEYALLADSNSNAAAFLKSNCQAKYLKDCATMCKHYR 420 RAQKRQMNMSQWIRFRCSKIDEGGDWRPIVQFLRYQQIEFITFLGALKSFLKGTPKKNCL 480 VFCGPANTGKSYFGMSFIHFIQGAVISFVNSTSHFWLEPLTDTKVAMLDDATTTCWTYFD 540 TYMRNALDGNPISIDRKHKPLIQLKCPPILLTTNIHPAKDNRWPYLESRITVFEFPNAFP 600 FDKNGNPVYEINDKNWKCFFERTWSRLDLHEEEEDADTEGNPFGTFKLRAGQNHRPL 657 HPV18 E2 Accession number W2WL18 1 MQTPKETLSERLSCVQDKIIDHYENDSKDIDSQIQYWQLIRWENAIFFAAREHGIQTLNH 60 QVVPAYNISKSKAHKAIELQMALQGLAQSRYKTEDWTLQDTCEELWNTEPTHCFKKGGQT 120 VQVYFDGNKDNCMTYVAWDSVYYMTDAGTWDKTATCVSHRGLYYVKEGYNTFYIEFKSEC 180 EKYGNTGTWEVHFGNNVIDCNDSMCSTSDDTVSATQLVKQLQHTPSPYSSTVSVGTAKTY 240 GQTSAATRPGHCGLAEKQHCGPVNPLLGAATPTGNNKRRKLCSGNTTPIIHLKGDRNSLK 300 CLRYRLRKHSDHYRDISSTWHWTGAGNEKTGILTVTYHSETQRTKFLNTVAIPDSVQILV 360 GYMTM 365 HPV18 E5 Accession number WSWL18 1 MLSLIFLFCFCVCMYVCCHVPLLPSVCMCAYAWVLVFVYIVVITSPATAFTVYVFCFLLP 60 MLLLHIHAILSLQ 73 HPV18 E6 1 MARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSI 60 PHAACHKCIDFYSRIRELRHYSDSVYGDTLEKLThTGLYNLLIRCLRCQKPLNPAEKLRH 120 LNEKRRFHNIAGHYRGQCHSCCNRARQERLQRRRETQV 158 HPV18 E7 1 MHGPKATLQDIVLHLEPQNEIPVDLLCHEQLSDSEEENDEIDGVNHQHLPARRAEPQRHT 60 MLCMCCKCEARIKLVVESSADDLRAFQQLFLNTLSFVCPWCASQQ 105 HPV18 L1 Accession number CAA28671 1 MCLYTRVLILHYHLLPLYGPLYHPRPLPLHSILVYMVHIIICGHYIILFLRNVNVFPIFL 60 QMALWRPSDNTVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNK 120 QDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSG 180 HPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRP 240 LSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSA 300 DPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSI 360 VTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDAT 420 KFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTY 480 RFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKP 540 TIGPRKRSAPSATTSSKPAKRVRVRARK 568 HPV18 L2 Accession number P2WL18 1 MVSHRAARRKRASVTDLYKTCKQSGTCPPDVVPKVEGTTLADKILQWSSLGIFLGGLGIG 60 TGSGTGGRTGYIPLGGRSNTVVDVGPTRPPVVIEPVGPTDPSIVTLIEDSSVVTSGAPRP 120 TFTGTSGFDITSAGTTTPAVLDITPSSTSVSISTTNFTNPAFSDPSIIEVPQTGEVAGNV 180 FVGTPTSGTHGYEEIPLQTFASSGTGEEPISSTPLPTVRRVAGPRLYSPAYQQVSVANPE 240 FLTRPSSLITYDNPAFEPVDTTLTFDPRSDVPDSDFMDIIRLHRPALTSRRGTVRFSRLG 300 QPATMFTRSGTQIGARVHFYHDISPIAPSPEYIELQPLVSATEDNDLFDIYADDMDPAVP 360 VPSRSTTSFAFFKYSPTISSASSYSNVTVPLTSSWDVPVYTGPDITLPSTTSVWPIVSPT 420 APASTQYIGIHGTHYYLWPLYYFIPKKRKRVPYFFADGFVAA 462 HPV31 E1 Accession number W1WL31 1 MADPAGTDGEGTGCNGWFYVEAVIDRQTGDNISEDENEDSSDTGEDMVDFIDNCNVYNNQ 60 AEAETAQALFHAQEAEEHAEAVQVLKRKYVGSPLSDISSCVDYNISPRLKAICIENNSKT 120 AKRRLFELPDSGYGNTEVETQQMVQVEEQQTTLSCNGSDGTHSERENETPTRNILQVLKT 180 SNGKAAMLGKFKELYGVSFMELIRPFQSNKSTCTDWCVAAFGVTGTVAEGFKTLLQPYCL 240 YCHLQSLACSWGMVMLMLVRFKCAKNRITIEKLLEKLLCISTNCMLIQPPKLRSTAAALY 300 WYRTGMSNISDVYGETPEWIERQTVLQHSFNDTTFDLSQMVQWAYDNDVMDDSEIAYKYA 360 QLADSDSNACAFLKSNSQAKIVKDCGTMCRHYKRAEKRQMSMGQWIKSRCDKVSDEGDWR 420 DIVKFLRYQQIEFVSFLSALKLFLKGVPKKNCILIHGAPNTGKSYFGMSLISFLQGCIIS 480 YANSKSHFWLQPLADAKIGMLDDATTPCWHYIDNYLRNALDGNPVSIDVKHKALMQLKCP 540
PLLITSNINAGKDDRWPYLHSRLVVFTFPNPFPFDKNGNPVYELSDKNWKSFFSRTWCRL 600 NLHEEEDKENDGDSFSTFKCVSGQNIRTL 629 HPV31 E2 Accession number W2WL31 1 METLSQRLNVCQDKILEHYENDSKRLCDHIDYWKHIRLECVLMYKAREMGIHSINHQVVP 60 ALSVSKAKALQAIELQMMLETLNNTEYKNEDWTMQQTSLELYLTAPTGCLKKHGYTVEVQ 120 FDGDVHNTMHYTNWKFIYLCIDGQCTVVEGQVNCKGIYYVHEGHITYFVNFTEEAKKYGT 180 GKKWEVHAGGQVIVFPESVFSSDEISFAGIVTKLPTANNTTTSNSKTCALGTSEGVRRAT 240 TSTKRPRTEPEHRNTHHPNKLLRGDSVDSVNCGVISAAACTNQTRAVSCPATTPIIHLKG 300 DANILKCLRYRLSKYKQLYEQVSSTWHWTCTDGKHKNAIVTLTYISTSQRDDFLNTVKIP 360 NTVSVSTGYMTI 372 HPV31 E5 Accession number W5WL31 1 MIELNISTVSIVLCFLLCFCVLLFVCLVIRPLVLSVSVYATLLLLIVTLWVIATSPLRCF 60 CIYVVFIYTPLFVIHTHASFLSQQ 84 HPV31 E6 Accession number W6WL31 1 MFKNPAERPRKLHELSSALEIPYDELRLNCVYCKGQLTETEVLDFAFTDLTIVYRDDTPH 60 GVCTKCLRFYSKVSEFRWYRYSVYGTTLEKLTNKGICDLLIRCITCQRPLCPEEKQRHLD 120 KKKRFHNIGGRWTGRCIACWRRPRTETQV 149 HPV31 E7 Accession number W7WL31 1 MRGETPTLQDYVLDLQPEATDLHCYEQLPDSSDEEDVIDSPAGQAEPDTSNYNIVTFCCQ 60 CKSTLRLCVQSTQVDIRILQELLMGSFGIVCPNCSTRL 98 HPV31 L1 Accession number P1WL31 1 MSLWRPSEATVYLPPVPVSKVVSTDEYVTRTNIYYHAGSARLLTVGHPYYSIPKSDNPKK 60 IVVPKVSGLQYRVFRVRLPDPNKFGFPDTSFYNPETQRLVWACVGLEVGRGQPLGVGISG 120 HPLLNKFDDTENSNRYAGGPGTDNRECISMDYKQTQLCLLGCKPPIGEHWGKGSPCSNNA 180 ITPGDCPPLELKNSVIQDGDMVDTGFGAMDFTALQDTKSNVPLDICNSICKYPDYLKMVA 240 EPYGDTLFFYLRREQMFVRHFFNRSGTVGESVPTDLYIKGSGSTATLANSTYFPTPSGSM 300 VTSDAQIFNKPYWMQRAQGHNNGICWGNQLFVTVVDTTRSTNMSVCAAIANSDTTFKSSN 360 FKEYLRHGEEFDLQFIFQLCKITLSADIMTYIHSMNPAILEDWNFGLTTPPSGSLEDTYR 420 FVTSQAITCQKTAPQKPKEDPFKDYVFWEVNLKEKFSADLDQFPLGRKFLLQAGYRARPK 480 FKAGKRSAPSASTTTPAKRKKTKK 504 HPV31 L2 Accession number P2WL31 1 MRSKRSTKRTKRASATQLYQTCKAAGTCPSDVIPKIEHTTIADQILRYGSMGVFFGGLGI 60 GSGSGTGGRTGYVPLSTRPSTVSEASIPIRPPVSIDPVGPLDPSIVSLVEESGIVDVGAP 120 APIPHPPTTSGFDIATTADTTPAILDVTSVSTHENPTFTDPSVLQPPTPAETSGHLLLSS 180 SSISTHNYEEIPMDTFIVSTNNENITSSTPIPGVRRPARLGLYSKATQQVKVIDPTFLSA 240 PKQLITYENPAYETVNAEESLYFSNTSHNIAPDPDFLDIIALHRPALTSRRNTVRYSRLG 300 NKQTLRTRSGATIGARVHYYYDISSINPAGESIEMQPLGASATTTSTLNDGLYDIYADTD 360 FTVDTPATHNVSPSTAVQSTSAVSAYVPTNTTVPLSTGFDIPIFSGPDVPIEHAPTQVFP 420 FPLAPTTPQVSIFVDGGDFYLHPSYYMLKRRRKRVSYFFTDVSVAA 466 HPV45 E1 Accession number S36563 1 MADPEGTDGEGTGCNGWFFVETIVEKKTGDVISDDEDETATDTGSDMVDFIDTQLSICEQ 60 AEQETAQALFHAQEVQNDAQVLHLLKRKFAGGSKENSPLGEQLSVDTDLSPRLQEISLNS 120 GHKKAKRRLFTISDSGYGCSEVEAAETQVTVNTNAENGGSVHSTQSSGGDSSDNAENVDP 180 HCSITELKELLQASNKKAAMLAVFKDIYGLSFTDLVRNFKSDKTTCTDWVMAIFGVNPTV 240 AEGFKTLIKPATLYAHIQCLDCKWGVLILALLRYKCGKNRLTVAKGLSTLLHVPETCMLI 300 EPPKLRSSVAALYWYRTGISNISEVSGDTPEWIQRLTIIQHGIDDSNFDLSDMVQWAFDN 360 DLTDESDMAFQYAQLADCNSNAAAFLKSNCQAKYLKDCAVMCRHYKRAQKRQMNMSQWIK 420 YRCSKIDEGGDWRPIVQFLRYQGVEFISFLRALKEFLKGTPKKNCILLYGPANTGKSYFG 480 MSFIHFLQGAIISFVNSNSHFWLEPLADTKVANLDDATHTCWTYFDNYMRNALDGNPISI 540 DRKHKPLLQLKCPPILLTSNIDPAKDNKWPYLESRVTVFTFPHAFPFDKNGNPVYEINDK 600 NWKCFFERTWSRLDLHEDDEDADTEGIPFGTFKCVTGQNTRPL 643 HPV45 E2 Accession number S36564 MKMQTPKESLSERLSALQDKILDHYENDSKDINSQISYWQLIRLENAILFTAREHGITKL 60 NHQVVPPINISKSKAHKAIELQMALKGLAQSKYNNEEWTLQDTCEELWNTEPSQCFKKGG 120 KTVHVYFDGNKDNCMNYVVWDSIYYITETGIWDKTAACVSYWGVYYIKDGDTTYYVQFKS 180 ECEKYGNSNTWEVQYGGNVIDCNDSMCSTSDDTVSATQIVRQLQHASTSTPKTASVGTPK 240 PHIQTPATKRPRQCGLTEQHHGRVNTHVHNPLLCSSTSNNKRRKVCSGNTTPIIHLKGDK 300 NSLKCLRYRLRKYADHYSEISSTWHWTGCNKNTGILTVTYNSEVQRNTFLDVVTIPNSVQ 360 ISVGYMTI 368 HPV45 E6 Accession number CAB44706 1 MARFDDPTQRPYKLPDLCTELNTSLQDVSIACVYCKATLERTEVYQFAFKDLFIVYRDCI 60 AYAACHKCIDFYSRIRELRYYSNSVYGETLEKITNTELYNLLIRCLRCQKPLNPAEKRRH 120 LKDKRRFHSIAGQYRGQCNTCCDQARQERLRRRRETQV 158 HPV45 E7 Accession number CAB44707 1 MHGPRATLQEIVLHLEPQNELDPVDLLCYEQLSESEEENDEADGVSHAQLPARRAEPQRH 60 KILCVCCKCDGRIELTVESSADDLRTLQQLFLSTLSFVCPWCATNQ 106 HPV45 L1 Accession number CAB44705 1 MAHNIIYGHGIIIFLKNVNVFPIFLQMALWRPSDSTVYLPPPSVARVVNTDDYVSRTSIF 60 YHAGSSRLLTVGNPYFRVVPSGAGNKQAVPKVSAYQYRVFRVALPDPNKFGLPDSTIYNP 120 ETQRLVWACVGMEIGRGQPLGIGLSGHPFYNKLDDTESAHAATAVITQDVRDNVSVDYKQ 180 TQLCILGCVPAIGEHWAKGTLCKPAQLQPGDCPPLELKNTIIEDGDMVDTGYGAMDFSTL 240 QDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGVMGDTVPT 300 DLYIKGTSANMRETPGSCVYSPSPSGSITTSDSQLFNKPYWLHKAQGHNNGICWHNQLFV 360 TVVDTTRSTNLTLCASTQNPVPNTYDPTKFKHYSRHVEEYDLQFIFQLCTITLTAEVMSY 420 IHSMNSSILENWNFGVPPPPTTSLVDTYRFVQSVAVTCQKDTTPPEKQDPYDKLKFWTVD 480 LKEKFSSDLDQYPLGRKFLVQAGLRRRPTIGPRKRPAASTSTASRPAKRVRIRSKK 536 HPV45 L2 Accession number S36565 1 MVSHRAARRKRASATDLYRTCKQSGTCPPDVINKVEGTTLADKILQWSSLGIFLGGLGIG 60 TGSGSGGRTGYVPLGGRSNTVVDVGPTRPPVVIEPVGPTDPSIVTLVEDSSVVASGAPVP 120 TFTGTSGFEITSSGTTTPAVLDITPTVDSVSISSTSFTNPAFSDPSIIEVPQTGEVSGNI 180 FVGTPTSGSHGYEETPLQTFASSGSGTEPISSTPLPTVRRVRGPRLYSRANQQVRVSTSQ 240 FLTHPSSLVTFDNPAYEPLDTTLSFEPTSNVPDSDFMDIIRLHRPALSSRRGTVRFSRLG 300 QRATMFTRSGKQIGGRVHFYHDISPIAATEEIELQPLISATNDSDLFDVYADFPPPASTT 360 PSTIHKSFTYPKYSLTMPSTAASSYSNVTVPLTSAWDVPIYTGPDIILPSHTPMWPSTSP 420 TNASTTTYIGIHGTQYYLWPWYYYFPKKRKRIPYFFADGFVAA 463 HPV33 E1 Accession number W1WL33 1 MADPEGTNGAGMGCTGWFEVEAVIERRTGDNISEDEDETADDSGTDLLEFIDDSMENSIQ 60 ADTEAARALFNIQEGEDDLNAVCALKRKFAACSQSAAEDVVDPAANPCRTSINKNKECTY 120 RKRKIDELEDSGYGNTEVETQQMVQQVESQNGDTNLNDLESSGVGDDSEVSCETNVDSCE 180 NVTLQEISNVLHSSNTKANILYKFKEAYGISFMELVRPFKSDKTSCTDWCITGYGISPSV 240 AESLKVLIKQHSLYTHLQCLTCDRGIIILLLIRFRCSKNRLTVAKLMSNLLSIPETCMVI 300 EPPKLRSQTCALYWFRTAMSNISDVQGTTPEWIDRLTVLQHSFNDNIFDLSEMVQWAYDN 360 ELTDDSDIAYYYAQLADSNSNAAAFLKSNSQAKIVKDCGIMCRHYKKAEKRKMSIGQWIQ 420 SRCEKTNDGGNWRPIVQLLRYQNIEFTAFLGAFKKFLKGIPKKSCMLICGPANTGKSYFG 480 MSLIQFLKGCVISCVNSKSHFWLQPLSDAKIGMIDDVTPISWTYIDDYMRNALDGNEISI 540 DVKHRALVQLKCPPLLLTSNTNAGTDSRWPYLHSRLTVFEFKNPFPFDENGNPVYAINDE 600 NWKSFFSRTWCKLDLIEEEDKENRGGNISTFKCSAGENTRSLRS 644 HPV33 E2 Accession number W2WL33 1 MEEISARLNAVQEKILDLYEADKTDLPSQTEHWKLIRMECALLYTAKQMGFSHLCHQVVP 60 SLLASKTKAFQVIELQMALETLSKSQYSTSQWTLQQTSLEVWLCEPPKCFKKQGETVTVQ 120 YDNDKKNTMDYTNWGEIYIIEEDTCTMVTGKVDYIGMYYIHNCEKVYFKYFKEDAAKYSK 180 TQMWEVHVGGQVIVCPTSISSNQTSTTETADIQTDNDNRPPQAAAKRRRPADTTDTAQPL 240 TKLFCADPALDNRTARTATNCTNKQRTVCSSNVAPIVHLKGESNSLKCLRYRLKPYKELY 300 SSMSSTWHWTSDNKNSKNGIVTVTFVTEQQQQMFLGTVKIPPTVQISTGFMTL 353 HPV33 E5 Accession number W5WL33 1 MIFVFVLCFILFLCLSLLLRPLILSISTYAWLLVLVLLLWVFVGSPLKIFFCYLLFLYLP 60 MMCINFHAQHMTQQE 75 HPV33 E6 Accession number W6WL33 1 MFQDTEEKPRTLHDLCQALETTIHNIELQCVECKKPLQRSEVYDFAFADLTVVYREGNPF 60 GICKLCLRFLSKISEYRHYNYSVYGNTLEQTVKKPLNEILIRCIICQRPLCPQEKKRHVD 120 LNKRFHNISGRWAGRCAACWRSRRRETAL 149 HPV33 E7 Accession number W7WL33 1 MRGHKPTLKEYVLDLYPEPTDLYCYEQLSDSSDEDEGLDRPDGQAQPATADYYIVTCCHT 60 CNTTVRLCVNSTASDLRTIQQLLMGTVNIVCPTCAQQ 97 HPV33 L1 Accession number P1WL33 1 MSVWRPSEATVYLPPVPVSKVVSTDEYVSRTSIYYYAGSSRLLAVGHPYFSIKNPTNAKK 60 LLVPKVSGLQYRVFRVRLPDPNKFGFPDTSFYNPDTQRLVWACVGLEIGRGQPLGVGISG 120 HPLLNKFDDTETGNKYPGQPGADNPECLSMDYKQTQLCLLGCKPPTGEHWGKGVACTNAA 180 PANDCPPLELINTIIEDGDMVDTGFGCMDFKTLQANKSDVPIDICGSTCKYPDYLKMTSE 240 PYGDSLFFFLRREQMFVRHFFNRAGTLGEAVPDDLYIKGSGTTASIQSSAFFPTPSGSMV 300 TSESQLFNKPYWLQRAQGHNNGICWGNQVFVTVVDTTRSThMTLCTQVTSDSTYKNENFK 360 EYIRHVEEYDLQFVFQLCKVTLTAEVMTYIHAMNPDILEDWQFGLTPPPSASLQDTYRFV 420 TSQAITCQKTVPPKEKEDPLGKYTFWEVDLKEKFSADLDQFPLGRKFLLQAGLKAKPKLK 480 RAAPTSTRTSSAKRKKVKK 499 HPV33 L2 Accession number P2WL33 1 MRHKRSTRRKRASATQLYQTCKATGTCPPDVIPKVEGSTIADQILKYGSLGVFFGGLGIG 60 TGSGSGGRTGYVPIGTDPPTAAIPLQPIRPPVTVDTVGPLDSSIVSLIEETSFIEAGAPA 120 PSIPTPSGFDVTTSADTTPAIINVSSVGESSIQTISTHLNPTFTEPSVLHPPAPAEASGH 180 FIFSSPTVSTQSYENIPMDTFVVSTDSSNVTSSTPIPGSRPVARLGLYSRNTQQVKVVDP 240 AFLTSPHKLITYDNPAFESFDPEDTLQFQHSDISPAPDPDFLDIIALHRPAITSRRHTVR 300 FSRVGQKATLKTRSGKQIGARIHYYQDLSPIVPLDHTVPNEQYELQPLHDTSTSSYSIND 360 GLYDVYADDVDNVHTPMQHSYSTFATTRTSNVSIPLNTGFDTPVMSGPDIPSPLFPTSSP 420 FVPISPFFPFDTIVVDGADFVLHPSYFILRRRRKRFPYFFTDVRVAA 467 HPV56 E2 Accession number S36581 1 MVPCLQVCKAKACSAIEVQTALESLSTTIYNNEEWTLRDTCEELWLTEPKKCFKKEGQHI 60
EVWFDGSKNNCMQYVAWKYIYYNGDCGWQKVCSGVDYRGIYYVHDGHKTYYTDFEQEAKK 120 FGCKNIWEVHMENESIYCPDSVSSTCRYNVSPVETVNEYNTHKTTTTTSTSVGNQDAAVS 180 HRPGKRPRLRESEFDSSRESHAKCVTTHTHISDTDNTDSRSRSINNNNHPGDKTTPVVHL 240 KGEPNRLKCCRYRFQKYKTLFVDVTSTYHWTSTDNKNYSIITIIYKDETQRNSFLSHVKI 300 PVVYRLVWDK 310 HPV56 E6 Accession number W6WL56 1 MEPQFNNPQERPRSLHHLSEVLEIPLIDLRLSCVYCKKELTRAEVYNFACTELKLVYRDD 60 FPYAVCRVCLLFYSKVRKYRYYDYSVYGATLESITKKQLCDLLIRCYRCQSPLTPEEKQL 120 HCDRKRRFHLIAHGWTGSCLGCWRQTSREPRESTV 155 HPV56 E7 Accession number S36580 1 MHGKVPTLQDVVLELTPQTEIDLQCNEQLDSSEDEDEDEVDHLQERPQQARQAKQHTCYL 60 IHVPCCECKFVVQLDIQSTKEDLRVVQQLLMGALTVTCPLCASSN 105 HPV56 L1 Accession number 538563 1 MMLPMMYIYRDPPLHYGLCIFLDVGAVNVFPIFLQMATWRPSENKVYLPPTPVSKVVATD 60 SYVKRTSIFYHAGSSRLLAVGHPYYSVTKDNTKTNIPKVSAYQYRVFRVRLPDPNKFGLP 120 DTNIYNPDQERLVWACVGLEVGRGQPLGAGLSGHPLFNRLDDTESSNLANNNVIEDSRDN 180 ISVDGKQTQLCIVGCTPAMGEHWTKGAVCKSTQVTTGDCPPLALINTPIEDGDMIDTGFG 240 AMDFKVLQESKAEVPLDIVQSTCKYPDYLKMSADAYGDSMWFYLRREQLFARHYFNRAGK 300 VGETIPAELYLKGSNGREPPPSSVYVATPSGSMITSEAQLFNKPYWLQRAQGHNNGICWG 360 NQLFVTVVDTTRSTNMTISTATEQLSKYDARKINQYLRHVEEYELQFVFQLCKITLSAEV 420 MAYLHNMNANLLEDWNIGLSPPVATSLEDKYRYVRSTAITCQREQPPTEKQDPLAKYKFW 480 DVNLQDSFSTDLDQFPLGRKFLMQLGTRSKPAVATSKKRSAPTSTSTPAKRKRR 534 HPV56 L2 Accession number 536582 1 MVAHRATRRKRASATQLYKTCKLSGTCPEDVVNKIEQKTWADKILQWGSLFTYFGGLGIG 60 TGTGSGGRAGYVPLGSRPSTIVDVTPARPPIVVESVGPTDPSIVTLVEESSVIESGAGIP 120 NFTGSGGFEITSSSTTTPAVLDITPTSSTVHVSSTHITNPLFIDPPVIEAPQTGEVSGNI 180 LISTPTSGIHSYEEIPMQTFAVHGSGTEPISSTPIPGFRRIAAPRLYRKAFQQVKVTDPA 240 FLDRPATLVSADNPLFEGTDTSLAFSPSGVAPDPDFMNIVALHRPAFTTRRGGVRFSRLG 300 RKATIQTRRGTQIGARVHYYYDISPIAQAEEIEMQPLLSANNSFDGLYDIYANIDDEAPG 360 LSSQSVATPSAHLPIKPSTLSFASNTTNVTAPLGNVWETPFYSGPDIVLPTGPSTWPFVP 420 QSPYDVTHDVYIQGSSFALWPVYFFRRRRRKRIPYFFADGDVAA 464
HLA Class I Motifs Indicative of CTL Inducing Peptide Epitopes
[0094]The primary anchor residues of the HLA class I peptide epitope supermotifs and motifs delineated below are summarized in Table I. The HLA class I motifs set out in Table I (a) are those most particularly relevant to the invention claimed here. Primary and secondary anchor positions are summarized in Table II. Allele-specific HLA molecules that comprise HLA class I supertype families are listed in Table VI. In some cases, peptide epitopes may be listed in both a motif and a supermotif Table. The relationship of a particular motif and respective supermotif is indicated in the description of the individual motifs.
HLA-A1 Supermotif
[0095]The HLA-A1 supermotif is characterized by the presence in peptide ligands of a small (T or S) or hydrophobic (L, I, V, or M) primary anchor residue in position 2, and an aromatic (Y, F, or W) primary anchor residue at the C-terminal position of the epitope. The corresponding family of HLA molecules that bind to the A1 supermotif (i.e., the HLA-A1 supertype) is comprised of at least A*0101, A*2601, A*2602, A*2501, and A*3201 (see, e.g., DiBrino, M. et al., J. Immunol. 151:5930, 1993; DiBrino, M. et al., J. Immunol. 152:620, 1994; Kondo, A. et al., Immunogenetics 45:249, 1997). Other allele-specific HLA molecules predicted to be members of the A1 superfamily are shown in Table VI. Peptides binding to each of the individual HLA proteins can be modulated by substitutions at primary and/or secondary anchor positions, preferably choosing respective residues specified for the supermotif.
[0096]Representative peptide epitopes that comprise the A1 supermotif are set forth in Table VII.
HLA-A2 Supermotif
[0097]Primary anchor specificities for allele-specific HLA-A2.1 molecules (see, e.g., Falk et al., Nature 351:290-296, 1991; Hunt et al., Science 255:1261-1263, 1992; Parker et al., J. Immunol. 149:3580-3587, 1992; Ruppert et al., Cell 74:929-937, 1993) and cross-reactive binding among HLA-A2 and -A28 molecules have been described. (See, e.g., Fruci et al., Human Immunol. 38:187-192, 1993; Tanigaki et al., Human Immunol. 39:155-162, 1994; Del Guercio et al., J. Immunol. 154:685-693, 1995; Kast et al., J. Immunol. 152:3904-3912, 1994 for reviews of relevant data.) These primary anchor residues define the HLA-A2 supermotif; which presence in peptide ligands corresponds to the ability to bind several different HLA-A2 and -A28 molecules. The HLA-A2 supermotif comprises peptide ligands with L, I, V, M, A, T, or Q as a primary anchor residue at position 2 and L, I, V, M, A, or T as a primary anchor residue at the C-terminal position of the epitope.
[0098]The corresponding family of HLA molecules (i.e., the HLA-A2 supertype that binds these peptides) is comprised of at least: A*0201, A*0202, A*0203, A*0204, A*0205, A*0206, A*0207, A*0209, A*0214, A*6802, and A*6901. Other allele-specific HLA molecules predicted to be members of the A2 superfamily are shown in Table VI. As explained in detail below, binding to each of the individual allele-specific HLA molecules can be modulated by substitutions at the primary anchor and/or secondary anchor positions, preferably choosing respective residues specified for the supermotif.
[0099]Representative peptide epitopes that comprise an A2 supermotif are set forth in Table VIII. The motifs comprising the primary anchor residues V, A, T, or Q at position 2 and L, I, V, A, or T at the C-terminal position are those most particularly relevant to the invention claimed herein.
HLA-A3 Supermotif
[0100]The HLA-A3 supermotif is characterized by the presence in peptide ligands of A, L, I, V, M, S, or, T as a primary anchor at position 2, and a positively charged residue, R or K, at the C-terminal position of the epitope, e.g., in position 9 of 9-mers (see, e.g., Sidney et al., Hum. Immunol. 45:79, 1996). Exemplary members of the corresponding family of HLA molecules (the HLA-A3 supertype) that bind the A3 supermotif include at least A*0301, A*1101, A*3101, A*3301, and A*6801. Other allele-specific HLA molecules predicted to be members of the A3 supertype are shown in Table VI. As explained in detail below, peptide binding to each of the individual allele-specific HLA proteins can be modulated by substitutions of amino acids at the primary and/or secondary anchor positions of the peptide, preferably choosing respective residues specified for the supermotif.
[0101]Representative peptide epitopes that comprise the A3 supermotif are set forth in Table IX.
HLA-A24 Supermotif
[0102]The HLA-A24 supermotif is characterized by the presence in peptide ligands of an aromatic (F, W, or Y) or hydrophobic aliphatic (L, I, V, M, or T) residue as a primary anchor in position 2, and Y, F, W, L, I, or M as primary anchor at the C-terminal position of the epitope (see, e.g., Sette and Sidney, Immunogenetics 1999 November; 50 (3-4):201-12, Review). The corresponding family of HLA molecules that bind to the A24 supermotif (i.e., the A24 supertype) includes at least A*2402, A*3001, and A*2301. Other allele-specific HLA molecules predicted to be members of the A24 supertype are shown in Table VI. Peptide binding to each of the allele-specific HLA molecules can be modulated by substitutions at primary and/or secondary anchor positions, preferably choosing respective residues specified for the supermotif.
[0103]Representative peptide epitopes that comprise the A24 supermotif are set forth in Table X.
HLA-B7 Supermotif
[0104]The HLA-B7 supermotif is characterized by peptides bearing proline in position 2 as a primary anchor, and a hydrophobic or aliphatic amino acid (L, I, V, M, A, F, W, or Y) as the primary anchor at the C-terminal position of the epitope. The corresponding family of HLA molecules that bind the B7 supermotif (i.e., the HLA-B7 supertype) is comprised of at least twenty six HLA-B proteins including: B*0702, B*0703, B*0704, B*0705, B*1508, B*3501, B*3502, B*3503, B*3504, B*3505, B*3506, B*3507, B*3508, B*5101, B*5102, B*5103, B*5104, B*5105, B*5301, B*5401, B*5501, B*5502, B*5601, B*5602, B*6701, and B*7801 (see, e.g., Sidney, et al., J. Immunol. 154:247, 1995; Barber, et al., Curr. Biol. 5:179, 1995; Hill, et al., Nature 360:434, 1992; Rammensee, et al., Immunogenetics 41:178, 1995 for reviews of relevant data). Other allele-specific HLA molecules predicted to be members of the B7 supertype are shown in Table VI. As explained in detail below, peptide binding to each of the individual allele-specific HLA proteins can be modulated by substitutions at the primary and/or secondary anchor positions of the peptide, preferably choosing respective residues specified for the supermotif.
[0105]Representative peptide epitopes that comprise the B7 supermotif are set forth in Table XI.
HLA-B27 Supermotif
[0106]The HLA-B27 supermotif is characterized by the presence in peptide ligands of a positively charged (R, H, or K) residue as a primary anchor at position 2, and a hydrophobic (F, Y, L, W, M, I, A, or V) residue as a primary anchor at the C-terminal position of the epitope (see, e.g., Sidney and Sette, Immunogenetics 1999 November; 50 (3-4):201-12, Review). Exemplary members of the corresponding family of HLA molecules that bind to the B27 supermotif (i.e., the B27 supertype) include at least B*1401, B*1402, B*1509, B*2702, B*2703, B*2704, B*2705, B*2706, B*3801, B*3901, B*3902, and B*7301. Other allele-specific HLA molecules predicted to be members of the B27 supertype are shown in Table VI. Peptide binding to each of the allele-specific HLA molecules can be modulated by substitutions at primary and/or secondary anchor positions, preferably choosing respective residues specified for the supermotif.
[0107]Representative peptide epitopes that comprise the B27 supermotif are set forth in Table XII.
HLA-B44 Supermotif
[0108]The HLA-B44 supermotif is characterized by the presence in peptide ligands of negatively charged (D or E) residues as a primary anchor in position 2, and hydrophobic residues (F, W, Y, L, I, M, V, or A) as a primary anchor at the C-terminal position of the epitope (see, e.g., Sidney et al., Immunol. Today 17:261, 1996). Exemplary members of the corresponding family of HLA molecules that bind to the B44 supermotif (i.e., the B44 supertype) include at least: B*1801, B*1802, B*3701, B*4001, B*4002, B*4006, B*4402, B*4403, and B*4006. Peptide binding to each of the allele-specific HLA molecules can be modulated by substitutions at primary and/or secondary anchor positions; preferably choosing respective residues specified for the supermotif.
HLA-B58 Supermotif
[0109]The HLA-B58 supermotif is characterized by the presence in peptide ligands of a small aliphatic residue (A, S, or T) as a primary anchor residue at position 2, and an aromatic or hydrophobic residue (F, W, Y, L, I, V, M, or A) as a primary anchor residue at the C-terminal position of the epitope (see, e.g., Sidney and Sette, Immunogenetics 1999 November; 50 (3-4):201-12, Review). Exemplary members of the corresponding family of HLA molecules that bind to the B58 supermotif (i.e., the B58 supertype) include at least: B*1516, B*1517, B*5701, B*5702, and B*5801. Other allele-specific HLA molecules predicted to be members of the B58 supertype are shown in Table VI. Peptide binding to each of the allele-specific HLA molecules can be modulated by substitutions at primary and/or secondary anchor positions, preferably choosing respective residues specified for the supermotif.
[0110]Representative peptide epitopes that comprise the B58 supermotif are set forth in Table XIII.
HLA-B62 Supermotif
[0111]The HLA-B62 supermotif is characterized by the presence in peptide ligands of the polar aliphatic residue Q or a hydrophobic aliphatic residue (L, V, M, I, or P) as a primary anchor in position 2, and a hydrophobic residue (F, W, Y, M, I, V, L, or A) as a primary anchor at the C-terminal position of the epitope (see, e.g., Sidney and Sette, Immunogenetics 1999 November; 50 (3-4):201-12, Review). Exemplary members of the corresponding family of HLA molecules that bind to the B62 supermotif (i.e., the B62 supertype) include at least: B*1501, B*1502, B*1513, and B5201. Other allele-specific HLA molecules predicted to be members of the B62 supertype are shown in Table VI. Peptide binding to each of the allele-specific HLA molecules can be modulated by substitutions at primary and/or secondary anchor positions, preferably choosing respective residues specified for the supermotif.
[0112]Representative peptide epitopes that comprise the B62 supermotif are set forth in Table XIV.
HLA-A1 Motif
[0113]The HLA-A1 motif is characterized by the presence in peptide ligands of T, S, or M as a primary anchor residue at position 2 and the presence of Y as a primary anchor residue at the C-terminal position of the epitope. An alternative allele-specific A1 motif is characterized by a primary anchor residue at position 3 rather than position 2. This motif is characterized by the presence of D, E, A, or S as a primary anchor residue in position 3, and a Y as a primary anchor residue at the C-terminal position of the epitope (see, e.g., DiBrino et al., J. Immunol., 152:620, 1994; Kondo et al., Immunogenetics 45:249, 1997; and Kubo et al., J. Immunol. 152:3913, 1994 for reviews of relevant data). Peptide binding to HLA A1 can be modulated by substitutions at primary and/or secondary anchor positions, preferably choosing respective residues specified for the motif.
[0114]Representative peptide epitopes that comprise either A1 motif are set forth in Table XV. Those epitopes comprising T, S, or M at position 2 and Y at the C-terminal position are also included in the listing of HLA-A1 supermotif-bearing peptides listed in Table VII, as these residues are a subset of the A1 supermotif primary anchors.
HLA-A*0201 Motif
[0115]An HLA-A2*0201 motif was determined to be characterized by the presence in peptide ligands of L or M as a primary anchor residue in position 2, and L or V as a primary anchor residue at the C-terminal position of a 9-residue peptide (see, e.g., Falk et al., Nature 351:290-296, 1991) and was further found to comprise an I at position 2 and I or A at the C-terminal position of a nine amino acid peptide (see, e.g., Hunt et al., Science 255:1261-1263, Mar. 6, 1992; Parker et al., J. Immunol. 149:3580-3587, 1992). The A*0201 allele-specific motif has also been defined by the present inventors to additionally comprise V, A, T, or Q as a primary anchor residue at position 2, and M or T as a primary anchor residue at the C-terminal position of the epitope (see, e.g., Kast et al., J. Immunol. 152:3904-3912, 1994). Thus, the HLA-A*0201 motif comprises peptide ligands with L, I, V, M, A, T, or Q as primary anchor residues at position 2 and L, I, V, M, A, or T as a primary anchor residue at the C-terminal position of the epitope. The preferred and tolerated residues that characterize the primary anchor positions of the HLA-A*0201 motif are identical to the residues describing the A2 supermotif. (For reviews of relevant data, see, e.g., Del Guercio et al., J. Immunol. 154:685-693, 1995; Ruppert et al., Cell 74:929-937, 1993; Sidney et al., Immunol. Today 17:261-266, 1996; Sette and Sidney, Curr. Opin. in Immunol. 10:478-482, 1998). Secondary anchor residues that characterize the A*0201 motif have additionally been defined (see, e.g., Ruppert et al., Cell 74:929-937, 1993). These are shown in Table II. Peptide binding to HLA-A*0201 molecules can be modulated by substitutions at primary and/or secondary anchor positions, preferably choosing respective residues specified for the motif.
[0116]Representative peptide epitopes that comprise an A*0201 motif are set forth in Table VIII. The A*0201 motifs comprising the primary anchor residues V, A, T, or Q at position 2 and L, I, V, A, or T at the C-terminal position are those most particularly relevant to the invention claimed herein.
HLA-A3 Motif
[0117]The HLA-A3 motif is characterized by the presence in peptide ligands of L, M, V, I, S, A, T, F, C, G, or D as a primary anchor residue at position 2, and the presence of K, Y, R, H, F, or A as a primary anchor residue at the C-terminal position of the epitope (see, e.g., DiBrino et al., Proc. Natl. Acad. Sci. USA 90:1508, 1993; and Kubo et al., J. Immunol. 152:3913-3924, 1994). Peptide binding to HLA-A3 can be modulated by substitutions at primary and/or secondary anchor positions, preferably choosing respective residues specified for the motif.
[0118]Representative peptide epitopes that comprise the A3 motif are set forth in Table XVI. Those epitopes that also comprise the A3 supermotif are also listed in Table IX. The A3 supermotif primary anchor residues comprise a subset of the A3- and A 11-allele specific motif primary anchor residues.
HLA-A 11 Motif
[0119]The HLA-A11 motif is characterized by the presence in peptide ligands of V, T, M, L, I, S, A, G, N, C, D, or F as a primary anchor residue in position 2, and K, R, Y, or H as a primary anchor residue at the C-terminal position of the epitope (see, e.g., Zhang et al., Proc. Natl. Acad. Sci. USA 90:2217-2221, 1993; and Kubo et al., J. Immunol. 152:3913-3924, 1994). Peptide binding to HLA-A11 can be modulated by substitutions at primary and/or secondary anchor positions, preferably choosing respective residues specified for the motif.
[0120]Representative peptide epitopes that comprise the A11 motif are set forth in Table XVII; peptide epitopes comprising the A3 allele-specific motif are also present in this Table because of the extensive overlap between the A3 and A11 motif primary anchor specificities. Further, those peptide epitopes that comprise the A3 supermotif are also listed in Table IX.
HLA-A24 Motif
[0121]The HLA-A24 motif is characterized by the presence in peptide ligands of Y, F, W, or M as a primary anchor residue in position 2, and F, L, I, or W as a primary anchor residue at the C-terminal position of the epitope (see, e.g., Kondo et al., J. Immunol. 155:4307-4312, 1995; and Kubo et al., J. Immunol. 152:3913-3924, 1994). Peptide binding to HLA-A24 molecules can be modulated by substitutions at primary and/or secondary anchor positions; preferably choosing respective residues specified for the motif.
[0122]Representative peptide epitopes that comprise the A24 motif are set forth in Table XVIII. These epitopes are also listed in Table X, which sets forth HLA-A24-supermotif-bearing peptides, as the primary anchor residues characterizing the A24 allele-specific motif comprise a subset of the A24 supermotif primary anchor residues.
Motifs Indicative of Class II HTL Inducing Peptide Epitopes
[0123]The primary and secondary anchor residues of the HLA class II peptide epitope supermotifs and motifs delineated below are summarized in Table III.
HLA DR-1-4-7 Supermotif
[0124]Motifs have also been identified for peptides that bind to three common HLA class II allele-specific HLA molecules: HLA DRB1*0401, DRB1*0101, and DRB1*0701 (see, e.g., the review by Southwood et al. J Immunology 160:3363-3373, 1998). Collectively, the common residues from these motifs delineate the HLA DR-1-4-7 supermotif. Peptides that bind to these DR molecules carry a supermotif characterized by a large aromatic or hydrophobic residue (Y, F, W, L, I, V, or M) as a primary anchor residue in position 1, and a small, non-charged residue (S, T, C, A, P, V, I, L, or M) as a primary anchor residue in position 6 of a 9-mer core region. Allele-specific secondary effects and secondary anchors for each of these HLA types have also been identified (Southwood et al., supra). These are set forth in Table III. Peptide binding to HLA-DRB1*0401, DRB1*0101, and/or DRB1*0701 can be modulated by substitutions at primary and/or secondary anchor positions, preferably choosing respective residues specified for the supermotif.
[0125]Representative 9-mer epitopes comprising the DR-1-4-7 supermotif, wherein position 1 of the supermotif is at position 1 of the nine-residue core, are set forth in Table XIX. Exemplary epitopes of 15 amino acids in length that comprises the nine residue core include the three residues on either side that flank the nine residue core. HTL epitopes that comprise the core sequences can also be of lengths other than 15 amino acids, supra. Accordingly, epitopes of the invention include sequences that typically comprise the nine residue core plus 1, 2, 3 (as in the exemplary 15-mer), 4, or 5 flanking residues on either side of the nine residue core.
HLA DR3 Motifs
[0126]Two alternative motifs (i.e., submotifs) characterize peptide epitopes that bind to HLA-DR3 molecules (see, e.g., Geluk et al., J. Immunol. 152:5742, 1994). In the first motif (submotif DR3A) a large, hydrophobic residue (L, I, V, M, F, or Y) is present in anchor position 1 of a 9-mer core, and D is present as an anchor at position 4, towards the carboxyl terminus of the epitope. As in other class II motifs, core position 1 may or may not occupy the peptide N-terminal position.
[0127]The alternative DR3 submotif provides for lack of the large, hydrophobic residue at anchor position 1, and/or lack of the negatively charged or amide-like anchor residue at position 4, by the presence of a positive charge at position 6 towards the carboxyl terminus of the epitope. Thus, for the alternative allele-specific DR3 motif (submotif DR3B): L, I, V, M, F, Y, A, or Y is present at anchor position 1; D, N, Q, E, S, or T is present at anchor position 4; and K, R, or H is present at anchor position 6. Peptide binding to HLA-DR3 can be modulated by substitutions at primary and/or secondary anchor positions, preferably choosing respective residues specified for the motif.
[0128]Representative 9-mer epitopes corresponding to a nine residue sequence comprising the DR3a and DR3b submotifs (wherein position 1 of the motif is at position 1 of the nine residue core) are set forth in Table XXa and b. Exemplary epitopes of 15 amino acids in length that comprises the nine residue core include the three residues on either side that flank the nine residue core. HTL epitopes that comprises the cores sequences can also be of lengths other than 15 amino acids, supra. Accordingly, epitopes of the invention include sequences that typically comprise the nine residue core plus 1, 2, 3 (as in the exemplary 15-mer), 4, or 5 flanking residues on either side of the nine residue core.
[0129]Each of the HLA class I or class II epitopes set out in the Tables herein are deemed singly to be an inventive aspect of this application. Further, it is also an inventive aspect of this application that each epitope may be used in combination with any other epitope.
Enhancing Population Coverage of the Vaccine
[0130]Vaccines that have broad population coverage are preferred because they are more commercially viable and generally applicable to the most people. Broad population coverage can be obtained using the peptides of the invention (and nucleic acid compositions that encode such peptides) through selecting peptide epitopes that bind to HLA alleles which, when considered in total, are present in most of the population. The Table below lists the overall frequencies of the HLA class I supertypes in various ethnicities (section a) and the combined population coverage achieved by the A2-, A3-, and B7-supertypes (section b). The A2-, A3-, and B7 supertypes are each present on the average of over 40% in each of these five major ethnic groups. Coverage in excess of 80% is achieved with a combination of these supermotifs. These results suggest that effective and non-ethnically biased population coverage is achieved upon use of a limited number of cross-reactive peptides. Although the population coverage reached with these three main peptide specificities is high, coverage can be expanded to reach 95% population coverage and above, and more easily achieve truly multispecific responses upon use of additional supermotif or allele-specific motif bearing peptides.
[0131]The B44-, A1-, and A24-supertypes are each present, on average, in a range from 25% to 40% in these major ethnic populations (section a). While less prevalent overall, the B27-, B58-, and B62 supertypes are each present with a frequency >25% in at least one major ethnic group (section a). In section b, the Table summarizes the estimated prevalence of combinations of HLA supertypes that have been identified in five major ethnic groups. The incremental coverage obtained by the inclusion of A1-, A24-, and B44-supertypes to the A2, A3, and B7 coverage and coverage obtained with all of the supertypes described herein, is shown.
[0132]The data presented herein, together with the previous definition of the A2-, A3-, and B7-supertypes, indicates that all antigens, with the possible exception of A29, B8, and B46, can be classified into a total of nine HLA supertypes. By including epitopes from the six most frequent supertypes, an average population coverage of 99% is obtained for five major ethnic groups.
Population Coverage with Combined HLA Supertypes
TABLE-US-00002 PHENOTYPIC FREQUENCY North HLA- American SUPERTYPES Caucasian Black Japanese Chinese Hispanic Average a. Individual Supertypes A2 45.8 39.0 42.4 45.9 43.0 43.2 A3 37.5 42.1 45.8 52.7 43.1 44.2 B7 43.2 55.1 57.1 43.0 49.3 49.5 A1 47.1 16.1 21.8 14.7 26.3 25.2 A24 23.9 38.9 58.6 40.1 38.3 40.0 B44 43.0 21.2 42.9 39.1 39.0 37.0 B27 28.4 26.1 13.3 13.9 35.3 23.4 B62 12.6 4.8 36.5 25.4 11.1 18.1 B58 10.0 25.1 1.6 9.0 5.9 10.3 b. Combined Supertypes A2, A3, B7 84.3 86.8 89.5 89.8 86.8 87.4 A2, A3, B7, A24, 99.5 98.1 100.0 99.5 99.4 99.3 B44, A1 A2, A3, B7, A24, 99.9 99.6 100.0 99.8 99.9 99.8 B44, A1, B27, B62, B58
Immune Response-Stimulating Peptide Analogs
[0133]In general, CTL and HTL responses to whole antigens are not directed against all possible epitopes. Rather, they are restricted to a few "immunodominant" determinants (Zinkernagel, et al., Adv. Immunol. 27:5159, 1979; Bennink, et al., J. Exp. Med. 168:19351939, 1988; Rawle, et al., J. Immunol. 146:3977-3984, 1991). It has been recognized that immunodominance (Benacerraf, et al., Science 175:273-279, 1972) could be explained by either the ability of a given epitope to selectively bind a particular HLA protein (determinant selection theory) (Vitiello, et al., J. Immunol. 131:1635, 1983); Rosenthal, et al., Nature 267:156-158, 1977), or to be selectively recognized by the existing TCR (T cell receptor) specificities (repertoire theory) (Klein, J., IMMUNOLOGY, THE SCIENCE OF SELFNONSELF DISCRIMINATION, John Wiley & Sons, New York, pp. 270-310, 1982). It has been demonstrated that additional factors, mostly linked to processing events, can also play a key role in dictating, beyond strict immunogenicity, which of the many potential determinants will be presented as immunodominant (Sercarz, et al., Annu. Rev. Immunol. 11:729-766, 1993).
[0134]The concept of dominance and subdominance is relevant to immunotherapy of both infectious diseases and cancer. For example, in the course of chronic viral disease, recruitment of subdominant epitopes can be important for successful clearance of the infection, especially if dominant CTL or HTL specificities have been inactivated by functional tolerance, suppression, mutation of viruses and other mechanisms (Franco, et al., Curr. Opin. Immunol. 7:524-531, 1995). In the case of cancer and tumor antigens, CTLs recognizing at least some of the highest binding affinity peptides might be functionally inactivated. Lower binding affinity peptides are preferentially recognized at these times, and may therefore be preferred in therapeutic or prophylactic anti-cancer vaccines.
[0135]In particular, it has been noted that a significant number of epitopes derived from known non-viral tumor associated antigens (TAA) bind HLA class I with intermediate affinity (IC50 in the 50-500 nM range). For example, it has been found that 8 of 15 known TAA peptides recognized by tumor infiltrating lymphocytes (TIL) or CTL bound in the 50-500 nM range. (These data are in contrast with estimates that 90% of known viral antigens were bound by HLA class I molecules with IC50 of 50 nM or less, while only approximately 10% bound in the 50-500 nM range (Sette, et al., J. Immunol., 153:558-5592, 1994). In the cancer setting this phenomenon is probably due to elimination or functional inhibition of the CTL recognizing several of the highest binding peptides, presumably because of T cell tolerization events.
[0136]Without intending to be bound by theory, it is believed that because T cells to dominant epitopes may have been clonally deleted, selecting subdominant epitopes may allow existing T cells to be recruited, which will then lead to a therapeutic or prophylactic response. However, the binding of HLA molecules to subdominant epitopes is often less vigorous than to dominant ones. Accordingly, there is a need to be able to modulate the binding affinity of particular immunogenic epitopes for one or more HLA molecules, and thereby to modulate the immune response elicited by the peptide, for example to prepare analog peptides which elicit a more vigorous response. This ability would greatly enhance the usefulness of peptide epitope-based vaccines and therapeutic agents.
[0137]Although peptides with suitable cross-reactivity among all alleles of a superfamily are identified by the screening procedures described above, cross-reactivity is not always as complete as possible, and in certain cases procedures to increase cross-reactivity of peptides can be useful; moreover, such procedures can also be used to modify other properties of the peptides such as binding affinity or peptide stability. Having established the general rules that govern cross-reactivity of peptides for HLA alleles within a given motif or supermotif, modification (i.e., analoging) of the structure of peptides of particular interest in order to achieve broader (or otherwise modified) HLA binding capacity can be performed. More specifically, peptides which exhibit the broadest cross-reactivity patterns, can be produced in accordance with the teachings herein. The present concepts related to analog generation are set forth in greater detail in co-pending U.S. Ser. No. 09/226,775 filed Jan. 6, 1999.
[0138]In brief, the strategy employed utilizes the motifs or supermotifs which correlate with binding to certain HLA molecules. The motifs or supermotifs are defined by having primary anchors, and in many cases secondary anchors. Analog peptides can be created by substituting amino acid residues at primary anchor, secondary anchor, or at primary and secondary anchor positions. Generally, analogs are made for peptides that already bear a motif or supermotif. Preferred secondary anchor residues of supermotifs and motifs that have been defined for HLA class I and class II binding peptides are shown in Tables II and III, respectively.
[0139]For a number of the motifs or supermotifs in accordance with the invention, residues are defined which are deleterious to binding to allele-specific HLA molecules or members of HLA supertypes that bind the respective motif or supermotif (Tables II and III). Accordingly, removal of such residues that are detrimental to binding can be performed in accordance with the present invention. For example, in the case of the A3 supertype, when all peptides that have such deleterious residues are removed from the population of peptides used in the analysis, the incidence of cross-reactivity increased from 22% to 37% (see, e.g., Sidney, J. et al., Hu. Immunol. 45:79, 1996). Thus, one strategy to improve the cross-reactivity of peptides within a given supermotif is simply to delete one or more of the deleterious residues present within a peptide and substitute a small "neutral" residue such as Ala (that may not influence T cell recognition of the peptide). An enhanced likelihood of cross-reactivity is expected if, together with elimination of detrimental residues within a peptide, "preferred" residues associated with high affinity binding to an allele-specific HLA molecule or to multiple HLA molecules within a superfamily are inserted.
[0140]To ensure that an analog peptide, when used as a vaccine, actually elicits a CTL response to the native epitope in vivo (or, in the case of class II epitopes, elicits helper T cells that cross-react with the wild type peptides), the analog peptide may be used to immunize T cells in vitro from individuals of the appropriate HLA allele. Thereafter, the immunized cells' capacity to induce lysis of wild type peptide sensitized target cells is evaluated. It will be desirable to use as antigen presenting cells, cells that have been either infected, or transfected with the appropriate genes, or, in the case of class II epitopes only, cells that have been pulsed with whole protein antigens, to establish whether endogenously produced antigen is also recognized by the relevant T cells.
[0141]Another embodiment of the invention is to create analogs of weak binding peptides, to thereby ensure adequate numbers of cross-reactive cellular binders. Class I binding peptides exhibiting binding affinities of 500-5000 nM, and carrying an acceptable but suboptimal primary anchor residue at one or both positions can be "fixed" by substituting preferred anchor residues in accordance with the respective supertype. The analog peptides can then be tested for crossbinding activity.
[0142]Another embodiment for generating effective peptide analogs involves the substitution of residues that have an adverse impact on peptide stability or solubility in, e.g., a liquid environment. This substitution may occur at any position of the peptide epitope. For example, a cysteine (C) can be substituted out in favor of α-amino butyric acid. Due to its chemical nature, cysteine has the propensity to form disulfide bridges and sufficiently alter the peptide structurally so as to reduce binding capacity. Substituting α-amino butyric acid for C not only alleviates this problem, but actually improves binding and crossbinding capability in certain instances (see, e.g., the review by Sette et al., In: Persistent Viral Infections, Eds. R. Ahmed and I. Chen, John Wiley & Sons, England, 1999). Substitution of cysteine with α-amino butyric acid may occur at any residue of a peptide epitope, i.e. at either anchor or non-anchor positions.
Computer Screening of Protein Sequences from Disease-Related Antigens for Supermotif- or Motif-Bearing Peptides
[0143]In order to identify supermotif- or motif-bearing epitopes in a target antigen, a native protein sequence, e.g., a tumor-associated antigen, or sequences from an infectious organism, or a donor tissue for transplantation, is screened using a means for computing, such as an intellectual calculation or a computer, to determine the presence of a supermotif or motif within the sequence. The information obtained from the analysis of native peptide can be used directly to evaluate the status of the native peptide or may be utilized subsequently to generate the peptide epitope.
[0144]Computer programs that allow the rapid screening of protein sequences for the occurrence of the subject supermotifs or motifs are encompassed by the present invention; as are programs that permit the generation of analog peptides. These programs are implemented to analyze any identified amino acid sequence or operate on an unknown sequence and simultaneously determine the sequence and identify motif-bearing epitopes thereof; analogs can be simultaneously determined as well. Generally, the identified sequences will be from a pathogenic organism or a tumor-associated peptide. For example, the target molecules considered herein include, without limitation, the E1, E2, E4, E5a, E5b, E6, E7, L1 and L2 proteins of HPV.
[0145]In cases where the sequences of multiple variants of the same target protein are available, potential peptide epitopes can also be selected on the basis of their conservancy. For example, a criterion for conservancy may define that the entire sequence of an HLA class I binding peptide or the entire 9-mer core of a class II binding peptide, be conserved in a designated percentage, of the sequences evaluated for a specific protein antigen.
[0146]To target a broad population that may be infected with a number of different strains, it is preferable to include in vaccine compositions epitopes that are representative of HPV antigen sequences from different HPV strains. As appreciated by those in the art, regions with greater or lessor degrees of conservancy among HPv strains can be employed as appropriate for a given antigenic target.
[0147]It is important that the selection criteria utilized for prediction of peptide binding are as accurate as possible, to correlate most efficiently with actual binding. Prediction of peptides that bind, for example, to HLA-A*0201, on the basis of the presence of the appropriate primary anchors, is positive at about a 30% rate (see, e.g., Ruppert, J. et al. Cell 74:929, 1993). However, by extensively analyzing peptide-HLA binding data disclosed herein, data in related patent applications, and data in the art, the present inventors have developed a number of allele-specific polynomial algorithms that dramatically increase the predictive value over identification on the basis of the presence of primary anchor residues alone. These algorithms take into account not only the presence or absence of primary anchors, but also consider the positive or deleterious presence of secondary anchor residues (to account for the impact of different amino acids at different positions). The algorithms are essentially based on the premise that the overall affinity (or ΔG) of peptide-HLA interactions can be approximated as a linear polynomial function of the type:
ΔG=a1i×a2i×a3i . . . ×ani
[0148]where aji is a coefficient that represents the effect of the presence of a given amino acid (j) at a given position (i) along the sequence of a peptide of n amino acids. An important assumption of this method is that the effects at each position are essentially independent of each other. This assumption is justified by studies that demonstrated that peptides are bound to HLA molecules and recognized by T cells in essentially an extended conformation. Derivation of specific algorithm coefficients has been described, for example, in Gulukota, K. et al., J. Mol. Biol. 267:1258, 1997.
[0149]Additional methods to identify preferred peptide sequences, which also make use of specific motifs, include the use of neural networks and molecular modeling programs (see, e.g., Milik et al., Nature Biotechnology 16:753, 1998; Altuvia et al., Hum. Immunol. 58:1, 1997; Altuvia et al, J. Mol. Biol. 249:244, 1995; Buus, S. Curr. Opin. Immunol. 11:209-213, 1999; Brusic, V. et al., Bioinformatics 14:121-130, 1998; Parker et al., J. Immunol. 152:163, 1993; Meister et al., Vaccine 13:581, 1995; Hammer et al., J. Exp. Med. 180:2353, 1994; Sturniolo et al., Nature Biotechnol. 17:555 1999).
[0150]For example, it has been shown that in sets of A*0201 motif-bearing peptides containing at least one preferred secondary anchor residue while avoiding the presence of any deleterious secondary anchor residues, 69% of the peptides will bind A*0201 with an IC50 less than 500 nM (Ruppert, J. et al. Cell 74:929, 1993). These algorithms are also flexible in that cut-off scores may be adjusted to select sets of peptides with greater or lower predicted binding properties, as desired.
[0151]In utilizing computer screening to identify peptide epitopes, a protein sequence or translated sequence may be analyzed using software developed to search for motifs, for example the "FINDPATTERNS` program (Devereux, et al. Nucl. Acids Res. 12:387-395, 1984) or MotifSearch 1.4 software program (D. Brown, San Diego, Calif.) to identify potential peptide sequences containing appropriate HLA binding motifs. The identified peptides can be scored using customized polynomial algorithms to predict their capacity to bind specific HLA class I or class II alleles. As appreciated by one of ordinary skill in the art, a large array of computer programming software and hardware options are available in the relevant art which can be employed to implement the motifs of the invention in order to evaluate (e.g., without limitation, to identify epitopes, identify epitope concentration per peptide length, or to generate analogs) known or unknown peptide sequences.
[0152]In accordance with the procedures described above, HPV peptide epitopes that are able to bind HLA supertype groups or allele-specific HLA molecules have been identified (Tables VII-XX).
Preparation of Peptide Epitopes
[0153]Peptides in accordance with the invention can be prepared synthetically, by recombinant DNA technology or chemical synthesis, or from natural sources such as native tumors or pathogenic organisms. Peptide epitopes may be synthesized individually or as polyepitopic peptides. Although the peptide will preferably be substantially free of other naturally occurring host cell proteins and fragments thereof, in some embodiments the peptides may be synthetically conjugated to native fragments or particles.
[0154]The peptides in accordance with the invention can be a variety of lengths, and either in their neutral (uncharged) forms or in forms which are salts. The peptides in accordance with the invention are either free of modifications such as glycosylation, side chain oxidation, or phosphorylation; or they contain these modifications, subject to the condition that modifications do not destroy the biological activity of the peptides as described herein.
[0155]When possible, it may be desirable to optimize HLA class I binding epitopes of the invention, such as can be used in a polyepitopic construct, to a length of about 8 to about 13 amino acid residues, often 8 to 11, preferably 9 to 10. HLA class II binding peptide epitopes of the invention may be optimized to a length of about 6 to about 30 amino acids in length, preferably to between about 13 and about 20 residues. Preferably, the peptide epitopes are commensurate in size with endogenously processed pathogen-derived peptides or tumor cell peptides that are bound to the relevant HLA molecules, however, the identification and preparation of peptides that comprise epitopes of the invention can also be carried out using the techniques described herein.
[0156]In alternative embodiments, epitopes of the invention can be linked as a polyepitopic peptide, or as a minigene that encodes a polyepitopic peptide.
[0157]In another embodiment, it is preferred to identify native peptide regions that contain a high concentration of class I and/or class II epitopes. Such a sequence is generally selected on the basis that it contains the greatest number of epitopes per amino acid length. It is to be appreciated that epitopes can be present in a nested or overlapping manner, e.g. a 10 amino acid long peptide could contain two 9 amino acid long epitopes and one 10 amino acid long epitope; upon intracellular processing, each epitope can be exposed and bound by an HLA molecule upon administration of such a peptide. This larger, preferably multi-epitopic, peptide can be generated synthetically, recombinantly, or via cleavage from the native source.
[0158]The peptides of the invention can be prepared in a wide variety of ways. For the preferred relatively short size, the peptides can be synthesized in solution or on a solid support in accordance with conventional techniques. Various automatic synthesizers are commercially available and can be used in accordance with known protocols. (See, for example, Stewart & Young, SOLID PHASE PEPTIDE SYNTHESIS, 2D. ED., Pierce Chemical Co., 1984). Further, individual peptide epitopes can be joined using chemical ligation to produce larger peptides that are still within the bounds of the invention.
[0159]Alternatively, recombinant DNA technology can be employed wherein a nucleotide sequence which encodes an immunogenic peptide of interest is inserted into an expression vector, transformed or transfected into an appropriate host cell and cultivated under conditions suitable for expression. These procedures are generally known in the art, as described generally in Sambrook et al., MOLECULAR CLONING, A LABORATORY MANUAL, Cold Spring Harbor Press, Cold Spring Harbor, N.Y. (1989). Thus, recombinant polypeptides which comprise one or more peptide sequences of the invention can be used to present the appropriate T cell epitope.
[0160]The nucleotide coding sequence for peptide epitopes of the preferred lengths contemplated herein can be synthesized by chemical techniques, for example, the phosphotriester method of Matteucci, et al., J. Am. Chem. Soc. 103:3185 (1981). Peptide analogs can be made simply by substituting the appropriate and desired nucleic acid base(s) for those that encode the native peptide sequence; exemplary nucleic acid substitutions are those that encode an amino acid defined by the motifs/supermotifs herein. The coding sequence can then be provided with appropriate linkers and ligated into expression vectors commonly available in the art, and the vectors used to transform suitable hosts to produce the desired fusion protein. A number of such vectors and suitable host systems are now available. For expression of the fusion proteins, the coding sequence will be provided with operably linked start and stop codons, promoter and terminator regions and usually a replication system to provide an expression vector for expression in the desired cellular host. For example, promoter sequences compatible with bacterial hosts are provided in plasmids containing convenient restriction sites for insertion of the desired coding sequence. The resulting expression vectors are transformed into suitable bacterial hosts. Of course, yeast, insect or mammalian cell hosts may also be used, employing suitable vectors and control sequences.
Assays to Detect T-Cell Responses
[0161]Once HLA binding peptides are identified, they can be tested for the ability to elicit a T-cell response. The preparation and evaluation of motif-bearing peptides are described in PCT publications WO 94/20127 and WO 94/03205. Briefly, peptides comprising epitopes from a particular antigen are synthesized and tested for their ability to bind to the appropriate HLA proteins. These assays may involve evaluating the binding of a peptide of the invention to purified HLA class I molecules in relation to the binding of a radioiodinated reference peptide. Alternatively, cells expressing empty class I molecules (i.e. lacking peptide therein) may be evaluated for peptide binding by immunofluorescent staining and flow microfluorimetry. Other assays that may be used to evaluate peptide binding include peptide-dependent class I assembly assays and/or the inhibition of CTL recognition by peptide competition. Those peptides that bind to the class I molecule, typically with an affinity of 500 nM or less, are further evaluated for their ability to serve as targets for CTLs derived from infected or immunized individuals, as well as for their capacity to induce primary in vitro or in vivo CTL responses that can give rise to CTL populations capable of reacting with selected target cells associated with a disease.
[0162]Analogous assays are used for evaluation of HLA class II binding peptides. HLA class II motif-bearing peptides that are shown to bind, typically at an affinity of 1000 nM or less, are further evaluated for the ability to stimulate HTL responses.
[0163]Conventional assays utilized to detect T cell responses include proliferation assays, lymphokine secretion assays, direct cytotoxicity assays, and limiting dilution assays. For example, antigen-presenting cells that have been incubated with a peptide can be assayed for the ability to induce CTL responses in responder cell populations. Antigen-presenting cells can be normal cells such as peripheral blood mononuclear cells or dendritic cells. Alternatively, mutant non-human mammalian cell lines that are deficient in their ability to load class 1 molecules with internally processed peptides and that have been transfected with the appropriate human class I gene, may be used to test for the capacity of the peptide to induce in vitro primary CTL responses.
[0164]Peripheral blood mononuclear cells (PBMCs) may be used as the responder cell source of CTL precursors. The appropriate antigen-presenting cells are incubated with peptide, after which the peptide-loaded antigen-presenting cells are then incubated with the responder cell population under optimized culture conditions. Positive CTL activation can be determined by assaying the culture for the presence of CTLs that kill radio-labeled target cells, both specific peptide-pulsed targets as well as target cells expressing endogenously processed forms of the antigen from which the peptide sequence was derived.
[0165]Additionally, a method has been devised which allows direct quantification of antigen-specific T cells by staining with Fluorescein-labelled HLA tetrameric complexes (Altman, J. D. et al., Proc. Natl. Acad. Sci. USA 90:10330, 1993; Altman, J. D. et al., Science 274:94, 1996). Other relatively recent technical developments include staining for intracellular lymphokines, and interferon release assays or ELISPOT assays. Tetramer staining, intracellular lymphokine staining and ELISPOT assays all appear to be at least 10-fold more sensitive than more conventional assays (Lalvani, A. et al., J. Exp. Med. 186:859, 1997; Dunbar, P. R. et al., Curr. Biol. 8:413, 1998; Murali-Krishna, K. et al., Immunity 8:177, 1998).
[0166]HTL activation may also be assessed using such techniques known to those in the art such as T cell proliferation and secretion of lymphokines, e.g. IL-2 (see, e.g. Alexander et al., Immunity 1:751-761, 1994).
[0167]Alternatively, immunization of HLA transgenic mice can be used to determine immunogenicity of peptide epitopes. Several transgenic mouse models including mice with human A2.1, A11 (which can additionally be used to analyze HLA-A3 epitopes), and B7 alleles have been characterized and others (e.g., transgenic mice for HLA-A1 and A24) are being developed. HLA-DR1 and HLA-DR3 mouse models have also been developed. Additional transgenic mouse models with other HLA alleles may be generated as necessary. Mice may be immunized with peptides emulsified in Incomplete Freund's Adjuvant and the resulting T cells tested for their capacity to recognize peptide-pulsed target cells and target cells transfected with appropriate genes. CTL responses may be analyzed using cytotoxicity assays described above. Similarly, HTL responses may be analyzed using such assays as T cell proliferation or secretion of lymphokines.
Use of Peptide Epitopes as Diagnostic Agents and for Evaluating Immune Responses
[0168]In one aspect of the invention, HLA class I and class II binding peptides as described herein can be used as reagents to evaluate an immune response. The immune response to be evaluated is induced by using as an immunogen any agent that may result in the production of antigen-specific CTLs or HTLs that recognize and bind to the peptide epitope(s) to be employed as the reagent. The peptide reagent need not be used as the immunogen. Assay systems that are used for such an analysis include relatively recent technical developments such as tetramers, staining for intracellular lymphokines and interferon release assays, or ELISPOT assays.
[0169]For example, a peptide of the invention is used in a tetramer staining assay to assess peripheral blood mononuclear cells for the presence of antigen-specific CTLs following exposure to a pathogen or immunogen. The HLA-tetrameric complex is used to directly visualize antigen-specific CTLs (see, e.g., Ogg et al., Science 279:2103-2106, 1998; and Altman et al., Science 174:94-96, 1996) and determine the frequency of the antigen-specific CTL population in a sample of peripheral blood mononuclear cells.
[0170]A tetramer reagent using a peptide of the invention is generated as follows: A peptide that binds to an HLA molecule is refolded in the presence of the corresponding HLA heavy chain and β2-microglobulin to generate a trimolecular complex. The complex is biotinylated at the carboxyl terminal end of the heavy chain at a site that was previously engineered into the protein. Tetramer formation is then induced by the addition of streptavidin. By means of fluorescently labeled streptavidin, the tetramer can be used to stain antigen-specific cells. The cells can then be readily identified, for example, by flow cytometry. Such procedures are used for diagnostic or prognostic purposes. Cells identified by the procedure can also be used for therapeutic purposes.
[0171]Peptides of the invention are also used as reagents to evaluate immune recall responses. (see, e.g., Bertoni et al., J. Clin. Invest. 100:503-513, 1997 and Penna et al., J. Exp. Med. 174:1565-1570, 1991.) For example, patient PBMC samples from individuals infected with HPV are analyzed for the presence of antigen-specific CTLs or HTLs using specific peptides. A blood sample containing mononuclear cells may be evaluated by cultivating the PBMCs and stimulating the cells with a peptide of the invention. After an appropriate cultivation period, the expanded cell population may be analyzed, for example, for CTL or for HTL activity.
[0172]The peptides are also used as reagents to evaluate the efficacy of a vaccine. PBMCs obtained from a patient vaccinated with an immunogen are analyzed using, for example, either of the methods described above. The patient is HLA typed, and peptide epitope reagents that recognize the allele-specific molecules present in that patient are selected for the analysis. The immunogenicity of the vaccine is indicated by the presence of HPV epitope-specific CTLs and/or HTLs in the PBMC sample.
[0173]The peptides of the invention are also be used to make antibodies, using techniques well known in the art (see, e.g. CURRENT PROTOCOLS IN IMMUNOLOGY, Wiley/Greene, N.Y.; and Antibodies A Laboratory Manual Harlow, Harlow and Lane, Cold Spring Harbor Laboratory Press, 1989), which may be useful as reagents to diagnose HPV infection. Such antibodies include those that recognize a peptide in the context of an HLA molecule, i.e., antibodies that bind to a peptide-MHC complex.
Vaccine Compositions
[0174]Vaccines and methods of preparing vaccines that contain an immunogenically effective amount of one or more peptides as described herein are further embodiments of the invention. Once appropriately immunogenic epitopes have been defined, they can be sorted and delivered by various means, herein referred to as "vaccine" compositions. Such vaccine compositions can include, for example, lipopeptides (e.g., Vitiello, A. et al., J. Clin. Invest. 95:341, 1995), peptide compositions encapsulated in poly(DL-lactide-co-glycolide) ("PLG") microspheres (see, e.g., Eldridge, et al., Molec. Immunol. 28:287-294, 1991: Alonso et al., Vaccine 12:299-306, 1994; Jones et al., Vaccine 13:675-681, 1995), peptide compositions contained in immune stimulating complexes (ISCOMS) (see, e.g., Takahashi et al., Nature 344:873-875, 1990; Hu et al., Clin Exp Immunol. 113:235-243, 1998), multiple antigen peptide systems (MAPs) (see e.g., Tam, J. P., Proc. Natl. Acad. Sci. U.S.A. 85:5409-5413, 1988; Tam, J. P., J. Immunol. Methods 196:17-32, 1996), peptides formulated as multivalent peptides; peptides for use in ballistic delivery systems, typically crystallized peptides, viral delivery vectors (Perkus, M. E. et al., In: Concepts in vaccine development, Kaufmann, S. H. E., ed., p. 379, 1996; Chakrabarti, S. et al., Nature 320:535, 1986; Hu, S. L. et al., Nature 320:537, 1986; Kieny, M.-P. et al., AIDS Bio/Technology 4:790, 1986; Top, F. H. et al., J. Infect. Dis. 124:148, 1971; Chanda, P. K. et al., Virology 175:535, 1990), particles of viral or synthetic origin (e.g., Kofler, N. et al., J. Immunol. Methods. 192:25, 1996; Eldridge, J. H. et al., Sem. Hematol. 30:16, 1993; Falo, L. D., Jr. et al., Nature Med. 7:649, 1995), adjuvants (Warren, H. S., Vogel, F. R., and Chedid, L. A. Annu. Rev. Immunol. 4:369, 1986; Gupta, R. K. et al., Vaccine 11:293, 1993), liposomes (Reddy, R. et al., J. Immunol. 148:1585, 1992; Rock, K. L., Immunol. Today 17:131, 1996), or, naked or particle absorbed cDNA (Ulmer, J. B. et al., Science 259:1745, 1993; Robinson, H. L., Hunt, L. A., and Webster, R. G., Vaccine 11:957, 1993; Shiver, J. W. et al., In: Concepts in vaccine development, Kaufmann, S. H. E., ed., p. 423, 1996; Cease, K. B., and Berzofsky, J. A., Annu. Rev. Immunol. 12:923, 1994 and Eldridge, J. H. et al., Sem. Hematol. 30:16, 1993). Toxin-targeted delivery technologies, also known as receptor mediated targeting, such as those of Avant Immunotherapeutics, Inc. (Needham, Mass.) may also be used.
[0175]Vaccine compositions of the invention include nucleic acid-mediated modalities. DNA or RNA encoding one or more of the peptides of the invention can also be administered to a patient. This approach is described, for instance, in Wolff et. al., Science 247:1465 (1990) as well as U.S. Pat. Nos. 5,580,859; 5,589,466; 5,804,566; 5,739,118; 5,736,524; 5,679,647; WO 98/04720; and in more detail below. Examples of DNA-based delivery technologies include "naked DNA", facilitated (bupivicaine, polymers, peptide-mediated) delivery, cationic lipid complexes, and particle-mediated ("gene gun") or pressure-mediated delivery (see, e.g., U.S. Pat. No. 5,922,687).
[0176]For therapeutic or prophylactic immunization purposes, the peptides of the invention can be expressed by viral or bacterial vectors. Examples of expression vectors include attenuated viral hosts, such as vaccinia or fowlpox. This approach involves the use of vaccinia virus, for example, as a vector to express nucleotide sequences that encode the peptides of the invention. Upon introduction into an acutely or chronically infected host or into a non-infected host, the recombinant vaccinia virus expresses the immunogenic peptide, and thereby elicits a host CTL and/or HTL response. Vaccinia vectors and methods useful in immunization protocols are described in, e.g., U.S. Pat. No. 4,722,848. Another vector is BCG (Bacille Calmette Guerin). BCG vectors are described in Stover et al., Nature 351:456-460 (1991). A wide variety of other vectors useful for therapeutic administration or immunization of the peptides of the invention, e.g. adeno and adeno-associated virus vectors, retroviral vectors, Salmonella typhi vectors, detoxified anthrax toxin vectors, and the like, will be apparent to those skilled in the art from the description herein.
[0177]Furthermore, vaccines in accordance with the invention encompass compositions of one or more of the claimed peptides. A peptide can be present in a vaccine individually. Alternatively, the peptide can exist as a homopolymer comprising multiple copies of the same peptide, or as a heteropolymer of various peptides. Polymers have the advantage of increased immunological reaction and, where different peptide epitopes are used to make up the polymer, the additional ability to induce antibodies and/or CTLs that react with different antigenic determinants of the pathogenic organism or tumor-related peptide targeted for an immune response. The composition can be a naturally occurring region of an antigen or can be prepared, e.g., recombinantly or by chemical synthesis.
[0178]Carriers that can be used with vaccines of the invention are well known in the art, and include, e.g., thyroglobulin, albumins such as human serum albumin, tetanus toxoid, polyamino acids such as poly L-lysine, poly L-glutamic acid, influenza, hepatitis B virus core protein, and the like. The vaccines can contain a physiologically tolerable (i.e., acceptable) diluent such as water, or saline, preferably phosphate buffered saline. The vaccines also typically include an adjuvant. Adjuvants such as incomplete Freund's adjuvant, aluminum phosphate, aluminum hydroxide, or alum are examples of materials well known in the art. Additionally, as disclosed herein, CTL responses can be primed by conjugating peptides of the invention to lipids, such as tripalmitoyl-S-glycerylcysteinlyseryl-serine (P3CSS).
[0179]Upon immunization with a peptide composition in accordance with the invention, via injection, aerosol, oral, transdermal, transmucosal, intrapleural, intrathecal, or other suitable routes, the immune system of the host responds to the vaccine by producing large amounts of CTLs and/or HTLs specific for the desired antigen. Consequently, the host becomes at least partially immune to later infection, or at least partially resistant to developing an ongoing chronic infection, or derives at least some therapeutic benefit when the antigen was tumor-associated.
[0180]In some embodiments, it may be desirable to combine the class I peptide components with components that induce or facilitate neutralizing antibody and or helper T cell responses to the target antigen of interest. A preferred embodiment of such a composition comprises class I and class II epitopes in accordance with the invention. An alternative embodiment of such a composition comprises a class I and/or class II epitope in accordance with the invention, along with a cross reactive HTL epitope such as PADRE® (Epimmune, San Diego, Calif.) molecule (described e.g., in U.S. Pat. No. 5,736,142).
[0181]A vaccine of the invention can also include antigen-presenting cells (APC), such as dendritic cells (DC), as a vehicle to present peptides of the invention. Vaccine compositions can be created in vitro, following dendritic cell mobilization and harvesting, whereby loading of dendritic cells occurs in vitro. For example, dendritic cells are transfected, e.g., with a minigene in accordance with the invention, or are pulsed with peptides. The dendritic cell can then be administered to a patient to elicit immune responses in vivo.
[0182]Vaccine compositions, either DNA- or peptide-based, can also be administered in vivo in combination with dendritic cell mobilization whereby loading of dendritic cells occurs in vivo.
[0183]Antigenic peptides are used to elicit a CTL and/or HTL response ex vivo, as well. The resulting CTL or HTL cells, can be used to treat chronic infections, or tumors in patients that do not respond to other conventional forms of therapy, or will not respond to a therapeutic vaccine peptide or nucleic acid in accordance with the invention. Ex vivo CTL or HTL responses to a particular antigen (infectious or tumor-associated antigen) are induced by incubating in tissue culture the patient's, or genetically compatible, CTL or HTL precursor cells together with a source of antigen-presenting cells (APC), such as dendritic cells, and the appropriate immunogenic peptide. After an appropriate incubation time (typically about 7-28 days), in which the precursor cells are activated and expanded into effector cells, the cells are infused back into the patient, where they will destroy (CTL) or facilitate destruction (HTL) of their specific target cell (an infected cell or a tumor cell). Transfected dendritic cells may also be used as antigen presenting cells.
[0184]The vaccine compositions of the invention may also be used in combination with other procedures to remove warts or treat HPV infections. Such procedures include cryosurgery, application of caustic agents, electrodessication, surgical excision and laser ablation (Fauci et al. HARRISON'S PRINCIPLES OF INTERNAL MEDICINE, 14th ED., McGraw-Hill Co., Inc, 1998), as well as treatment with antiviral drugs such as interferon-α (see, e.g., Stellato, G., et al., Clin. Diagn. Virol. 7(3):167-72 (1997)) or interferon-inducing drugs such as imiquimod. Topical antimetabolites such a 5-fluorouracil may also be applied.
[0185]In patients with HPV-associated cancer, the vaccine compositions of the invention can also be used in conjunction with other treatments used for cancer, e.g., surgery, chemotherapy, drug therapies, radiation therapies, etc. including use in combination with immune adjuvants such as IL-2, IL-12, GM-CSF, and the like.
[0186]Preferably, the following principles are utilized when selecting an array of epitopes for inclusion in a polyepitopic composition for use in a vaccine, or for selecting discrete epitopes to be included in a vaccine and/or to be encoded by nucleic acids such as a minigene. It is preferred that each of the following principles are balanced in order to make the selection. The multiple epitopes to be incorporated in a given vaccine composition may be, but need not be, contiguous in sequence in the native antigen from which the epitopes are derived.
[0187]1.) Epitopes are selected which, upon administration, mimic immune responses that have been observed to be correlated with clearance of HPV infection or tumor clearance. For HLA Class I this includes 3-4 epitopes that come from at least one TAA. For HLA Class II a similar rationale is employed; again 3-4 epitopes are selected from at least one TAA (see, e.g., Rosenberg et al., Science 278:1447-1450). Epitopes from one TAA may be used in combination with epitopes from one or more additional TAAs to produce a vaccine that targets tumors with varying expression patterns of frequently-expressed TAAs as described, e.g., in Example 15.
[0188]2.) Epitopes are selected that have the requisite binding affinity established to be correlated with immunogenicity: for HLA Class I an IC50 of 500 nM or less, often 200 nM or less; and for Class II an IC50 of 1000 nM or less.
[0189]3.) Sufficient supermotif bearing-peptides, or a sufficient array of allele-specific motif-bearing peptides, are selected to give broad population coverage. For example, it is preferable to have at least 80% population coverage. A Monte Carlo analysis, a statistical evaluation known in the art, can be employed to assess the breadth, or redundancy of, population coverage.
[0190]4.) When selecting epitopes from cancer-related antigens it is often useful to select analogs because the patient may have developed tolerance to the native epitope. When selecting epitopes for infectious disease-related antigens it is preferable to select either native or analoged epitopes.
[0191]5.) Of particular relevance are epitopes referred to as "nested epitopes." Nested epitopes occur where at least two epitopes overlap in a given peptide sequence. A nested peptide sequence can comprise both HLA class I and HLA class II epitopes. When providing nested epitopes, a general objective is to provide the greatest number of epitopes per sequence. Thus, an aspect is to avoid providing a peptide that is any longer than the amino terminus of the amino terminal epitope and the carboxyl terminus of the carboxyl terminal epitope in the peptide. When providing a multi-epitopic sequence, such as a sequence comprising nested epitopes, it is generally important to screen the sequence in order to insure that it does not have pathological or other deleterious biological properties.
[0192]6.) If a polyepitopic protein is created, or when creating a minigene, an objective is to generate the smallest peptide that encompasses the epitopes of interest. This principle is similar, if not the same as that employed when selecting a peptide comprising nested epitopes. However, with an artificial polyepitopic peptide, the size minimization objective is balanced against the need to integrate any spacer sequences between epitopes in the polyepitopic protein. Spacer amino acid residues can, for example, be introduced to avoid junctional epitopes (an epitope recognized by the immune system, not present in the target antigen, and only created by the man-made juxtaposition of epitopes), or to facilitate cleavage between epitopes and thereby enhance epitope presentation. Junctional epitopes are generally to be avoided because the recipient may generate an immune response to that non-native epitope. Of particular concern is a junctional epitope that is a "dominant epitope." A dominant epitope may lead to such a zealous response that immune responses to other epitopes are diminished or suppressed.
[0193]7.) In cases where the sequences of multiple variants of the same target protein are available, potential peptide epitopes can also be selected on the basis of their conservancy. For example, a criterion for conservancy may define that the entire sequence of an HLA class I binding peptide or the entire 9-mer core of a class II binding peptide be conserved in a designated percentage of the sequences evaluated for a specific protein antigen.
[0194]8.) When selecting an array of epitopes of an infectious agent, it is preferred that at least some of the epitopes are derived from early and late proteins. The early proteins of HPV are expressed when the virus is replicating, either following acute or dormant infection. Therefore, it is particularly preferred to use epitopes from early stage proteins to alleviate disease manifestations at the earliest stage possible.
Minigene Vaccines
[0195]A number of different approaches are available which allow simultaneous delivery of multiple epitopes. Nucleic acids encoding the peptides of the invention are a particularly useful embodiment of the invention. Epitopes for inclusion in a minigene are preferably selected according to the guidelines set forth in the previous section. A preferred means of administering nucleic acids encoding the peptides of the invention uses minigene constructs encoding a peptide comprising one or multiple epitopes of the invention.
[0196]The use of multi-epitope minigenes is described below and in, e.g., co-pending application U.S. Ser. No. 09/311,784; Ishioka et al., J. Immunol. 162:3915-3925, 1999; An, L. and Whitton, J. L., J. Virol. 71:2292, 1997; Thomson, S. A. et al., J. Immunol. 157:822, 1996; Whitton, J. L. et al., J. Virol. 67:348, 1993; Hanke, R. et al., Vaccine 16:426, 1998. For example, a multi-epitope DNA plasmid encoding supermotif- and/or motif-bearing epitopes derived from multiple regions of one or more HPV antigens, the PADREquadrature universal helper T cell epitope (or multiple HTL epitopes from HPV antigens), and an endoplasmic reticulum-translocating signal sequence can be engineered. A vaccine may also comprise epitopes that are derived from other TAAs.
[0197]The immunogenicity of a multi-epitopic minigene can be tested in transgenic mice to evaluate the magnitude of CTL induction responses against the epitopes tested. Further, the immunogenicity of DNA-encoded epitopes in vivo can be correlated with the in vitro responses of specific CTL lines against target cells transfected with the DNA plasmid. Thus, these experiments can show that the minigene serves to both: 1.) generate a CTL response and 2.) that the induced CTLs recognized cells expressing the encoded epitopes.
[0198]For example, to create a DNA sequence encoding the selected epitopes (minigene) for expression in human cells, the amino acid sequences of the epitopes may be reverse translated. A human codon usage table can be used to guide the codon choice for each amino acid. These epitope-encoding DNA sequences may be directly adjoined, so that when translated, a continuous polypeptide sequence is created. To optimize expression and/or immunogenicity, additional elements can be incorporated into the minigene design. Examples of amino acid sequences that can be reverse translated and included in the minigene sequence include: HLA class I epitopes, HLA class II epitopes, a ubiquitination signal sequence, and/or an endoplasmic reticulum targeting signal. In addition, HLA presentation of CTL and HTL epitopes may be improved by including synthetic (e.g. poly-alanine) or naturally-occurring flanking sequences adjacent to the CTL or HTL epitopes; these larger peptides comprising the epitope(s) are within the scope of the invention.
[0199]The minigene sequence may be converted to DNA by assembling oligonucleotides that encode the plus and minus strands of the minigene. Overlapping oligonucleotides (30-100 bases long) may be synthesized, phosphorylated, purified and annealed under appropriate conditions using well known techniques. The ends of the oligonucleotides can be joined, for example, using T4 DNA ligase. This synthetic minigene, encoding the epitope polypeptide, can then be cloned into a desired expression vector.
[0200]Standard regulatory sequences well known to those of skill in the art are preferably included in the vector to ensure expression in the target cells. Several vector elements are desirable: a promoter with a down-stream cloning site for minigene insertion; a polyadenylation signal for efficient transcription termination; an E. coli origin of replication; and an E. coli selectable marker (e.g. ampicillin or kanamycin resistance). Numerous promoters can be used for this purpose, e.g., the human cytomegalovirus (hCMV) promoter. See, e.g., U.S. Pat. Nos. 5,580,859 and 5,589,466 for other suitable promoter sequences.
[0201]Additional vector modifications may be desired to optimize minigene expression and immunogenicity. In some cases, introns are required for efficient gene expression, and one or more synthetic or naturally-occurring introns could be incorporated into the transcribed region of the minigene. The inclusion of mRNA stabilization sequences and sequences for replication in mammalian cells may also be considered for increasing minigene expression.
[0202]Once an expression vector is selected, the minigene is cloned into the polylinker region downstream of the promoter. This plasmid is transformed into an appropriate E. coli strain, and DNA is prepared using standard techniques. The orientation and DNA sequence of the minigene, as well as all other elements included in the vector, are confirmed using restriction mapping and DNA sequence analysis. Bacterial cells harboring the correct plasmid can be stored as a master cell bank and a working cell bank.
[0203]In addition, immunostimulatory sequences (ISSs or CpGs) appear to play a role in the immunogenicity of DNA vaccines. These sequences may be included in the vector, outside the minigene coding sequence, if desired to enhance immunogenicity.
[0204]In some embodiments, a bi-cistronic expression vector which allows production of both the minigene-encoded epitopes and a second protein (included to enhance or decrease immunogenicity) can be used. Examples of proteins or polypeptides that could beneficially enhance the immune response if co-expressed include cytokines (e.g., IL-2, IL-12, GM-CSF), cytokine-inducing molecules (e.g., LeIF), costimulatory molecules, or for HTL responses, pan-DR binding proteins (PADRE®, Epimmune, San Diego, Calif.). Helper (HTL) epitopes can be joined to intracellular targeting signals and expressed separately from expressed CTL epitopes; this allows direction of the HTL epitopes to a cell compartment different than that of the CTL epitopes. If required, this could facilitate more efficient entry of HTL epitopes into the HLA class II pathway, thereby improving HTL induction. In contrast to HTL or CTL induction, specifically decreasing the immune response by co-expression of immunosuppressive molecules (e.g. TGF-β) may be beneficial in certain diseases.
[0205]Therapeutic quantities of plasmid DNA can be produced for example, by fermentation in E. coli, followed by purification. Aliquots from the working cell bank are used to inoculate growth medium, and grown to saturation in shaker flasks or a bioreactor according to well known techniques. Plasmid DNA can be purified using standard bioseparation technologies such as solid phase anion-exchange resins supplied by QIAGEN, Inc. (Valencia, Calif.). If required, supercoiled DNA can be isolated from the open circular and linear forms using gel electrophoresis or other methods.
[0206]Purified plasmid DNA can be prepared for injection using a variety of formulations. The simplest of these is reconstitution of lyophilized DNA in sterile phosphate-buffer saline (PBS). This approach, known as "naked DNA," is currently being used for intramuscular (IM) administration in clinical trials. To maximize the immunotherapeutic effects of minigene DNA vaccines, an alternative method for formulating purified plasmid DNA may be desirable. A variety of methods have been described, and new techniques may become available. Cationic lipids, glycolipids, and fusogenic liposomes can also be used in the formulation (see, e.g., as described by WO 93/24640; Mannino & Gould-Fogerite, BioTechniques 6(7): 682 (1988); U.S. Pat. No. 5,279,833; WO 91/06309; and Felgner, et al, Proc. Nat'l Acad. Sci. USA 84:7413 (1987). In addition, peptides and compounds referred to collectively as protective, interactive, non-condensing compounds (PINC) could also be complexed to purified plasmid DNA to influence variables such as stability, intramuscular dispersion, or trafficking to specific organs or cell types.
[0207]Target cell sensitization can be used as a functional assay for expression and HLA class I presentation of minigene-encoded CTL epitopes. For example, the plasmid DNA is introduced into a mammalian cell line that is suitable as a target for standard CTL chromium release assays. The transfection method used will be dependent on the final formulation. Electroporation can be used for "naked" DNA, whereas cationic lipids allow direct in vitro transfection. A plasmid expressing green fluorescent protein (GFP) can be co-transfected to allow enrichment of transfected cells using fluorescence activated cell sorting (FACS). These cells are then chromium-51 (51Cr) labeled and used as target cells for epitope-specific CTL lines; cytolysis, detected by 51Cr release, indicates both production of, and HLA presentation of, minigene-encoded CTL epitopes. Expression of HTL epitopes may be evaluated in an analogous manner using assays to assess HTL activity.
[0208]In vivo immunogenicity is a second approach for functional testing of minigene DNA formulations. Transgenic mice expressing appropriate human HLA proteins are immunized with the DNA product. The dose and route of administration are formulation dependent (e.g., IM for DNA in PBS, intraperitoneal (i.p.) for lipid-complexed DNA). Twenty-one days after immunization, splenocytes are harvested and restimulated for one week in the presence of peptides encoding each epitope being tested. Thereafter, for CTL effector cells, assays are conducted for cytolysis of peptide-loaded, 51Cr-labeled target cells using standard techniques. Lysis of target cells that were sensitized by HLA loaded with peptide epitopes, corresponding to minigene-encoded epitopes, demonstrates DNA vaccine function for in vivo induction of CTLs. Immunogenicity of HTL epitopes is evaluated in transgenic mice in an analogous manner.
[0209]Alternatively, the nucleic acids can be administered using ballistic delivery as described, for instance, in U.S. Pat. No. 5,204,253. Using this technique, particles comprised solely of DNA are administered. In a further alternative embodiment, DNA can be adhered to particles, such as gold particles.
[0210]Minigenes can also be delivered using other bacterial or viral delivery systems well known in the art, e.g., an expression construct encoding epitopes of the invention can be incorporated into a viral vector such as vaccinia.
Combinations of CTL Peptides with Helper Peptides
[0211]Vaccine compositions comprising CTL peptides of the invention can be modified to provide desired attributes, such as improved serum half life, broadened population coverage or enhanced immunogenicity.
[0212]For instance, the ability of a peptide to induce CTL activity can be enhanced by linking the peptide to a sequence which contains at least one epitope that is capable of inducing a T helper cell response. The use of T helper epitopes in conjunction with CTL epitopes to enhance immunogenicity is illustrated, for example, in the co-pending applications U.S. Ser. No. 08/820,360, U.S. Ser. No. 08/197,484, and U.S. Ser. No. 08/464,234.
[0213]Although a CTL peptide can be directly linked to a T helper peptide, often CTL epitope/HTL epitope conjugates are linked by a spacer molecule. The spacer is typically comprised of relatively small, neutral molecules, such as amino acids or amino acid mimetics, which are substantially uncharged under physiological conditions. The spacers are typically selected from, e.g., Ala, Gly, or other neutral spacers of nonpolar amino acids or neutral polar amino acids. It will be understood that the optionally present spacer need not be comprised of the same residues and thus may be a hetero- or homo-oligomer. When present, the spacer will usually be at least one or two residues, more usually three to six residues and sometimes 10 or more residues. The CTL peptide epitope can be linked to the T helper peptide epitope either directly or via a spacer either at the amino or carboxy terminus of the CTL peptide. The amino terminus of either the immunogenic peptide or the T helper peptide may be acylated.
[0214]In certain embodiments, the T helper peptide is one that is recognized by T helper cells present in the majority of the population. This can be accomplished by selecting peptides that bind to many, most, or all of the HLA class II molecules. These are known as "loosely HLA-restricted" or "promiscuous" T helper sequences. Examples of amino acid sequences that are promiscuous include sequences from antigens such as tetanus toxoid at positions 830-843 (QYIKANSKFIGITE; SEQ ID NO: 51484), Plasmodium falciparum circumsporozoite (CS) protein at positions 378-398 (DIEKKIAKMEKASSVFNVVNS; SEQ ID NO: 51485), and Streptococcus 18 kD protein at positions 116 (GAVDSILGGVATYGAA; SEQ ID NO: 51486). Other examples include peptides bearing a DR 1-4-7 supermotif, or either of the DR3 motifs.
[0215]Alternatively, it is possible to prepare synthetic peptides capable of stimulating T helper lymphocytes, in a loosely HLA-restricted fashion, using amino acid sequences not found in nature (see, e.g., PCT publication WO 95/07707). These synthetic compounds called Pan-DR-binding epitopes (e.g., PADRE®, Epimmune, Inc., San Diego, Calif.) are designed to most preferrably bind most HLA-DR (human HLA class II) molecules. For instance, a pan-DR-binding epitope peptide having the formula: aKXVAAWTLKAAa, where "X" is either cyclohexylalanine, phenylalanine, or tyrosine, and a is either D-alanine or L-alanine, has been found to bind to most HLA-DR alleles, and to stimulate the response of T helper lymphocytes from most individuals, regardless of their HLA type. An alternative of a pan-DR binding epitope comprises all "L" natural amino acids and can be provided in the form of nucleic acids that encode the epitope.
[0216]HTL peptide epitopes can also be modified to alter their biological properties. For example, they can be modified to include D-amino acids to increase their resistance to proteases and thus extend their serum half life, or they can be conjugated to other molecules such as lipids, proteins, carbohydrates, and the like to increase their biological activity. For example, a T helper peptide can be conjugated to one or more palmitic acid chains at either the amino or carboxyl termini.
Combinations of CTL Peptides with T Cell Priming Agents
[0217]In some embodiments it may be desirable to include in the pharmaceutical compositions of the invention at least one component which primes cytotoxic T lymphocytes. Lipids have been identified as agents capable of priming CTL in vivo against viral antigens. For example, palmitic acid residues can be attached to the ε- and α-amino groups of a lysine residue and then linked, e.g., via one or more linking residues such as Gly, Gly-Gly-, Ser, Ser-Ser, or the like, to an immunogenic peptide. The lipidated peptide can then be administered either directly in a micelle or particle, incorporated into a liposome, or emulsified in an adjuvant, e.g., incomplete Freund's adjuvant. In a preferred embodiment, a particularly effective immunogenic composition comprises palmitic acid attached to ε- and α-amino groups of Lys, which is attached via linkage, e.g., Ser-Ser, to the amino terminus of the immunogenic peptide.
[0218]As another example of lipid priming of CTL responses, E. coli lipoproteins, such as tripalmitoyl-S-glycerylcysteinlyseryl-serine (P3CSS) can be used to prime virus specific CTL when covalently attached to an appropriate peptide (see, e.g., Deres, et al., Nature 342:561, 1989). Peptides of the invention can be coupled to P3CSS, for example, and the lipopeptide administered to an individual to specifically prime a CTL response to the target antigen. Moreover, because the induction of neutralizing antibodies can also be primed with P3CSS-conjugated epitopes, two such compositions can be combined to more effectively elicit both humoral and cell-mediated responses.
[0219]CTL and/or HTL peptides can also be modified by the addition of amino acids to the termini of a peptide to provide for ease of linking peptides one to another, for coupling to a carrier support or larger peptide, for modifying the physical or chemical properties of the peptide or oligopeptide, or the like. Amino acids such as tyrosine, cysteine, lysine, glutamic or aspartic acid, or the like, can be introduced at the C- or N-terminus of the peptide or oligopeptide, particularly class I peptides. However, it is to be noted that modification at the carboxyl terminus of a CTL epitope may, in some cases, alter binding characteristics of the peptide. In addition, the peptide or oligopeptide sequences can differ from the natural sequence by being modified by terminal-NH2 acylation, e.g., by alkanoyl (C1-C20) or thioglycolyl acetylation, terminal-carboxyl amidation, e.g., ammonia, methylamine, etc. In some instances these modifications may provide sites for linking to a support or other molecule.
Vaccine Compositions Comprising DC Pulsed with CTL and/or HTL Peptides
[0220]An embodiment of a vaccine composition in accordance with the invention comprises ex vivo administration of a cocktail of epitope-bearing peptides to PBMC, or isolated DC therefrom, from the patient's blood. A pharmaceutical to facilitate harvesting of DC can be used, such as Progenipoietinquadrature (Monsanto, St. Louis, Mo.) or GM-CSF/IL-4. After pulsing the DC with peptides and prior to reinfusion into patients, the DC are washed to remove unbound peptides. In this embodiment, a vaccine comprises peptide-pulsed DCs which present the pulsed peptide epitopes complexed with HLA molecules on their surfaces.
[0221]The DC can be pulsed ex vivo with a cocktail of peptides, some of which stimulate CTL responses to one or more HPV antigens of interest. Optionally, a helper T cell (HTL) peptide such as a PADRE family molecule, can be included to facilitate the CTL response. Thus, a vaccine in accordance with the invention, preferably comprising epitopes from multiple HPV antigens, is used to treat HPV infection or cancer resulting from HPV infection.
Administration of Vaccines for Therapeutic or Prophylactic Purposes
[0222]The peptides of the present invention and pharmaceutical and vaccine compositions of the invention are typically used to treat and/or prevent cancer associated with HPV infection. Vaccine compositions containing the peptides of the invention are administered to a patient infected with HPV or to an individual susceptible to, or otherwise at risk for, HPV infection to elicit an immune response against HPV antigens and thus enhance the patient's own immune response capabilities.
[0223]As noted above, peptides comprising CTL and/or HTL epitopes of the invention induce immune responses when presented by HLA molecules and contacted with a CTL or HTL specific for an epitope comprised by the peptide. The peptides (or DNA encoding them) can be administered individually or as fusions of one or more peptide sequences. The manner in which the peptide is contacted with the CTL or HTL is not critical to the invention. For instance, the peptide can be contacted with the CTL or HTL either in vivo or in vitro. If the contacting occurs in vivo, the peptide itself can be administered to the patient, or other vehicles, e.g., DNA vectors encoding one or more peptides, viral vectors encoding the peptide(s), liposomes and the like, can be used, as described herein.
[0224]When the peptide is contacted in vitro, the vaccinating agent can comprise a population of cells, e.g., peptide-pulsed dendritic cells, or HPV-specific CTLs, which have been induced by pulsing antigen-presenting cells in vitro with the peptide or by transfecting antigen-presenting cells with a minigene of the invention. Such a cell population is subsequently administered to a patient in a therapeutically effective dose.
[0225]In therapeutic applications, peptide and/or nucleic acid compositions are administered to a patient in an amount sufficient to elicit an effective CTL and/or HTL response to the virus antigen and to cure or at least partially arrest or slow symptoms and/or complications. An amount adequate to accomplish this is defined as "therapeutically effective dose." Amounts effective for this use will depend on, e.g., the particular composition administered, the manner of administration, the stage and severity of the disease being treated, the weight and general state of health of the patient, and the judgment of the prescribing physician.
[0226]For pharmaceutical compositions, the immunogenic peptides of the invention, or DNA encoding them, are generally administered to an individual already infected with HPV. The peptides or DNA encoding them can be administered individually or as fusions of one or more peptide sequences. HPV-infected patients, with or without neoplasia, can be treated with the immunogenic peptides separately or in conjunction with other treatments, such as surgery, as appropriate.
[0227]For therapeutic use, administration should generally begin at the first diagnosis of HPV infection or HPV-associated cancer. This is followed by boosting doses until at least symptoms are substantially abated and for a period thereafter. The embodiment of the vaccine composition (i.e., including, but not limited to embodiments such as peptide cocktails, polyepitopic polypeptides, minigenes, or TAA-specific CTLs or pulsed dendritic cells) delivered to the patient may vary according to the stage of the disease or the patient's health status. For example, in a patient with a tumor that expresses HPV antigens, a vaccine comprising HPV-specific CTL may be more efficacious in killing tumor cells in patient with advanced disease than alternative embodiments.
[0228]Where susceptible individuals are identified prior to or during infection, the composition can be targeted to them, thus minimizing the need for administration to a larger population. Susceptible populations include those individuals who are sexually active.
[0229]The peptide or other compositions used for the treatment or prophylaxis of HPV infection can be used, e.g., in persons who have not manifested symptoms, e.g., genital warts or neoplastic growth. In this context, it is generally important to provide an amount of the peptide epitope delivered by a mode of administration sufficient to effectively stimulate a cytotoxic T cell response; compositions which stimulate helper T cell responses can also be given in accordance with this embodiment of the invention.
[0230]The dosage for an initial therapeutic immunization generally occurs in a unit dosage range where the lower value is about 1, 5, 50, 500, or 1,000 μg and the higher value is about 10,000; 20,000; 30,000; or 50,000 μg. Dosage values for a human typically range from about 500 μg to about 50,000 μg per 70 kilogram patient. Boosting dosages of between about 1.0 μg to about 50,000 μg of peptide pursuant to a boosting regimen over weeks to months may be administered depending upon the patient's response and condition as determined by measuring the specific activity of CTL and HTL obtained from the patient's blood. Administration should continue until at least clinical symptoms or laboratory tests indicate that the viral infection, or neoplasia, has been eliminated or reduced and for a period thereafter. The dosages, routes of administration, and dose schedules are adjusted in accordance with methodologies known in the art.
[0231]In certain embodiments, the peptides and compositions of the present invention are employed in serious disease states, that is, life-threatening or potentially life threatening situations. In such cases, as a result of the minimal amounts of extraneous substances and the relative nontoxic nature of the peptides in preferred compositions of the invention, it is possible and may be felt desirable by the treating physician to administer substantial excesses of these peptide compositions relative to these stated dosage amounts.
[0232]The vaccine compositions of the invention can also be used purely as prophylactic agents. Generally the dosage for an initial prophylactic immunization generally occurs in a unit dosage range where the lower value is about 1, 5, 50, 500, or 1000 μg and the higher value is about 10,000; 20,000; 30,000; or 50,000 μg. Dosage values for a human typically range from about 500 μg to about 50,000 μg per 70 kilogram patient. This is followed by boosting dosages of between about 1.0 μg to about 50,000 μg of peptide administered at defined intervals from about four weeks to six months after the initial administration of vaccine. The immunogenicity of the vaccine can be assessed by measuring the specific activity of CTL and HTL obtained from a sample of the patient's blood.
[0233]The pharmaceutical compositions for therapeutic treatment are intended for parenteral, topical, oral, intrathecal, or local (e.g. as a cream or topical ointment) administration. Preferably, the pharmaceutical compositions are administered parentally, e.g., intravenously, subcutaneously, intradermally, or intramuscularly. Thus, the invention provides compositions for parenteral administration which comprise a solution of the immunogenic peptides dissolved or suspended in an acceptable carrier, preferably an aqueous carrier. A variety of aqueous carriers may be used, e.g., water, buffered water, 0.8% saline, 0.3% glycine, hyaluronic acid and the like. These compositions may be sterilized by conventional, well known sterilization techniques, or may be sterile filtered. The resulting aqueous solutions may be packaged for use as is, or lyophilized, the lyophilized preparation being combined with a sterile solution prior to administration. The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as pH-adjusting and buffering agents, tonicity adjusting agents, wetting agents, preservatives, and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, etc.
[0234]The concentration of peptides of the invention in the pharmaceutical formulations can vary widely, i.e., from less than about 0.1%, usually at or at least about 2% to as much as 20% to 50% or more by weight, and will be selected primarily by fluid volumes, viscosities, etc., in accordance with the particular mode of administration selected.
[0235]A human unit dose form of the peptide composition is typically included in a pharmaceutical composition that comprises a human unit dose of an acceptable carrier, preferably an aqueous carrier, and is administered in a volume of fluid that is known by those of skill in the art to be used for administration of such compositions to humans (see, e.g., Remington's Pharmaceutical Sciences, 17th Edition, A. Gennaro, Editor, Mack Publishing Co., Easton, Pa., 1985).
[0236]The peptides of the invention, and/or nucleic acids encoding the peptides, can also be administered via liposomes, which may also serve to target the peptides to a particular tissue, such as lymphoid tissue, or to target selectively to infected cells, as well as to increase the half-life of the peptide composition. Liposomes include emulsions, foams, micelles, insoluble monolayers, liquid crystals, phospholipid dispersions, lamellar layers and the like. In these preparations, the peptide to be delivered is incorporated as part of a liposome, alone or in conjunction with a molecule which binds to a receptor prevalent among lymphoid cells, such as monoclonal antibodies which bind to the CD45 antigen, or with other therapeutic or immunogenic compositions. Thus, liposomes either filled or decorated with a desired peptide of the invention can be directed to the site of lymphoid cells, where the liposomes then deliver the peptide compositions. Liposomes for use in accordance with the invention are formed from standard vesicle-forming lipids, which generally include neutral and negatively charged phospholipids and a sterol, such as cholesterol. The selection of lipids is generally guided by consideration of, e.g., liposome size, acid lability and stability of the liposomes in the blood stream. A variety of methods are available for preparing liposomes, as described in, e.g., Szoka, et al., Ann. Rev. Biophys. Bioeng. 9:467 (1980), and U.S. Pat. Nos. 4,235,871, 4,501,728, 4,837,028, and 5,019,369.
[0237]For targeting cells of the immune system, a ligand to be incorporated into the liposome can include, e.g., antibodies or fragments thereof specific for cell surface determinants of the desired immune system cells. A liposome suspension containing a peptide may be administered intravenously, locally, topically, etc. in a dose which varies according to, inter alia, the manner of administration, the peptide being delivered, and the stage of the disease being treated.
[0238]For solid compositions, conventional nontoxic solid carriers may be used which include, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium carbonate, and the like. For oral administration, a pharmaceutically acceptable nontoxic composition is formed by incorporating any of the normally employed excipients, such as those carriers previously listed, and generally 10-95% of active ingredient, that is, one or more peptides of the invention, and more preferably at a concentration of 25%-75%.
[0239]For aerosol administration, the immunogenic peptides are preferably supplied in finely divided form along with a surfactant and propellant. Typical percentages of peptides are 0.01%-20% by weight, preferably 1%-10%. The surfactant must, of course, be nontoxic, and preferably soluble in the propellant. Representative of such agents are the esters or partial esters of fatty acids containing from 6 to 22 carbon atoms, such as caproic, octanoic, lauric, palmitic, stearic, linoleic, linolenic, olesteric and oleic acids with an aliphatic polyhydric alcohol or its cyclic anhydride. Mixed esters, such as mixed or natural glycerides may be employed. The surfactant may constitute 0.1%-20% by weight of the composition, preferably 0.25-5%. The balance of the composition is ordinarily propellant. A carrier can also be included, as desired, as with, e.g., lecithin for intranasal delivery.
HLA Expression: Implications for T Cell-Based Immunotherapy
Disease Progression in Cancer and Infectious Disease
[0240]It is well recognized that a dynamic interaction between exists between host and disease, both in the cancer and infectious disease settings. In the infectious disease setting, it is well established that pathogens evolve during disease. The strains that predominate early in HIV infection are different from the ones that are associated with AIDS and later disease stages (NS versus S strains). It has long been hypothesized that pathogen forms that are effective in establishing infection may differ from the ones most effective in terms of replication and chronicity.
[0241]Similarly, it is widely recognized that the pathological process by which an individual succumbs to a neoplastic disease is complex. During the course of disease, many changes occur in cancer cells. The tumor accumulates alterations which are in part related to dysfunctional regulation of growth and differentiation, but also related to maximizing its growth potential, escape from drug treatment and/or the body's immunosurveillance. Neoplastic disease results in the accumulation of several different biochemical alterations of cancer cells, as a function of disease progression. It also results in significant levels of intra- and inter-cancer heterogeneity, particularly in the late, metastatic stage.
[0242]Familiar examples of cellular alterations affecting treatment outcomes include the outgrowth of radiation or chemotherapy resistant tumors during the course of therapy.
[0243]These examples parallel the emergence of drug resistant viral strains as a result of aggressive chemotherapy, e.g., of chronic HBV and HIV infection, and the current resurgence of drug resistant organisms that cause Tuberculosis and Malaria. It appears that significant heterogeneity of responses is also associated with other approaches to cancer therapy, including anti-angiogenesis drugs, passive antibody immunotherapy, and active T cell-based immunotherapy. Thus, in view of such phenomena, epitopes from multiple disease-related antigens can be used in vaccines and therapeutics thereby counteracting the ability of diseased cells to mutate and escape treatment.
The Interplay Between Disease and the Immune System
[0244]One of the main factors contributing to the dynamic interplay between host and disease is the immune response mounted against the pathogen, infected cell, or malignant cell. In many conditions such immune responses control the disease. Several animal model systems and prospective studies of natural infection in humans suggest that immune responses against a pathogen can control the pathogen, prevent progression to severe disease and/or eliminate the pathogen. A common theme is the requirement for a multispecific T cell response, and that narrowly focused responses appear to be less effective. These observations guide skilled artisan as to embodiments of methods and compositions of the present invention that provide for a broad immune response.
[0245]In the cancer setting there are several findings that indicate that immune responses can impact neoplastic growth:
[0246]First, the demonstration in many different animal models, that anti-tumor T cells, restricted by MHC class I, can prevent or treat tumors.
[0247]Second, encouraging results have come from immunotherapy trials.
[0248]Third, observations made in the course of natural disease correlated the type and composition of T cell infiltrate within tumors with positive clinical outcomes (Coulie P G, et al. Antitumor immunity at work in a melanoma patient In Advances in Cancer Research, 213-242, 1999).
[0249]Finally, tumors commonly have the ability to mutate, thereby changing their immunological recognition. For example, the presence of monospecific CTL was also correlated with control of tumor growth, until antigen loss emerged (Riker A, et al., Immune selection after antigen-specific immunotherapy of melanoma Surgery, August: 126(2):112-20, 1999; Marchand M, et al., Tumor regressions observed in patients with metastatic melanoma treated with an antigenic peptide encoded by gene MAGE-3 and presented by HLA-A1 Int. J. Cancer 80(2):219-30, Jan. 18, 1999). Similarly, loss of beta 2 microglobulin was detected in 5/13 lines established from melanoma patients after receiving immunotherapy at the NCI (Restifo N P, et al., Loss of functional Beta2-microglobulin in metastatic melanomas from five patients receiving immunotherapy Journal of the National Cancer Institute, Vol. 88 (2), 100-108, January 1996). It has long been recognized that HLA class I is frequently altered in various tumor types. This has led to a hypothesis that this phenomenon might reflect immune pressure exerted on the tumor by means of class I restricted CTL. The extent and degree of alteration in HLA class I expression appears to be reflective of past immune pressures, and may also have prognostic value (van Duinen S G, et al., Level of HLA antigens in locoregional metastases and clinical course of the disease in patients with melanoma Cancer Research 48, 1019-1025, February 1988; Moller P, et al., Influence of major histocompatibility complex class I and II antigens on survival in colorectal carcinoma Cancer Research 51, 729-736, January 1991). Taken together, these observations provide a rationale for immunotherapy of cancer and infectious disease, and suggest that effective strategies need to account for the complex series of pathological changes associated with disease.
The three main types of alterations in HLA expression in tumors and their functional significance
[0250]The level and pattern of expression of HLA class I antigens in tumors has been studied in many different tumor types and alterations have been reported in all types of tumors studied. The molecular mechanisms underlining HLA class I alterations have been demonstrated to be quite heterogeneous. They include alterations in the TAP/processing pathways, mutations of β2-microglobulin and specific HLA heavy chains, alterations in the regulatory elements controlling over class I expression and loss of entire chromosome sections. There are several reviews on this topic, see, e.g.,: Gamido F, et al., Natural history of HLA expression during tumour development Immunol Today 14(10):491-499, 1993; Kaklamanis L, et al., Loss of HLA class-I alleles, heavy chains and β2-microglobulin in colorectal cancer Int. J. Cancer, 51(3):379-85, May 28, 1992. There are three main types of HLA Class I alteration (complete loss, allele-specific loss and decreased expression). The functional significance of each alteration is discussed separately:
Complete Loss of HLA Expression
[0251]Complete loss of HLA expression can result from a variety of different molecular mechanisms, reviewed in (Algarra I, et al., The HLA crossroad in tumor immunology Human Immunology 61, 65-73, 2000; Browning M, et al., Mechanisms of loss of HLA class I expression on colorectal tumor cells Tissue Antigens 47:364-371, 1996; Ferrone S, et al., Loss of HLA class I antigens by melanoma cells: molecular mechanisms, functional significance and clinical relevance Immunology Today, 16(10): 487-494, 1995; Gamido F, et al., Natural history of HLA expression during tumour development Immunology Today 14(10):491-499, 1993; Tait, B D, HLA Class I expression on human cancer cells: Implications for effective immunotherapy Hum Immunol 61, 158-165, 2000). In functional terms, this type of alteration has several important implications.
[0252]While the complete absence of class I expression will eliminate CTL recognition of those tumor cells, the loss of HLA class I will also render the tumor cells extraordinary sensitive to lysis from NK cells (Ohnmacht, Ga., et al., Heterogeneity in expression of human leukocyte antigens and melanoma-associated antigens in advanced melanoma J Cellular Phys 182:332-338, 2000; Liunggren H G, et al., Host resistance directed selectively against H-2 deficient lymphoma variants: Analysis of the mechanism J. Exp. Med., December 1; 162(6):1745-59, 1985; Maio M, et al., Reduction in susceptibility to natural killer cell-mediated lysis of human FO-1 melanoma cells after induction of HLA class I antigen expression by transfection with B2m gene J. Clin. Invest. 88(1):282-9, July 1991; Schrier P I, et al., Relationship between myc oncogene activation and MHC class I expression Adv. Cancer Res., 60:181-246, 1993).
[0253]The complementary interplay between loss of HLA expression and gain in NK sensitivity is exemplified by the classic studies of Coulie and coworkers (Coulie, P G, et al., Antitumor immunity at work in a melanoma patient. In Advances in Cancer Research, 213-242, 1999) which described the evolution of a patient's immune response over the course of several years. Because of increased sensitivity to NK lysis, it is predicted that approaches leading to stimulation of innate immunity in general and NK activity in particular would be of special significance. An example of such approach is the induction of large amounts of dendritic cells (DC) by various hematopoietic growth factors, such as Flt3 ligand or ProGP. The rationale for this approach resides in the well known fact that dendritic cells produce large amounts of IL-12, one of the most potent stimulators for innate immunity and NK activity in particular. Alternatively, IL-12 is administered directly, or as nucleic acids that encode it. In this light, it is interesting to note that Flt3 ligand treatment results in transient tumor regression of a class I negative prostate murine cancer model (Ciavarra R P, et al., Flt3-Ligand induces transient tumor regression in an ectopic treatment model of major histocompatibility complex-negative prostate cancer Cancer Res 60:2081-84, 2000). In this context, specific anti-tumor vaccines in accordance with the invention synergize with these types of hematopoietic growth factors to facilitate both CTL and NK cell responses, thereby appreciably impairing a cell's ability to mutate and thereby escape efficacious treatment. Thus, an embodiment of the present invention comprises a composition of the invention together with a method or composition that augments functional activity or numbers of NK cells. Such an embodiment can comprise a protocol that provides a composition of the invention sequentially with an NK-inducing modality, or contemporaneous with an NK-inducing modality.
[0254]Secondly, complete loss of HLA frequently occurs only in a fraction of the tumor cells, while the remainder of tumor cells continue to exhibit normal expression. In functional terms, the tumor would still be subject, in part, to direct attack from a CTL response; the portion of cells lacking HLA subject to an NK response. Even if only a CTL response were used, destruction of the HLA expressing fraction of the tumor has dramatic effects on survival times and quality of life.
[0255]It should also be noted that in the case of heterogeneous HLA expression, both normal HLA-expressing as well as defective cells are predicted to be susceptible to immune destruction based on "bystander effects." Such effects were demonstrated, e.g., in the studies of Rosendahl and colleagues that investigated in vivo mechanisms of action of antibody targeted superantigens (Rosendahl A, et al., Perforin and IFN-gamma are involved in the antitumor effects of antibody-targeted superantigens J. Immunol. 160(11):5309-13, Jun. 1, 1998). The bystander effect is understood to be mediated by cytokines elicited from, e.g., CTLs acting on an HLA-bearing target cell, whereby the cytokines are in the environment of other diseased cells that are concomitantly killed.
Allele-Specific Loss
[0256]One of the most common types of alterations in class I molecules is the selective loss of certain alleles in individuals heterozygous for HLA. Allele-specific alterations might reflect the tumor adaptation to immune pressure, exerted by an immunodominant response restricted by a single HLA restriction element. This type of alteration allows the tumor to retain class I expression and thus escape NK cell recognition, yet still be susceptible to a CTL-based vaccine in accordance with the invention which comprises epitopes corresponding to the remaining HLA type. Thus, a practical solution to overcome the potential hurdle of allele-specific loss relies on the induction of multispecific responses. Just as the inclusion of multiple disease-associated antigens in a vaccine of the invention guards against mutations that yield loss of a specific disease antigens, simultaneously targeting multiple HLA specificities and multiple disease-related antigens prevents disease escape by allele-specific losses.
Decrease in Expression (Allele-Specific or not)
[0257]The sensitivity of effector CTL has long been demonstrated (Brower, R C, et al., Minimal requirements for peptide mediated activation of CD8+ CTL Mol. Immunol., 31; 1285-93, 1994; Chriustnick, E T, et al. Low numbers of MHC class I-peptide complexes required to trigger a T cell response Nature 352:67-70, 1991; Sykulev, Y, et al., Evidence that a single peptide-MHC complex on a target cell can elicit a cytolytic T cell response Immunity, 4(6):565-71, June 1996). Even a single peptide/MHC complex can result in tumor cells lysis and release of anti-tumor lymphokines. The biological significance of decreased HLA expression and possible tumor escape from immune recognition is not fully known. Nevertheless, it has been demonstrated that CTL recognition of as few as one MHC/peptide complex is sufficient to lead to tumor cell lysis.
[0258]Further, it is commonly observed that expression of HLA can be upregulated by gamma IFN, commonly secreted by effector CTL. Additionally, HLA class I expression can be induced in vivo by both alpha and beta IFN (Halloran, et al. Local T cell responses induce widespread MHC expression. J Immunol 148:3837, 1992; Pestka, S, et al., Interferons and their actions Annu. Rev. Biochem. 56:727-77, 1987). Conversely, decreased levels of HLA class I expression also render cells more susceptible to NK lysis.
[0259]With regard to gamma IFN, Torres et al (Torres, M J, et al., Loss of an HLA haplotype in pancreas cancer tissue and its corresponding tumor derived cell line. Tissue Antigens 47:372-81, 1996) note that HLA expression is upregulated by gamma IFN in pancreatic cancer, unless a total loss of haplotype has occurred. Similarly, Rees and Mian note that allelic deletion and loss can be restored, at least partially, by cytokines such as IFN-gamma (Rees, R., et al. Selective MHC expression in tumours modulates adaptive and innate antitumour responses Cancer Immunol Immunother 48:374-81, 1999). It has also been noted that IFN-gamma treatment results in upregulation of class 1 molecules in the majority of the cases studied (Browning M, et al., Mechanisms of loss of HLA class I expression on colorectal tumor cells. Tissue Antigens 47:364-71, 1996). Kaklamakis, et al. also suggested that adjuvant immunotherapy with IFN-gamma may be beneficial in the case of HLA class I negative tumors (Kaklamanis L, Loss of transporter in antigen processing 1 transport protein and major histocompatibility complex class I molecules in metastatic versus primary breast cancer. Cancer Research 55:5191-94, November 1995). It is important to underline that IFN-gamma production is induced and self-amplified by local inflammation/immunization (Halloran, et al. Local T cell responses induce widespread MHC expression J Immunol 148:3837, 1992), resulting in large increases in MHC expressions even in sites distant from the inflammatory site.
[0260]Finally, studies have demonstrated that decreased HLA expression can render tumor cells more susceptible to NK lysis (Ohnmacht, Ga., et al., Heterogeneity in expression of human leukocyte antigens and melanoma-associated antigens in advanced melanoma J Cellular Phys 182:332-38, 2000; Liunggren H G, et al., Host resistance directed selectively against H-2 deficient lymphoma variants: Analysis of the mechanism J. Exp. Med., 162(6):1745-59, Dec. 1, 1985; Maio M, et al., Reduction in susceptibility to natural killer cell-mediated lysis of human FO-1 melanoma cells after induction of HLA class I antigen expression by transfection with β2m gene J. Clin. Invest. 88(1):282-9, July 1991; Schrier P I, et al., Relationship between myc oncogene activation and MHC class I expression Adv. Cancer Res., 60:181-246, 1993). If decreases in HLA expression benefit a tumor because it facilitates CTL escape, but render the tumor susceptible to NK lysis, then a minimal level of HLA expression that allows for resistance to NK activity would be selected for (Gamido F, et al., Implications for immunosurveillance of altered HLA class I phenotypes in human tumours Immunol Today 18(2):89-96, February 1997). Therefore, a therapeutic compositions or methods in accordance with the invention together with a treatment to upregulate HLA expression and/or treatment with high affinity T-cells renders the tumor sensitive to CTL destruction.
Frequency of Alterations in HLA Expression
[0261]The frequency of alterations in class I expression is the subject of numerous studies (Algarra I, et al., The HLA crossroad in tumor immunology Human Immunology 61, 65-73, 2000). Rees and Mian estimate allelic loss to occur overall in 3-20% of tumors, and allelic deletion to occur in 15-50% of tumors. It should be noted that each cell carries two separate sets of class I genes, each gene carrying one HLA-A and one HLA-B locus. Thus, fully heterozygous individuals carry two different HLA-A molecules and two different HLA-B molecules. Accordingly, the actual frequency of losses for any specific allele could be as little as one quarter of the overall frequency. They also note that, in general, a gradient of expression exists between normal cells, primary tumors and tumor metastasis. In a study from Natali and coworkers (Natali P G, et al., Selective changes in expression of HLA class I polymorphic determinants in human solid tumors PNAS USA 86:6719-6723, September 1989), solid tumors were investigated for total HLA expression, using W6/32 antibody, and for allele-specific expression of the A2 antigen, as evaluated by use of the BB7.2 antibody. Tumor samples were derived from primary cancers or metastasis, for 13 different tumor types, and scored as negative if less than 20%, reduced if in the 30-80% range, and normal above 80%. All tumors, both primary and metastatic, were HLA positive with W6/32. In terms of A2 expression, a reduction was noted in 16.1% of the cases, and A2 was scored as undetectable in 39.4% of the cases. Gamido and coworkers (Gamido F, et al., Natural history of HLA expression during tumour development Immunol Today 14(10):491-99, 1993) emphasize that HLA changes appear to occur at a particular step in the progression from benign to most aggressive. Jiminez et al (Jiminez P, et al., Microsatellite instability analysis in tumors with different mechanisms for total loss of HLA expression. Cancer Immunol Immunother 48:684-90, 2000) have analyzed 118 different tumors (68 colorectal, 34 laryngeal and 16 melanomas). The frequencies reported for total loss of HLA expression were 11% for colon, 18% for melanoma and 13% for larynx. Thus, HLA class I expression is altered in a significant fraction of the tumor types, possibly as a reflection of immune pressure, or simply a reflection of the accumulation of pathological changes and alterations in diseased cells.
Immunotherapy in the Context of HLA Loss
[0262]A majority of the tumors express HLA class I, with a general tendency for the more severe alterations to be found in later stage and less differentiated tumors. This pattern is encouraging in the context of immunotherapy, especially considering that: 1) the relatively low sensitivity of immunohistochemical techniques might underestimate HLA expression in tumors; 2) class I expression can be induced in tumor cells as a result of local inflammation and lymphokine release; and, 3) class I negative cells are sensitive to lysis by NK cells.
[0263]Accordingly, various embodiments of the present invention can be selected in view of the fact that there can be a degree of loss of HLA molecules, particularly in the context of neoplastic disease. For example, the treating physician can assay a patient's tumor to ascertain whether HLA is being expressed. If a percentage of tumor cells express no class I HLA, then embodiments of the present invention that comprise methods or compositions that elicit NK cell responses can be employed. As noted herein, such NK-inducing methods or composition can comprise a Flt3 ligand or ProGP which facilitate mobilization of dendritic cells, the rationale being that dendritic cells produce large amounts of IL-12. IL-12 can also be administered directly in either amino acid or nucleic acid form. It should be noted that compositions in accordance with the invention can be administered concurrently with NK cell-inducing compositions, or these compositions can be administered sequentially.
[0264]In the context of allele-specific HLA loss, a tumor retains class I expression and may thus escape NK cell recognition, yet still be susceptible to a CTL-based vaccine in accordance with the invention which comprises epitopes corresponding to the remaining HLA type. The concept here is analogous to embodiments of the invention that include multiple disease antigens to guard against mutations that yield loss of a specific antigen. Thus, one can simultaneously target multiple HLA specificities and epitopes from multiple disease-related antigens to prevent tumor escape by allele-specific loss as well as disease-related antigen loss. In addition, embodiments of the present invention can be combined with alternative therapeutic compositions and methods. Such alternative compositions and methods comprise, without limitation, radiation, cytotoxic pharmaceuticals, and/or compositions/methods that induce humoral antibody responses.
[0265]Moreover, it has been observed that expression of HLA can be upregulated by gamma IFN, which is commonly secreted by effector CTL, and that HLA class I expression can be induced in vivo by both alpha and beta IFN. Thus, embodiments of the invention can also comprise alpha, beta and/or gamma IFN to facilitate upregulation of HLA.
Reprieve Periods from Therapies that Induce Side Effects: "Scheduled Treatment Interruptions or Drug Holidays"
[0266]Recent evidence has shown that certain patients infected with a pathogen, whom are initially treated with a therapeutic regimen to reduce pathogen load, have been able to maintain decreased pathogen load when removed from the therapeutic regimen, i.e., during a "drug holiday" (Rosenberg, E., et al., Immune control of HIV-1 after early treatment of acute infection Nature 407:523-26, Sep. 28, 2000) As appreciated by those skilled in the art, many therapeutic regimens for both pathogens and cancer have numerous, often severe, side effects. During the drug holiday, the patient's immune system is keeping the disease in check. Methods for using compositions of the invention are used in the context of drug holidays for cancer and pathogenic infection.
[0267]For treatment of an infection, where therapies are not particularly immunosuppressive, compositions of the invention are administered concurrently with the standard therapy. During this period, the patient's immune system is directed to induce responses against the epitopes comprised by the present inventive compositions. Upon removal from the treatment having side effects, the patient is primed to respond to the infectious pathogen should the pathogen load begin to increase. Composition of the invention can be provided during the drug holiday as well.
[0268]For patients with cancer, many therapies are immunosuppressive. Thus, upon achievement of a remission or identification that the patient is refractory to standard treatment, then upon removal from the immunosuppressive therapy, a composition in accordance with the invention is administered. Accordingly, as the patient's immune system reconstitutes, precious immune resources are simultaneously directed against the cancer. Composition of the invention can also be administered concurrently with an immunosuppressive regimen if desired.
Kits
[0269]The peptide and nucleic acid compositions of this invention can be provided in kit form together with instructions for vaccine administration. Typically the kit would include desired peptide compositions in a container, preferably in unit dosage form and instructions for administration. An alternative kit would include a minigene construct with desired nucleic acids of the invention in a container, preferably in unit dosage form together with instructions for administration. Lymphokines such as IL-2 or IL-12 may also be included in the kit. Other kit components that may also be desirable include, for example, a sterile syringe, booster dosages, and other desired excipients.
Overview
[0270]Epitopes in accordance with the present invention were successfully used to induce an immune response. Immune responses with these epitopes have been induced by administering the epitopes in various forms. The epitopes have been administered as peptides, as nucleic acids, and as viral vectors comprising nucleic acids that encode the epitope(s) of the invention. Upon administration of peptide-based epitope forms, immune responses have been induced by direct loading of an epitope onto an empty HLA molecule that is expressed on a cell, and via internalization of the epitope and processing via the HLA class I pathway; in either event, the HLA molecule expressing the epitope was then able to interact with and induce a CTL response. Peptides can be delivered directly or using such agents as liposomes. They can additionally be delivered using ballistic delivery, in which the peptides are typically in a crystalline form. When DNA is used to induce an immune response, it is administered either as naked DNA, generally in a dose range of approximately 1-5 mg, or via the ballistic "gene gun" delivery, typically in a dose range of approximately 10-100 μg. The DNA can be delivered in a variety of conformations, e.g., linear, circular etc. Various viral vectors have also successfully been used that comprise nucleic acids which encode epitopes in accordance with the invention.
[0271]Accordingly compositions in accordance with the invention exist in several forms. Embodiments of each of these composition forms in accordance with the invention have been successfully used to induce an immune response.
[0272]One composition in accordance with the invention comprises a plurality of peptides. This plurality or cocktail of peptides is generally admixed with one or more pharmaceutically acceptable excipients. The peptide cocktail can comprise multiple copies of the same peptide or can comprise a mixture of peptides. The peptides can be analogs of naturally occurring epitopes. The peptides can comprise artificial amino acids and/or chemical modifications such as addition of a surface active molecule, e.g., lipidation; acetylation, glycosylation, biotinylation, phosphorylation etc. The peptides can be CTL or HTL epitopes. In a preferred embodiment the peptide cocktail comprises a plurality of different CTL epitopes and at least one HTL epitope. The HTL epitope can be naturally or non-naturally (e.g., PADRE®, Epimmune Inc., San Diego, Calif.). The number of distinct epitopes in an embodiment of the invention is generally a whole unit integer from one through one hundred fifty (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, or 150).
[0273]An additional embodiment of a composition in accordance with the invention comprises a polypeptide multi-epitope construct, i.e., a polyepitopic peptide. Polyepitopic peptides in accordance with the invention are prepared by use of technologies well-known in the art. By use of these known technologies, epitopes in accordance with the invention are connected one to another. The polyepitopic peptides can be linear or non-linear, e.g., multivalent. These polyepitopic constructs can comprise artificial amino acids, spacing or spacer amino acids, flanking amino acids, or chemical modifications between adjacent epitope units. The polyepitopic construct can be a heteropolymer or a homopolymer. The polyepitopic constructs generally comprise epitopes in a quantity of any whole unit integer between 2-150 (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, or 150). The polyepitopic construct can comprise CTL and/or HTL epitopes. One or more of the epitopes in the construct can be modified, e.g., by addition of a surface active material, e.g. a lipid, or chemically modified, e.g., acetylation, etc. Moreover, bonds in the multiepitopic construct can be other than peptide bonds, e.g., covalent bonds, ester or ether bonds, disulfide bonds, hydrogen bonds, ionic bonds etc.
[0274]Alternatively, a composition in accordance with the invention comprises construct which comprises a series, sequence, stretch, etc., of amino acids that have homology to (i.e., corresponds to or is contiguous with) to a native sequence. This stretch of amino acids comprises at least one subsequence of amino acids that, if cleaved or isolated from the longer series of amino acids, functions as an HLA class I or HLA class II epitope in accordance with the invention. In this embodiment, the peptide sequence is modified, so as to become a construct as defined herein, by use of any number of techniques known or to be provided in the art. The polyepitopic constructs can contain homology to a native sequence in any whole unit integer increment from 70-100%, e.g., 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or, 100 percent.
[0275]A further embodiment of a composition in accordance with the invention is an antigen presenting cell that comprises one or more epitopes in accordance with the invention. The antigen presenting cell can be a "professional" antigen presenting cell, such as a dendritic cell. The antigen presenting cell can comprise the epitope of the invention by any means known or to be determined in the art. Such means include pulsing of dendritic cells with one or more individual epitopes or with one or more peptides that comprise multiple epitopes, by nucleic acid administration such as ballistic nucleic acid delivery or by other techniques in the art for administration of nucleic acids, including vector-based, e.g. viral vector, delivery of nucleic acids.
[0276]Further embodiments of compositions in accordance with the invention comprise nucleic acids that encode one or more peptides of the invention, or nucleic acids which encode a polyepitopic peptide in accordance with the invention. As appreciated by one of ordinary skill in the art, various nucleic acids compositions will encode the same peptide due to the redundancy of the genetic code. Each of these nucleic acid compositions falls within the scope of the present invention. This embodiment of the invention comprises DNA or RNA, and in certain embodiments a combination of DNA and RNA. It is to be appreciated that any composition comprising nucleic acids that will encode a peptide in accordance with the invention or any other peptide based composition in accordance with the invention, falls within the scope of this invention.
[0277]It is to be appreciated that peptide-based forms of the invention (as well as the nucleic acids that encode them) can comprise analogs of epitopes of the invention generated using principles already known, or to be known, in the art. Principles related to analoging are now known in the art, and are disclosed herein; moreover, analoging principles (heteroclitic analoging) are disclosed in co-pending application serial number U.S. Ser. No. 09/226,775 filed 6 Jan. 1999. Generally the compositions of the invention are isolated or purified.
[0278]The invention will be described in greater detail by way of specific examples. The following examples are offered for illustrative purposes, and are not intended to limit the invention in any manner. Those of skill in the art will readily recognize a variety of non-critical parameters that can be changed or modified to yield alternative embodiments in accordance with the invention.
Examples
[0279]The following example of peptide binding to HLA molecules demonstrates quantification of binding affinities of HLA class I and class II peptides. Binding assays can be performed with peptides that are either motif-bearing or not motif-bearing.
Example 1
HLA Class I and Class II Binding Assays
[0280]The following example of peptide binding to HLA molecules demonstrates quantification of binding affinities of HLA class I and class II peptides. Binding assays can be performed with peptides that are either motif-bearing or not motif-bearing.
[0281]HLA class I and class II binding assays using purified HLA molecules were performed in accordance with disclosed protocols (e.g., PCT publications WO 94/20127 and WO 94/03205; Sidney et al., Current Protocols in Immunology 18.3.1 (1998); Sidney, et al., J. Immunol. 154:247 (1995); Sette, et al., Mol. Immunol. 31:813 (1994)). Briefly, purified MHC molecules (5 to 500 nM) were incubated with various unlabeled peptide inhibitors and 1-10 nM 125I-radiolabeled probe peptides as described. Following incubation, MHC-peptide complexes were separated from free peptide by gel filtration and the fraction of peptide bound was determined. Typically, in preliminary experiments, each MHC preparation was titered in the presence of fixed amounts of radiolabeled peptides to determine the concentration of HLA molecules necessary to bind 10-20% of the total radioactivity. All subsequent inhibition and direct binding assays were performed using these HLA concentrations.
[0282]Since under these conditions [label]<[HLA] and IC50≧[HLA], the measured IC50 values are reasonable approximations of the true KD values. Peptide inhibitors are typically tested at concentrations ranging from 120 μg/ml to 1.2 ng/ml, and are tested in two to four completely independent experiments. To allow comparison of the data obtained in different experiments, a relative binding figure is calculated for each peptide by dividing the IC50 of a positive control for inhibition by the IC50 for each tested peptide (typically unlabeled versions of the radiolabeled probe peptide). For database purposes, and inter-experiment comparisons, relative binding values are compiled. These values can subsequently be converted back into IC50 nM values by dividing the IC50 nM of the positive controls for inhibition by the relative binding of the peptide of interest. This method of data compilation has proven to be the most accurate and consistent for comparing peptides that have been tested on different days, or with different lots of purified MHC.
[0283]Binding assays as outlined above may be used to analyze supermotif and/or motif-bearing epitopes as, for example, described in Example 2.
Example 2
Identification of HLA Supermotif- and Motif-Bearing CTL Candidate Epitopes
[0284]Vaccine compositions of the invention can include multiple epitopes that comprise multiple HLA supermotifs or motifs to achieve broad population coverage. This example illustrates the identification of supermotif- and motif-bearing epitopes for the inclusion in such a vaccine composition. Calculation of population coverage was performed using the strategy described below.
Computer Searches and Algorithms for Identification of Supermotif and/or Motif-Bearing Epitopes
[0285]The searches performed to identify the motif-bearing peptide sequences in Examples 2 and 5 employed the protein sequence data from seven proteins (E1, E2, E5, E6, E7, L1 and L2) from HPV types 16, 18, 31, 33, 45, and 56.
TABLE-US-00003 Accession numbers for HPV types Protein 6a 6b 11 E1 Q84293 P03113 W1WL11 AAA74213 CAA25020 P04014 W1WL6 AAA46929 E2 Q84294 P03119 AAA46930 AAA74214 CAA25021 W2WLI1 W2WL6 P04015 E4 Q84295 CAA25022 P04016 AAA74215 W4WL6 W4WL11 AAA46931 E5a Q84296 P06460 W5WL11 AAA74216 CAA25023 P04017 W5WL6A AAA46932 E5b N.A. P06461 W5WL1B CAA25024 P04018 W5WLB AAA46933 E6 Q84291 P06462 W6WL11 AAA74211 CAA250I8 P04019 W6WL6 AAA21703 AAA46927 E7 Q84929 P06464 AAA46928 AAA74212 CAA25019 AAA21704 W7WL6 W7WL11 P04020 L1 P03100 P03100 P04012 AAA74218 CAA25026 P1WL11 P1WL6 AAA4635 L2 Q84297 P03106 P2WL11 CAA25025 AAA46934 P2WL6 P040I3 Strain Protein Antigen Accession number HPV16 E1 W1SLHS HPV16 E2 W2WLHS HPV16 E5 W5WLHS HPV16 E6 W6WLHS HPV16 E7 W7WLHS HPV16 L1 AAD33259 HPV16 L2 AAD33258 HPV18 E1 W1WL18 HPV18 E2 WL18 HPV18 E5 W5WL18 HPV18 E6 W6WL18 HPV18 E7 PO6788 HPV18 L1 CAA28671 HPV18 L2 P2WL18 HPV31 E1 W1WL31 HPV31 E2 W2WL3 HPV31 E5 W5WL31 HPV31 E6 W6WL31 HPV31 E7 W7WL31 HPV31 L1 P1WL31 HPV31 L2 P2WL31 HPV45 E1 S36563 HPV45 E2 S36564 HPV45 E6 CAB44706 HPV45 E7 CAB44707 HPV45 L1 CAB44705 HPV45 L2 S36565 HPV33 E1 W1WL33 HPV33 E2 W2WL33 HPV33 E5 W5WL33 HPV33 E6 W6WL33 HPV33 E7 W7WL33 HPV33 L1 P1WL33 HPV33 L2 P2WL33 HPV56 E2 S36581 HPV56 E6 W6WL56 HPV56 E7 S36580 HPV56 L1 S38563 HPV56 L2 S36582
[0286]Computer searches for epitopes bearing HLA Class I or Class II supermotifs or motifs were performed as follows. All translated HPV protein sequences were analyzed using a text string search software program, e.g., MotifSearch 1.4 (D. Brown, San Diego) to identify potential peptide sequences containing appropriate HLA binding motifs; alternative programs are readily produced in accordance with information in the art in view of the motif/supermotif disclosure herein. Furthermore, such calculations can be made mentally.
[0287]Identified A2-, A3-, and DR-supermotif sequences were scored using polynomial algorithms to predict their capacity to bind to specific HLA-Class I or Class II molecules. These polynomial algorithms take into account both extended and refined motifs (that is, to account for the impact of different amino acids at different positions), and are essentially based on the premise that the overall affinity (or ΔG) of peptide-HLA molecule interactions can be approximated as a linear polynomial function of the type:
"ΔG"=a1i×a2i×a3i . . . ×ani
where aji is a coefficient which represents the effect of the presence of a given amino acid (j) at a given position (i) along the sequence of a peptide of n amino acids. The crucial assumption of this method is that the effects at each position are essentially independent of each other (i.e., independent binding of individual side-chains). When residue j occurs at position i in the peptide, it is assumed to contribute a constant amount ji to the free energy of binding of the peptide irrespective of the sequence of the rest of the peptide. This assumption is justified by studies from our laboratories that demonstrated that peptides are bound to MHC and recognized by T cells in essentially an extended conformation (data omitted herein).
[0288]The method of derivation of specific algorithm coefficients has been described in Gulukota et al., J. Mol. Biol. 267:1258-126, 1997; (see also Sidney et al., Human Immunol. 45:79-93, 1996; and Southwood et al., J. Immunol. 160:3363-3373, 1998). Briefly, for all i positions, anchor and non-anchor alike, the geometric mean of the average relative binding (ARB) of all peptides carrying j is calculated relative to the remainder of the group, and used as the estimate of ji. For Class II peptides, if multiple alignments are possible, only the highest scoring alignment is utilized, following an iterative procedure. To calculate an algorithm score of a given peptide in a test set, the ARB values corresponding to the sequence of the peptide are multiplied. If this product exceeds a chosen threshold, the peptide is predicted to bind. Appropriate thresholds are chosen as a function of the degree of stringency of prediction desired.
Selection of HLA-A2 Supertype Cross-Reactive Peptides
[0289]Complete protein sequences from the seven HPV structural and regulatory proteins of the HPV strains listed above were aligned, then scanned, utilizing motif identification software, to identify 9- and 10-mer sequences containing the HLA-A2-supermotif main anchor specificity.
[0290]HLA-A2 supermotif-bearing sequences are shown in Table VIII. Typically, these sequences are then scored using the A2 algorithm and the peptides corresponding to the positive-scoring sequences are synthesized and tested for their capacity to bind purified HLA-A*0201 molecules in vitro (HLA-A*0201 is considered a prototype A2 supertype molecule).
[0291]Examples of peptides that bind to HLA-A*0201 with IC50 values ≦500 nM are shown in Table VIII. These peptides are then tested for the capacity to bind to additional A2-supertype molecules (A*0202, A*0203, A*0206, and A*6802). Peptides that bind to at least three of the five A2-supertype alleles tested are typically deemed A2-supertype cross-reactive binders. Preferred peptides bind at an affinity equal to or less than 500 nM to three or more HLA-A2 supertype molecules.
Selection of HLA-A3 Supermotif-Bearing Epitopes
[0292]The HPV protein sequences scanned above were also examined for the presence of peptides with the HLA-A3-supermotif primary anchors (Table IX).
[0293]Peptides corresponding to the supermotif-bearing sequences are then synthesized and tested for binding to HLA-A*0301 and HLA-A*1101 molecules, the two most prevalent A3-supertype alleles. The peptides that are found to bind one of the two alleles with binding affinities of ≦500 nM, often ≦200 nM, are then tested for binding cross-reactivity to the other common A3-supertype alleles (A*3101, A*3301, and A*6801) to identify those that can bind at least three of the five HLA-A3-supertype molecules tested.
Selection of HLA-B7 Supermotif Bearing Epitopes
[0294]The same HPV target antigen protein sequences were also analyzed for the presence of 9- or 10-mer peptides with the HLA-B7-supermotif (Table XI).
[0295]Corresponding peptides are synthesized and tested for binding to HLA-B*0702, the most common B7-supertype allele (i.e., the prototype B7 supertype allele). Peptides binding B*0702 with IC50 of ≦500 nM are identified using standard methods. These peptides are then tested for binding to other common B7-supertype molecules (B*3501, B*5101, B*5301, and B*5401). Peptides capable of binding to three or more of the five B7-supertype alleles tested are thereby identified.
Selection of A1 and A24 Motif-Bearing Epitopes
[0296]To further increase population coverage, HLA-A1 and -A24 epitopes can, for example, also be incorporated into potential vaccine constructs. An analysis of the protein sequence data from the HPV target antigens utilized above can also be performed to identify HLA-A1- and A24-motif-containing sequences.
[0297]High affinity and/or cross-reactive binding epitopes that bear other motif and/or supermotifs are identified using analogous methodology.
Example 3
Confirmation of Immunogenicity
[0298]Cross-reactive candidate CTL A2-supermotif-bearing peptides that are identified as described in Example 2 were selected for in vitro immunogenicity testing. Testing was performed using the following methodology:
Target Cell Lines for Cellular Screening:
[0299]The 0.221A2.1 cell line, produced by transferring the HLA-A2.1 gene into the HLA-A, -B, -C null mutant human B-lymphoblastoid cell line 721.221, is used as the peptide-loaded target to measure activity of HLA-A2.1-restricted CTL. This cell line is grown in RPMI-1640 medium supplemented with antibiotics, sodium pyruvate, nonessential amino acids and 10% (v/v) heat inactivated FCS. Cells that express an antigen of interest, or transfectants comprising the gene encoding the antigen of interest, can be used as target cells to test the ability of peptide-specific CTLs to recognize endogenous antigen.
Primary CTL Induction Cultures:
[0300]Generation of Dendritic Cells (DC): PBMCs are thawed in RPMI with 30 μg/ml DNAse, washed twice and resuspended in complete medium (RPMI-1640 plus 5% AB human serum, non-essential amino acids, sodium pyruvate, L-glutamine and penicillin/strpetomycin). The monocytes are purified by plating 10×106 PBMC/well in a 6-well plate. After 2 hours at 37° C., the non-adherent cells are removed by gently shaking the plates and aspirating the supernatants. The wells are washed a total of three times with 3 ml RPMI to remove most of the non-adherent and loosely adherent cells. Three ml of complete medium containing 50 ng/ml of GM-CSF and 1,000 U/ml of IL-4 are then added to each well. TNFquadrature is added to the DCs on day 6 at 75 ng/ml and the cells are used for CTL induction cultures on day 7.
[0301]Induction of CTL with DC and Peptide: CD8+ T-cells are isolated by positive selection with Dynal immunomagnetic beads (Dynabeads® M-450) and the Detacha-Bead® reagent. Typically about 200-250×106 PBMC are processed to obtain 24×106 CD8.sup.+ T-cells (enough for a 48-well plate culture). Briefly, the PBMCs are thawed in RPMI with 30 μg/ml DNAse, washed once with PBS containing 1% human AB serum and resuspended in PBS/1% AB serum at a concentration of 20×106 cells/ml. The magnetic beads are washed 3 times with PBS/AB serum, added to the cells (140 μl beads/20×106 cells) and incubated for 1 hour at 4° C. with continuous mixing. The beads and cells are washed 4× with PBS/AB serum to remove the nonadherent cells and resuspended at 100×106 cells/ml (based on the original cell number) in PBS/AB serum containing 100 μl/ml Detacha-Bead® reagent and 30 μg/ml DNAse. The mixture is incubated for 1 hour at room temperature with continuous mixing. The beads are washed again with PBS/AB/DNAse to collect the CD8+ T-cells. The DC are collected and centrifuged at 1300 rpm for 5-7 minutes, washed once with PBS with 1% BSA, counted and pulsed with 40 μg/ml of peptide at a cell concentration of 1-2×106/ml in the presence of 3 μg/ml β2-microglobulin for 4 hours at 20° C. The DC are then irradiated (4,200 rads), washed 1 time with medium and counted again.
[0302]Setting up induction cultures: 0.25 ml cytokine-generated DC (@1×105 cells/ml) are co-cultured with 0.25 ml of CD8+ T-cells (@2×106 cell/ml) in each well of a 48-well plate in the presence of 10 ng/ml of IL-7. Recombinant human IL10 is added the next day at a final concentration of 10 ng/ml and rhuman IL2 is added 48 hours later at 10 IU/ml.
[0303]Restimulation of the induction cultures with peptide-pulsed adherent cells: Seven and fourteen days after the primary induction the cells are restimulated with peptide-pulsed adherent cells. The PBMCS are thawed and washed twice with RPMI and DNAse. The cells are resuspended at 5×106 cells/ml and irradiated at ˜4200 rads. The PBMCs are plated at 2×106 in 0.5 ml complete medium per well and incubated for 2 hours at 37° C. The plates are washed twice with RPMI by tapping the plate gently to remove the nonadherent cells and the adherent cells pulsed with 10 μg/ml of peptide in the presence of 3 μg/ml β2 microglobulin in 0.25 ml RPMI/5% AB per well for 2 hours at 37° C. Peptide solution from each well is aspirated and the wells are washed once with RPMI. Most of the media is aspirated from the induction cultures (CD8+ cells) and brought to 0.5 ml with fresh media. The cells are then transferred to the wells containing the peptide-pulsed adherent cells. Twenty four hours later rhuman IL10 is added at a final concentration of 10 ng/ml and rhuman IL2 is added the next day and again 2-3 days later at 50 IU/ml (Tsai et al., Critical Reviews in Immunology 18 (1-2):65-75, 1998). Seven days later the cultures are assayed for CTL activity in a 51Cr release assay. In some experiments the cultures are assayed for peptide-specific recognition in the in situ IFNγ ELISA at the time of the second restimulation followed by assay of endogenous recognition 7 days later. After expansion, activity is measured in both assays for a side by side comparison.
Measurement of CTL Lytic Activity by 51Cr Release.
[0304]Seven days after the second restimulation, cytotoxicity is determined in a standard (5 hr) 51Cr release assay by assaying individual wells at a single E:T. Peptide-pulsed targets are prepared by incubating the cells with 10 μg/ml peptide overnight at 37° C.
[0305]Adherent target cells are removed from culture flasks with trypsin-EDTA. Target cells are labelled with 200 μCi of 51Cr sodium chromate (Dupont, Wilmington, Del.) for 1 hour at 37° C. Labelled target cells are resuspended at 106 per ml and diluted 1:10 with K562 cells at a concentration of 3.3×106/ml (an NK-sensitive erythroblastoma cell line used to reduce non-specific lysis). Target cells (100 μl) and 100 μl of effectors are plated in 96 well round-bottom plates and incubated for 5 hours at 37° C. At that time, 100 μl of supernatant are collected from each well and percent lysis is determined according to the formula: [(cpm of the test sample-cpm of the spontaneous 51Cr release sample)/(cpm of the maximal 51Cr release sample-cpm of the spontaneous 51Cr release sample)]×100. Maximum and spontaneous release are determined by incubating the labelled targets with 1% Trition X-100 and media alone, respectively. A positive culture is defined as one in which the specific lysis (sample-background) is 10% or higher in the case of individual wells and is 15% or more at the 2 highest E:T ratios when expanded cultures are assayed.
In situ Measurement of Human γIFN Production as an Indicator of Peptide-Specific and Endogenous Recognition
[0306]Immulon 2 plates are coated with mouse anti-human IFNγ monoclonal antibody (4 μg/ml 0.1M NaHCO3, pH8.2) overnight at 4° C. The plates are washed with Ca2+, Mg2+-free PBS/0.05% Tween 20 and blocked with PBS/10% FCS for 2 hours, after which the CTLs (100 μl/well) and targets (100 μl/well) are added to each well, leaving empty wells for the standards and blanks (which received media only). The target cells, either peptide-pulsed or endogenous targets, are used at a concentration of 1×106 cells/ml. The plates are incubated for 48 hours at 37° C. with 5% CO2.
[0307]Recombinant human IFNγ is added to the standard wells starting at 400 pg or 1200 pg/100 μl/well and the plate incubated for 2 hours at 37° C. The plates are washed and 100 μl of biotinylated mouse anti-human IFNγ monoclonal antibody (2 μg/ml in PBS/3% FCS/0.05% Tween 20) are added and incubated for 2 hours at room temperature. After washing again, 100 μl HRP-streptavidin (1:4000) are added and the plates incubated for 1 hour at room temperature. The plates are then washed 6× with wash buffer, 100 μl/well developing solution (TMB 1:1) are added, and the plates allowed to develop for 5-15 minutes. The reaction is stopped with 50 μl/well 1M H3PO4 and read at OD450. A culture is considered positive if it measured at least 50 pg of IFNγ/well above background and is twice the background level of expression.
[0308]CTL Expansion. Those cultures that demonstrate specific lytic activity against peptide-pulsed targets and/or tumor targets are expanded over a two week period with anti-CD3. Briefly, 5×104 CD8+ cells are added to a T25 flask containing the following: 1×106 irradiated (4,200 rad) PBMC (autologous or allogeneic) per ml, 2×105 irradiated (8,000 rad) EBV-transformed cells per ml, and OKT3 (anti-CD3) at 30 ng per ml in RPMI-1640 containing 10% (v/v) human AB serum, non-essential amino acids, sodium pyruvate, 25 μM 2-mercaptoethanol, L-glutamine and penicillin/streptomycin. Rhuman IL2 is added 24 hours later at a final concentration of 2001 U/ml and every 3 days thereafter with fresh media at 50 IU/ml. The cells are split if the cell concentration exceeded 1×106/ml and the cultures are assayed between days 13 and 15 at E:T ratios of 30, 10, 3 and 1:1 in the 51Cr release assay or at 1×106/ml in the in situ IFNquadrature assay using the same targets as before the expansion.
[0309]Cultures are expanded in the absence of anti-CD3.sup.+ as follows. Those cultures that demonstrate specific lytic activity against peptide and endogenous targets are selected and 5×104 CD8.sup.+ cells are added to a T25 flask containing the following: 1×106 autologous PBMC per ml which have been peptide-pulsed with 10 μg/ml peptide for 2 hours at 37° C. and irradiated (4,200 rad); 2×105 irradiated (8,000 rad) EBV-transformed cells per ml RPMI-1640 containing 10% (v/v) human AB serum, non-essential AA, sodium pyruvate, 25 mM 2-ME, L-glutamine and gentamicin.
Immunogenicity of A2 Supermotif-Bearing Peptides
[0310]A2-supermotif cross-reactive binding peptides are tested in the cellular assay for the ability to induce peptide-specific CTL in normal individuals. In this analysis, a peptide is typically considered to be an epitope if it induces peptide-specific CTLs in at least 2 donors (unless otherwise noted) and preferably, also recognizes the endogenously expressed peptide.
[0311]Immunogenicity is additionally confirmed using PBMCs isolated from HPV-infected patients. Briefly, PBMCs are isolated from patients, re-stimulated with peptide-pulsed monocytes and assayed for the ability to recognize peptide-pulsed target cells as well as transfected cells endogenously expressing the antigen.
Evaluation of A*03/A11 Immunogenicity
[0312]HLA-A3 supermotif-bearing cross-reactive binding peptides are also evaluated for immunogenicity using methodology analogous for that used to evaluate the immunogenicity of the HLA-A2 supermotif peptides.
Evaluation of B7 Immunogenicity
[0313]Immunogenicity screening of the B7-supertype cross-reactive binding peptides identified in Example 2 are evaluated in a manner analogous to the evaluation of A2- and A3-supermotif-bearing peptides.
[0314]Peptides bearing other supermotifs/motifs, e.g., HLA-A1, HLA-A24 etc. are also evaluated using similar methodology
Example 4
Implementation of the Extended Supermotif to Improve the Binding Capacity of Native Epitopes by Creating Analogs
[0315]HLA motifs and supermotifs (comprising primary and/or secondary residues) are useful in the identification and preparation of highly cross-reactive native peptides, as demonstrated herein. Moreover, the definition of HLA motifs and supermotifs also allows one to engineer highly cross-reactive epitopes by identifying residues within a native peptide sequence which can be analoged, or "fixed" to confer upon the peptide certain characteristics, e.g. greater cross-reactivity within the group of HLA molecules that comprise a supertype, and/or greater binding affinity for some or all of those HLA molecules. Examples of analoging peptides to exhibit modulated binding affinity are set forth in this example.
Analoging at Primary Anchor Residues
[0316]Peptide engineering strategies are implemented to further increase the cross-reactivity of the epitopes. For example, on the basis of the data disclosed, e.g., in related and co-pending U.S.S.N 09/226,775, the main anchors of A2-supermotif-bearing peptides are altered, for example, to introduce a preferred L, I, V, or M at position 2, and I or V at the C-terminus.
[0317]To analyze the cross-reactivity of the analog peptides, each engineered analog is initially tested for binding to the prototype A2 supertype allele A*0201, then, if A*0201 binding capacity is maintained, for A2-supertype cross-reactivity.
[0318]Alternatively, a peptide is tested for binding to one or all supertype members and then analogued to modulate binding affinity to any one (or more) of the supertype members to add population coverage.
[0319]The selection of analogs for immunogenicity in a cellular screening analysis is typically further restricted by the capacity of the parent peptide to bind at least weakly, i.e., bind at an IC50 of 500 nM or less, to three of more A2 supertype alleles. The rationale for this requirement is that the WT peptides must be present endogenously in sufficient quantity to be biologically relevant. Analoged peptides have been shown to have increased immunogenicity and cross-reactivity by T cells specific for the parent epitope (see, e.g., Parkhurst et al., J. Immunol. 157:2539, 1996; and Pogue et al., Proc. Natl. Acad. Sci. USA 92:8166, 1995).
[0320]In the cellular screening of these peptide analogs, it is important to demonstrate that analog-specific CTLs are also able to recognize the wild-type peptide and, when possible, target cells that endogenously express the epitope.
Analoging of HLA-A3 and B7-Supermotif-Bearing Peptides
[0321]Analogs of HLA-A3 supermotif-bearing epitopes are generated using strategies similar to those employed in analoging HLA-A2 supermotif-bearing peptides. For example, peptides binding to 3/5 of the A3-supertype molecules are engineered at primary anchor residues to possess a preferred residue (V, S, M, or A) at position 2.
[0322]The analog peptides are then tested for the ability to bind A*03 and A*11 (prototype A3 supertype alleles). Those peptides that demonstrate ≦500 nM binding capacity are then tested for A3-supertype cross-reactivity.
[0323]Similarly to the A2- and A3-motif bearing peptides, peptides binding 3 or more B7-supertype alleles can be improved, where possible, to achieve increased cross-reactive binding. B7 supermotif-bearing peptides are, for example, engineered to possess a preferred residue (V, I, L, or F) at the C-terminal primary anchor position, as demonstrated by Sidney et al. (J. Immunol. 157:3480-3490, 1996).
[0324]Analoguing at primary anchor residues of other motif and/or supermotif-bearing epitopes is performed in a like manner.
[0325]The analog peptides are then be tested for immunogenicity, typically in a cellular screening assay. Again, it is generally important to demonstrate that analog-specific CTLs are also able to recognize the wild-type peptide and, when possible, targets that endogenously express the epitope.
Analoging at Secondary Anchor Residues
[0326]Moreover, HLA supermotifs are of value in engineering highly cross-reactive peptides and/or peptides that bind HLA molecules with increased affinity by identifying particular residues at secondary anchor positions that are associated with such properties. For example, the binding capacity of a B7 supermotif-bearing peptide with an F residue at position 1 is analyzed. The peptide is then analoged to, for example, substitute L for F at position 1. The analoged peptide is evaluated for increased binding affinity/and or increased cross-reactivity. Such a procedure identifies analoged peptides with modulated binding affinity.
[0327]Engineered analogs with sufficiently improved binding capacity or cross-reactivity can also be tested for immunogenicity in HLA-B7-transgenic mice, following for example, IFA immunization or lipopeptide immunization. Analogued peptides are additionally tested for the ability to stimulate a recall response using PBMC from HPV-infected patients.
Other Analoguing strategies
[0328]Another form of peptide analoguing, unrelated to the anchor positions, involves the substitution of a cysteine with α-amino butyric acid. Due to its chemical nature, cysteine has the propensity to form disulfide bridges and sufficiently alter the peptide structurally so as to reduce binding capacity. Substitution of α-amino butyric acid for cysteine not only alleviates this problem, but has been shown to improve binding and crossbinding capabilities in some instances (see, e.g., the review by Sette et al., In: Persistent Viral Infections, Eds. R. Ahmed and I. Chen, John Wiley & Sons, England, 1999).
[0329]Thus, by the use of even single amino acid substitutions, the binding affinity and/or cross-reactivity of peptide ligands for HLA supertype molecules can be modulated.
Example 5
Identification of HPV-Derived Sequences with HLA-DR Binding Motifs
[0330]Peptide epitopes bearing an HLA class II supermotif or motif are identified as outlined below using methodology similar to that described in Examples 1-3.
Selection of HLA-DR-Supermotif-Bearing Epitopes.
[0331]To identify HPV-derived, HLA class II HTL epitopes, the protein sequences from the same HPV antigens used for the identification of HLA Class I supermotif/motif sequences were analyzed for the presence of sequences bearing an HLA-DR-motif or supermotif. Specifically, 15-mer sequences were selected comprising a DR-supermotif, further comprising a 9-mer core, and three-residue N- and C-terminal flanking regions (15 amino acids total).
[0332]Protocols for predicting peptide binding to DR molecules have been developed (Southwood et al., J. Immunol. 160:3363-3373, 1998). These protocols, specific for individual DR molecules, allow the scoring, and ranking, of 9-mer core regions. Each protocol not only scores peptide sequences for the presence of DR-supermotif primary anchors (i.e., at position 1 and position 6) within a 9-mer core, but additionally evaluates sequences for the presence of secondary anchors. Using allele specific selection tables (see, e.g., Southwood et al., ibid.), it has been found that these protocols efficiently select peptide sequences with a high probability of binding a particular DR molecule. Additionally, it has been found that performing these protocols in tandem, specifically those for DR1, DR4w4, and DR7, can efficiently select DR cross-reactive peptides.
[0333]The HPV-derived peptides identified above are tested for their binding capacity for various common HLA-DR molecules. All peptides are initially tested for binding to the DR molecules in the primary panel: DR1, DR4w4, and DR7. Peptides binding at least 2 of these 3 DR molecules are then tested for binding to DR2w2 β1, DR2w2 β2, DR6w19, and DR9 molecules in secondary assays. Finally, peptides binding at least 2 of the 4 secondary panel DR molecules, and thus cumulatively at least 4 of 7 different DR molecules, are screened for binding to DR4w15, DR5w11, and DR8w2 molecules in tertiary assays. Peptides binding at least 7 of the 10 DR molecules comprising the primary, secondary, and tertiary screening assays are considered cross-reactive DR binders. HPV-derived peptides found to bind common HLA-DR alleles are of particular interest.
Selection of DR3 Motif Peptides
[0334]Because HLA-DR3 is an allele that is prevalent in Caucasian, Black, and Hispanic populations, DR3 binding capacity is an important criterion in the selection of HTL epitopes. However, data generated previously indicated that DR3 only rarely cross-reacts with other DR alleles (Sidney et al., J. Immunol. 149:2634-2640, 1992; Geluk et al., J. Immunol. 152:5742-5748, 1994; Southwood et al., J. Immunol. 160:3363-3373, 1998). This is not entirely surprising in that the DR3 peptide-binding motif appears to be distinct from the specificity of most other DR alleles. For maximum efficiency in developing vaccine candidates it would be desirable for DR3 motifs to be clustered in proximity with DR supermotif regions. Thus, peptides shown to be candidates may also be assayed for their DR3 binding capacity. However, in view of the distinct binding specificity of the DR3 motif, peptides binding only to DR3 can also be considered as candidates for inclusion in a vaccine formulation.
[0335]To efficiently identify peptides that bind DR3, target HPV antigens are analyzed for sequences carrying one of the two DR3 specific binding motifs reported by Geluk et al. (J. Immunol. 152:5742-5748, 1994). The corresponding peptides are then synthesized and tested for the ability to bind DR3 with an affinity of 1 μM or better, i.e., less than 1 μM. Peptides are found that meet this binding criterion and qualify as HLA class II high affinity binders.
[0336]DR3 binding epitopes identified in this manner are included in vaccine compositions with DR supermotif-bearing peptide epitopes.
[0337]Similarly to the case of HLA class I motif-bearing peptides, the class II motif-bearing peptides are analoged to improve affinity or cross-reactivity. For example, aspartic acid at position 4 of the 9-mer core sequence is an optimal residue for DR3 binding, and substitution for that residue often improves DR 3 binding.
Example 6
Immunogenicity of HPV-Derived HTL Epitopes
[0338]This example determines immunogenic DR supermotif- and DR3 motif-bearing epitopes among those identified using the methodology in Example 5.
[0339]Immunogenicity of HTL epitopes are evaluated in a manner analogous to the determination of immunogenicity of CTL epitopes by assessing the ability to stimulate HTL responses and/or by using appropriate transgenic mouse models. Immunogenicity is determined by screening for: 1.) in vitro primary induction using normal PBMC or 2.) recall responses from cancer patient PBMCs.
Example 7
Calculation of Phenotypic Frequencies of HLA-Supertypes in Various Ethnic Backgrounds to Determine Breadth of Population Coverage
[0340]This example illustrates the assessment of the breadth of population coverage of a vaccine composition comprised of multiple epitopes comprising multiple supermotifs and/or motifs.
[0341]In order to analyze population coverage, gene frequencies of HLA alleles were determined. Gene frequencies for each HLA allele were calculated from antigen or allele frequencies utilizing the binomial distribution formulae gf=1-(SQRT(1-af)) (see, e.g., Sidney et al., Human Immunol. 45:79-93, 1996). To obtain overall phenotypic frequencies, cumulative gene frequencies were calculated, and the cumulative antigen frequencies derived by the use of the inverse formula [af=1-(1-Cgf)2].
[0342]Where frequency data was not available at the level of DNA typing, correspondence to the serologically defined antigen frequencies was assumed. To obtain total potential supertype population coverage no linkage disequilibrium was assumed, and only alleles confirmed to belong to each of the supertypes were included (minimal estimates). Estimates of total potential coverage achieved by inter-loci combinations were made by adding to the A coverage the proportion of the non-A covered population that could be expected to be covered by the B alleles considered (e.g., total=A+B*(1-A)). Confirmed members of the A3-like supertype are A3, A11l, A31, A*3301, and A*6801. Although the A3-like supertype may also include A34, A66, and A*7401, these alleles were not included in overall frequency calculations. Likewise, confirmed members of the A2-like supertype family are A*0201, A*0202, A*0203, A*0204, A*0205, A*0206, A*0207, A*6802, and A*6901. Finally, the B7-like supertype-confirmed alleles are: B7, B*3501-03, B51, B*5301, B*5401, B*5501-2, B*5601, B*6701, and B*7801 (potentially also B*1401, B*3504-06, B*4201, and B*5602).
[0343]Population coverage achieved by combining the A2-, A3- and B7-supertypes is approximately 86% in five major ethnic groups, supra. Coverage may be extended by including peptides bearing the A1 and A24 motifs. On average, A1 is present in 12% and A24 in 29% of the population across five different major ethnic groups (Caucasian, North American Black, Chinese, Japanese, and Hispanic). Together, these alleles are represented with an average frequency of 39% in these same ethnic populations. The total coverage across the major ethnicities when A1 and A24 are combined with the coverage of the A2-, A3- and B7-supertype alleles is >95%. An analagous approach can be used to estimate population coverage achieved with combinations of class II motif-bearing epitopes.
[0344]Immunogenicity studies in humans (e.g., Bertoni et al., J. Clin. Invest. 100:503, 1997; Doolan et al., Immunity 7:97, 1997; and Threlkeld et al., J. Immunol. 159:1648, 1997) have shown that highly cross-reactive binding peptides are almost always recognized as epitopes. The use of highly cross-reactive binding peptides is an important selection criterion in identifying candidate epitopes for inclusion in a vaccine that is immunogenic in a diverse population.
[0345]With a sufficient number of epitopes (as disclosed herein and from the art), an average population coverage is predicted to be greater than 95% in each of five major ethnic populations. The game theory Monte Carlo simulation analysis, which is known in the art (see e.g., Osborne, M. J. and Rubinstein, A. "A course in game theory" MIT Press, 1994), can be used to estimate what percentage of the individuals in a population comprised of the Caucasian, North American Black, Japanese, Chinese, and Hispanic ethnic groups would recognize the vaccine epitopes described herein. A preferred percentage is 90%. A more preferred percentage is 95%.
Example 8
CTL Recognition Of Endogenous Processed Antigens After Priming
[0346]This example determines that CTL induced by native or analogued peptide epitopes identified and selected as described in Examples 1-6 recognize endogenously synthesized, i.e., native antigens.
[0347]Effector cells isolated from transgenic mice that are immunized with peptide epitopes as in Example 3, for example HLA-A2 supermotif-bearing epitopes, are re-stimulated in vitro using peptide-coated stimulator cells. Six days later, effector cells are assayed for cytotoxicity and the cell lines that contain peptide-specific cytotoxic activity are further re-stimulated. An additional six days later, these cell lines are tested for cytotoxic activity on 51Cr labeled Jurkat-A2.1/Kb target cells in the absence or presence of peptide, and also tested on 51Cr labeled target cells bearing the endogenously synthesized antigen, i.e. cells that are stably transfected with HPV expression vectors.
[0348]The result will demonstrate that CTL lines obtained from animals primed with peptide epitope recognize endogenously synthesized HPV antigen. The choice of transgenic mouse model to be used for such an analysis depends upon the epitope(s) that is being evaluated. In addition to HLA-A*0201/Kb transgenic mice, several other transgenic mouse models including mice with human A11, which may also be used to evaluate A3 epitopes, and B7 alleles have been characterized and others (e.g., transgenic mice for HLA-A1 and A24) are being developed. HLA-DR1 and HLA-DR3 mouse models have also been developed, which may be used to evaluate HTL epitopes.
Example 9
Activity of CTL-HTL Conjugated Epitopes in Transgenic Mice
[0349]This example illustrates the induction of CTLs and HTLs in transgenic mice by use of a tumor associated antigen CTL/HTL peptide conjugate whereby the vaccine composition comprises peptides to be administered to an HPV-infected patient. The peptide composition can comprise multiple CTL and/or HTL epitopes and further, can comprise epitopes selected from multiple HPV target antigens. The epitopes are identified using methodology as described in Examples 1-6 This analysis demonstrates the enhanced immunogenicity that can be achieved by inclusion of one or more HTL epitopes in a vaccine composition. Such a peptide composition can comprise an HTL epitope conjugated to a preferred CTL epitope containing, for example, at least one CTL epitope that binds to multiple HLA family members at an affinity of 500 nM or less, or analogs of that epitope. The peptides may be lipidated, if desired.
[0350]Immunization procedures: Immunization of transgenic mice is performed as described (Alexander et al., J. Immunol. 159:4753-4761, 1997). For example, A2/Kb mice, which are transgenic for the human HLA A2.1 allele and are useful for the assessment of the immunogenicity of HLA-A*0201 motif- or HLA-A2 supermotif-bearing epitopes, are primed subcutaneously (base of the tail) with a 0.1 ml of peptide in Incomplete Freund's Adjuvant, or if the peptide composition is a lipidated CTL/HTL conjugate, in DMSO/saline or if the peptide composition is a polypeptide, in PBS or Incomplete Freund's Adjuvant. Seven days after priming, splenocytes obtained from these animals are restimulated with syngenic irradiated LPS-activated lymphoblasts coated with peptide.
[0351]Cell lines: Target cells for peptide-specific cytotoxicity assays are Jurkat cells transfected with the HLA-A2.1/Kb chimeric gene (e.g., Vitiello et al., J. Exp. Med. 173:1007, 1991)
[0352]In vitro CTL activation: One week after priming, spleen cells (30×106 cells/flask) are co-cultured at 37° C. with syngeneic, irradiated (3000 rads), peptide coated lymphoblasts (10×106 cells/flask) in 10 ml of culture medium/T25 flask. After six days, effector cells are harvested and assayed for cytotoxic activity.
[0353]Assay for cytotoxic activity: Target cells (1.0 to 1.5×106) are incubated at 37° C. in the presence of 200 μl of 51Cr. After 60 minutes, cells are washed three times and resuspended in R10 medium. Peptide is added where required at a concentration of 1 μg/ml. For the assay, 104 51 Cr-labeled target cells are added to different concentrations of effector cells (final volume of 200 μl) in U-bottom 96-well plates. After a 6 hour incubation period at 37° C., a 0.1 ml aliquot of supernatant is removed from each well and radioactivity is determined in a Micromedic automatic gamma counter. The percent specific lysis is determined by the formula: percent specific release=100×(experimental release-spontaneous release)/(maximum release-spontaneous release). To facilitate comparison between separate CTL assays run under the same conditions, % 51Cr release data is expressed as lytic units/106 cells. One lytic unit is arbitrarily defined as the number of effector cells required to achieve 30% lysis of 10,000 target cells in a 6 hour 51Cr release assay. To obtain specific lytic units/106, the lytic units/106 obtained in the absence of peptide is subtracted from the lytic units/106 obtained in the presence of peptide. For example, if 30% 51Cr release is obtained at the effector (E): target (T) ratio of 50:1 (i.e., 5×105 effector cells for 10,000 targets) in the absence of peptide and 5:1 (i.e., 5×104 effector cells for 10,000 targets) in the presence of peptide, the specific lytic units would be: [( 1/50,000)-( 1/500,000)]×106=18 LU.
[0354]The results are analyzed to assess the magnitude of the CTL responses of animals injected with the immunogenic CTL/HTL conjugate vaccine preparation and are compared to the magnitude of the CTL response achieved using the CTL epitope as outlined in Example 3. Analyses similar to this may be performed to evaluate the immunogenicity of peptide conjugates containing multiple CTL epitopes and/or multiple HTL epitopes. In accordance with these procedures it is found that a CTL response is induced, and concomitantly that an HTL response is induced upon administration of such compositions.
Example 10
Selection of CTL and HTL Epitopes for Inclusion in an HPV-Specific Vaccine
[0355]This example illustrates the procedure for the selection of peptide epitopes for vaccine compositions of the invention. The peptides in the composition can be in the form of a nucleic acid sequence, either single or one or more sequences (i.e., minigene) that encodes peptide(s), or can be single and/or polyepitopic peptides.
[0356]The following principles are utilized when selecting an array of epitopes for inclusion in a vaccine composition. Each of the following principles is balanced in order to make the selection.
[0357]Epitopes are selected which, upon administration, mimic immune responses that have been observed to be correlated with HPV clearance. The number of epitopes used depends on observations of patients who spontaneously clear HPV. For example, if it has been observed that patients who spontaneously clear HPV generate an immune response to at least 3 epitopes on at least one HPV antigen, then 3-4 epitopes should be included for HLA class I. A similar rationale is used to determine HLA class II epitopes.
[0358]When selecting an array of HPV epitopes, it is preferred that at least some of the epitopes are derived from early and late proteins. The early proteins of HPV are expressed when the virus is replicating, either following acute or dormant infection. Therefore, it is particularly preferred to use epitopes from early stage proteins to alleviate disease manifestations at the earliest stage possible.
[0359]Epitopes are often selected that have a binding affinity of an IC50 of 500 nM or less for an HLA class 1 molecule, or for class II, an IC50 of 1000 nM or less.
[0360]Sufficient supermotif bearing peptides, or a sufficient array of allele-specific motif bearing peptides, are selected to give broad population coverage. For example, epitopes are selected to provide at least 80% population coverage. A Monte Carlo analysis, a statistical evaluation known in the art, can be employed to assess breadth, or redundancy, of population coverage.
[0361]When creating a polyepitopic compositions, e.g. a minigene, it is typically desirable to generate the smallest peptide possible that encompasses the epitopes of interest. The principles employed are similar, if not the same, as those employed when selecting a peptide comprising nested epitopes.
[0362]In cases where the sequences of multiple variants of the same target protein are available, potential peptide epitopes can also be selected on the basis of their conservancy. For example, a criterion for conservancy may define that the entire sequence of an HLA class I binding peptide or the entire 9-mer core of a class II binding peptide be conserved in a designated percentage of the sequences evaluated for a specific protein antigen.
[0363]A vaccine composition comprised of selected peptides, when administered, is safe, efficacious, and elicits an immune response similar in magnitude to an immune response that controls or clears an acute HPV infection.
Example 11
Construction of Minigene Multi-Epitope DNA Plasmids
[0364]This example provides general guidance for the construction of a minigene expression plasmid. Minigene plasmids may, of course, contain various configurations of CTL and/or HTL epitopes or epitope analogs as described herein. Examples of the construction and evaluation of expression plasmids are described, for example, in co-pending U.S. Ser. No. 09/311,784 filed May 13, 1999.
[0365]A minigene expression plasmid typically includes multiple CTL and HTL peptide epitopes. In the present example, HLA-A2, -A3, -B7 supermotif-bearing peptide epitopes and HLA-A1 and -A24 motif-bearing peptide epitopes are used in conjunction with DR supermotif-bearing epitopes and/or DR3 epitopes. HLA class I supermotif or motif-bearing peptide epitopes derived from multiple HPV antigens, preferably including both early and late phase antigens, are selected such that multiple supermotifs/motifs are represented to ensure broad population coverage. Similarly, HLA class II epitopes are selected from multiple HPV antigens to provide broad population coverage, i.e. both HLA DR-1-4-7 supermotif-bearing epitopes and HLA DR-3 motif-bearing epitopes are selected for inclusion in the minigene construct. The selected CTL and HTL epitopes are then incorporated into a minigene for expression in an expression vector.
[0366]Such a construct may additionally include sequences that direct the HTL epitopes to the endoplasmic reticulum. For example, the Ii protein may be fused to one or more HTL epitopes as described in co-pending application U.S. Ser. No. 09/311,784 filed May 13, 1999, wherein the CLIP sequence of the Ii protein is removed and replaced with an HLA class II epitope sequence so that HLA class II epitope is directed to the endoplasmic reticulum, where the epitope binds to an HLA class II molecules.
[0367]This example illustrates the methods to be used for construction of a minigene-bearing expression plasmid. Other expression vectors that may be used for minigene compositions are available and known to those of skill in the art.
[0368]The minigene DNA plasmid of this example contains a consensus Kozak sequence and a consensus murine kappa Ig-light chain signal sequence followed by CTL and/or HTL epitopes selected in accordance with principles disclosed herein. The sequence encodes an open reading frame fused to the Myc and H is antibody epitope tag coded for by the pcDNA 3.1 Myc-His vector.
[0369]Overlapping oligonucleotides that can, for example, average about 70 nucleotides in length with 15 nucleotide overlaps, are synthesized and HPLC-purified. The oligonucleotides encode the selected peptide epitopes as well as appropriate linker nucleotides, Kozak sequence, and signal sequence. The final multiepitope minigene is assembled by extending the overlapping oligonucleotides in three sets of reactions using PCR. A Perkin/Elmer 9600 PCR machine is used and a total of 30 cycles are performed using the following conditions: 95° C. for 15 sec, annealing temperature (5° below the lowest calculated Tm of each primer pair) for 30 sec, and 72° C. for 1 min.
[0370]For example, a minigene can be prepared as follows. For a first PCR reaction, 5 μg of each of two oligonucleotides are annealed and extended: In an example using eight oligonucleotides, i.e., four pairs of primers, oligonucleotides 1+2, 3+4, 5+6, and 7+8 are combined in 100 μl reactions containing Pfu polymerase buffer (1×=10 mM KCL, 10 mM (NH4)2SO4, 20 mM Tris-chloride, pH 8.75, 2 mM MgSO4, 0.1% Triton X-100, 100 μg/ml BSA), 0.25 mM each dNTP, and 2.5 U of Pfu polymerase. The full-length dimer products are gel-purified, and two reactions containing the product of 1+2 and 3+4, and the product of 5+6 and 7+8 are mixed, annealed, and extended for 10 cycles. Half of the two reactions are then mixed, and 5 cycles of annealing and extension carried out before flanking primers are added to amplify the full length product. The full-length product is gel-purified and cloned into pCR-blunt (Invitrogen) and individual clones are screened by sequencing.
Example 12
The Plasmid Construct and the Degree to which it Induces Immunogenicity
[0371]The degree to which a plasmid construct, for example a plasmid constructed in accordance with Example 11, is able to induce immunogenicity can be evaluated in vitro by testing for epitope presentation by APC following transduction or transfection of the APC with an epitope-expressing nucleic acid construct. Such a study determines "antigenicity" and allows the use of human APC. The assay determines the ability of the epitope to be presented by the APC in a context that is recognized by a T cell by quantifying the density of epitope-HLA class I complexes on the cell surface. Quantitation can be performed by directly measuring the amount of peptide eluted from the APC (see, e.g., Sijts et al., J. Immunol. 156:683-692, 1996; Demotz et al., Nature 342:682-684, 1989); or the number of peptide-HLA class I complexes can be estimated by measuring the amount of lysis or lymphokine release induced by infected or transfected target cells, and then determining the concentration of peptide necessary to obtained equivalent levels of lysis or lymphokine release (see, e.g., Kageyama et al., J. Immunol. 154:567-576, 1995).
[0372]Alternatively, immunogenicity can be evaluated through in vivo injections into mice and subsequent in vitro assessment of CTL and HTL activity, which are analysed using cytotoxicity and proliferation assays, respectively, as detailed e.g., in copending U.S. Ser. No. 09/311,784 filed May 13, 1999 and Alexander et al., Immunity 1:751-761, 1994.
[0373]For example, to assess the capacity of a DNA minigene construct (e.g., a pMin minigene construct generated as described in U.S. Ser. No. 09/311,784) containing at least one HLA-A2 supermotif peptide to induce CTLs in vivo, HLA-A2.1/Kb transgenic mice, for example, are immunized intramuscularly with 100 μg of naked cDNA. As a means of comparing the level of CTLs induced by cDNA immunization, a control group of animals is also immunized with an actual peptide composition that comprises multiple epitopes synthesized as a single polypeptide as they would be encoded by the minigene.
[0374]Splenocytes from immunized animals are stimulated twice with each of the respective compositions (peptide epitopes encoded in the minigene or the polyepitopic peptide), then assayed for peptide-specific cytotoxic activity in a 51Cr release assay. The results indicate the magnitude of the CTL response directed against the A2-restricted epitope, thus indicating the in vivo immunogenicity of the minigene vaccine and polyepitopic vaccine. It is, therefore, found that the minigene elicits immune responses directed toward the HLA-A2 supermotif peptide epitopes as does the polyepitopic peptide vaccine. A similar analysis is also performed using other HLA-A3 and HLA-B7 transgenic mouse models to assess CTL induction by HLA-A3 and HLA-B7 motif or supermotif epitopes.
[0375]To assess the capacity of a class II epitope encoding minigene to induce HTLs in vivo, DR transgenic mice, or for those epitope that cross react with the appropriate mouse MHC molecule, I-Ab-restricted mice, for example, are immunized intramuscularly with 100 μg of plasmid DNA. As a means of comparing the level of HTLs induced by DNA immunization, a group of control animals is also immunized with an actual peptide composition emulsified in complete Freund's adjuvant. CD4+ T cells, i.e. HTLs, are purified from splenocytes of immunized animals and stimulated with each of the respective compositions (peptides encoded in the minigene). The HTL response is measured using a 3H-thymidine incorporation proliferation assay, (see, e.g., Alexander et al. Immunity 1:751-761, 1994). The results indicate the magnitude of the HTL response, thus demonstrating the in vivo immunogenicity of the minigene.
[0376]DNA minigenes, constructed as described in Example 11, may also be evaluated as a vaccine in combination with a boosting agent using a prime boost protocol. The boosting agent can consist of recombinant protein (e.g., Barnett et al., Aids Res. and Human Retroviruses 14, Supplement 3:S299-S309, 1998) or recombinant vaccinia, for example, expressing a minigene or DNA encoding the complete protein of interest (see, e.g., Hanke et al., Vaccine 16:439-445, 1998; Sedegah et al., Proc. Natl. Acad. Sci. USA 95:7648-53, 1998; Hanke and McMichael, Immunol. Letters 66:177-181, 1999; and Robinson et al., Nature Med. 5:526-34, 1999).
[0377]For example, the efficacy of the DNA minigene used in a prime boost protocol is initially evaluated in transgenic mice. In this example, A2.1/Kb transgenic mice are immunized IM with 100 μg of a DNA minigene encoding the immunogenic peptides including at least one HLA-A2 supermotif-bearing peptide. After an incubation period (ranging from 3-9 weeks), the mice are boosted IP with 107 pfu/mouse of a recombinant vaccinia virus expressing the same sequence encoded by the DNA minigene. Control mice are immunized with 100 μg of DNA or recombinant vaccinia without the minigene sequence, or with DNA encoding the minigene, but without the vaccinia boost. After an additional incubation period of two weeks, splenocytes from the mice are immediately assayed for peptide-specific activity in an ELISPOT assay. Additionally, splenocytes are stimulated in vitro with the A2-restricted peptide epitopes encoded in the minigene and recombinant vaccinia, then assayed for peptide-specific activity in an IFN-quadrature ELISA.
[0378]It is found that the minigene utilized in a prime-boost protocol elicits greater immune responses toward the HLA-A2 supermotif peptides than with DNA alone. Such an analysis can also be performed using HLA-A11 or HLA-B7 transgenic mouse models to assess CTL induction by HLA-A3 or HLA-B7 motif or supermotif epitopes.
[0379]The use of prime boost protocols in humans is described in Example 20.
Example 13
Peptide Composition for Prophylactic Uses
[0380]Vaccine compositions of the present invention can be used to prevent HPV infection in persons who are at risk for such infection. For example, a polyepitopic peptide epitope composition (or a nucleic acid comprising the same) containing multiple CTL and HTL epitopes such as those selected in Examples 9 and/or 10, which are also selected to target greater than 80% of the population, is administered to individuals at risk for HPV infection.
[0381]For example, a peptide-based composition can be provided as a single polypeptide that encompasses multiple epitopes. The vaccine is typically administered in a physiological solution that comprises an adjuvant, such as Incomplete Freunds Adjuvant. The dose of peptide for the initial immunization is from about 1 to about 50,000 μg, generally 100-5,000 μg, for a 70 kg patient. The initial administration of vaccine is followed by booster dosages at 4 weeks followed by evaluation of the magnitude of the immune response in the patient, by techniques that determine the presence of epitope-specific CTL populations in a PBMC sample. Additional booster doses are administered as required. The composition is found to be both safe and efficacious as a prophylaxis against HPV infection.
[0382]Alternatively, a composition typically comprising transfecting agents can be used for the administration of a nucleic acid-based vaccine in accordance with methodologies known in the art and disclosed herein.
Example 14
Polyepitopic Vaccine Compositions Derived from Native HPV Sequences
[0383]A native HPV polyprotein sequence is screened, preferably using computer algorithms defined for each class I and/or class II supermotif or motif, to identify "relatively short" regions of the polyprotein that comprise multiple epitopes and is preferably less in length than an entire native antigen. This relatively short sequence that contains multiple distinct, even overlapping, epitopes is selected and used to generate a minigene construct. The construct is engineered to express the peptide, which corresponds to the native protein sequence. The "relatively short" peptide is generally less than 250 amino acids in length, often less than 100 amino acids in length, preferably less than 75 amino acids in length, and more preferably less than 50 amino acids in length. The protein sequence of the vaccine composition is selected because it has maximal number of epitopes contained within the sequence, i.e., it has a high concentration of epitopes. As noted herein, epitope motifs may be nested or overlapping (i.e., frame shifted relative to one another). For example, with f overlapping epitopes, two 9-mer epitopes and one 10-mer epitope can be present in a 10 amino acid peptide. Such a vaccine composition is administered for therapeutic or prophylactic purposes.
[0384]The vaccine composition will include, for example, three CTL epitopes from at least one HPV target antigen and at least one HTL epitope. This polyepitopic native sequence is administered either as a peptide or as a nucleic acid sequence which encodes the peptide. Alternatively, an analog can be made of this native sequence, whereby one or more of the epitopes comprise substitutions that alter the cross-reactivity and/or binding affinity properties of the polyepitopic peptide.
[0385]The embodiment of this example provides for the possibility that an as yet undiscovered aspect of immune system processing will apply to the native nested sequence and thereby facilitate the production of therapeutic or prophylactic immune response-inducing vaccine compositions. Additionally such an embodiment provides for the possibility of motif-bearing epitopes for an HLA makeup that is presently unknown. Furthermore, this embodiment (absent analogs) directs the immune response to multiple peptide sequences that are actually present in native HPV antigens thus avoiding the need to evaluate any junctional epitopes. Lastly, the embodiment provides an economy of scale when producing nucleic acid vaccine compositions.
[0386]Related to this embodiment, computer programs can be derived in accordance with principles in the art, which identify in a target sequence, the greatest number of epitopes per sequence length.
Example 15
Polyepitopic Vaccine Compositions from Multiple Antigens
[0387]The HPV peptide epitopes of the present invention are used in conjunction with peptide epitopes from other target tumor-associated antigens to create a vaccine composition that is useful for the prevention or treatment of cancer resulting from HPV infection in multiple patients.
[0388]For example, a vaccine composition can be provided as a single polypeptide that incorporates multiple epitopes from HPV antigens as well as tumor-associated antigens that are often expressed with a target cancer, e.g., cervical cancer, associated with HPV infection, or can be administered as a composition comprising one or more discrete epitopes. Alternatively, the vaccine can be administered as a minigene construct or as dendritic cells which have been loaded with the peptide epitopes in vitro.
Example 16
Use of Peptides to Evaluate an Immune Response
[0389]Peptides of the invention may be used to analyze an immune response for the presence of specific CTL or HTL populations directed to HPV. Such an analysis may be performed in a manner as that described by Ogg et al., Science 279:2103-2106, 1998. In the following example, peptides in accordance with the invention are used as a reagent for diagnostic or prognostic purposes, not as an immunogen.
[0390]In this example highly sensitive human leukocyte antigen tetrameric complexes ("tetramers") are used for a cross-sectional analysis of, for example, HPV HLA-A*0201-specific CTL frequencies from HLA A*0201-positive individuals at different stages of infection or following immunization using an HPV peptide containing an A*0201 motif. Tetrameric complexes are synthesized as described (Musey et al., N. Engl. J. Med. 337:1267, 1997). Briefly, purified HLA heavy chain (A*0201 in this example) and β2-microglobulin are synthesized by means of a prokaryotic expression system. The heavy chain is modified by deletion of the transmembrane-cytosolic tail and COOH-terminal addition of a sequence containing a BirA enzymatic biotinylation site. The heavy chain, β2-microglobulin, and peptide are refolded by dilution. The 45-kD refolded product is isolated by fast protein liquid chromatography and then biotinylated by BirA in the presence of biotin (Sigma, St. Louis, Mo.), adenosine 5' triphosphate and magnesium. Streptavidin-phycoerythrin conjugate is added in a 1:4 molar ratio, and the tetrameric product is concentrated to 1 mg/ml. The resulting product is referred to as tetramer-phycoerythrin.
[0391]For the analysis of patient blood samples, approximately one million PBMCs are centrifuged at 300 g for 5 minutes and resuspended in 50 μl of cold phosphate-buffered saline. Tri-color analysis is performed with the tetramer-phycoerythrin, along with anti-CD8-Tricolor, and anti-CD38. The PBMCs are incubated with tetramer and antibodies on ice for 30 to 60 min and then washed twice before formaldehyde fixation. Gates are applied to contain >99.98% of control samples. Controls for the tetramers include both A*0201-negative individuals and A*0201-positive uninfected donors. The percentage of cells stained with the tetramer is then determined by flow cytometry. The results indicate the number of cells in the PBMC sample that contain epitope-restricted CTLs, thereby readily indicating the extent of immune response to the HPV epitope, and thus the stage of infection with HPV, the status of exposure to HPV, or exposure to a vaccine that elicits a protective or therapeutic response.
Example 17
Use of Peptide Epitopes to Evaluate Recall Responses
[0392]The peptide epitopes of the invention are used as reagents to evaluate T cell responses, such as acute or recall responses, in patients. Such an analysis may be performed on patients who have recovered from infection, who are chronically infected with HPV, or who have been vaccinated with an HPV vaccine.
[0393]For example, the class I restricted CTL response of persons who have been vaccinated may be analyzed. The vaccine may be any HPV vaccine. PBMC are collected from vaccinated individuals and HLA typed. Appropriate peptide epitopes of the invention that, optimally, bear supermotifs to provide cross-reactivity with multiple HLA supertype family members, are then used for analysis of samples derived from individuals who bear that HLA type.
[0394]PBMC from vaccinated individuals are separated on Ficoll-Histopaque density gradients (Sigma Chemical Co., St. Louis, Mo.), washed three times in HBSS (GIBCO Laboratories), resuspended in RPMI-1640 (GIBCO Laboratories) supplemented with L-glutamine (2 mM), penicillin (50 U/ml), streptomycin (50 μg/ml), and Hepes (10 mM) containing 10% heat-inactivated human AB serum (complete RPMI) and plated using microculture formats. A synthetic peptide comprising an epitope of the invention is added at 10 μg/ml to each well and HBV core 128-140 epitope is added at 1 μg/ml to each well as a source of T cell help during the first week of stimulation.
[0395]In the microculture format, 4×105 PBMC are stimulated with peptide in 8 replicate cultures in 96-well round bottom plate in 100 μl/well of complete RPMI. On days 3 and 10, 100 ul of complete RPMI and 20 U/ml final concentration of rIL-2 are added to each well. On day 7 the cultures are transferred into a 96-well flat-bottom plate and restimulated with peptide, rIL-2 and 105 irradiated (3,000 rad) autologous feeder cells. The cultures are tested for cytotoxic activity on day 14. A positive CTL response requires two or more of the eight replicate cultures to display greater than 10% specific 51Cr release, based on comparison with uninfected control subjects as previously described (Rehermann, et al., Nature Med. 2:1104, 1108, 1996; Rehermann et al., J. Clin. Invest. 97:1655-1665, 1996; and Rehermann et al. J. Clin. Invest. 98:1432-1440, 1996).
[0396]Target cell lines are autologous and allogeneic EBV-transformed B-LCL that are either purchased from the American Society for Histocompatibility and Immunogenetics (ASHI, Boston, Mass.) or established from the pool of patients as described (Guilhot, et al. J. Virol. 66:2670-2678, 1992).
[0397]Cytotoxicity assays are performed in the following manner. Target cells consist of either allogeneic HLA-matched or autologous EBV-transformed B lymphoblastoid cell line that are incubated overnight with the synthetic peptide epitope of the invention at 10 μM, and labeled with 100 μCi of 51Cr (Amersham Corp., Arlington Heights, Ill.) for 1 hour after which they are washed four times with HBSS.
[0398]Cytolytic activity is determined in a standard 4-h, split well 51Cr release assay using U-bottomed 96 well plates containing 3,000 targets/well. Stimulated PBMC are tested at effector/target (E/T) ratios of 20-50:1 on day 14. Percent cytotoxicity is determined from the formula: 100×[(experimental release-spontaneous release)/maximum release-spontaneous release)]. Maximum release is determined by lysis of targets by detergent (2% Triton X-100; Sigma Chemical Co., St. Louis, Mo.). Spontaneous release is <25% of maximum release for all experiments.
[0399]The results of such an analysis indicate the extent to which HLA-restricted CTL populations have been stimulated by previous exposure to HPV or an HPV vaccine.
[0400]The class II restricted HTL responses may also be analyzed. Purified PBMC are cultured in a 96-well flat bottom plate at a density of 1.5×105 cells/well and are stimulated with 10 μg/ml synthetic peptide, whole antigen, or PHA. Cells are routinely plated in replicates of 4-6 wells for each condition. After seven days of culture, the medium is removed and replaced with fresh medium containing 10 U/ml IL-2. Two days later, 1 μCi 3H-thymidine is added to each well and incubation is continued for an additional 18 hours. Cellular DNA is then harvested on glass fiber mats and analyzed for 3H-thymidine incorporation. Antigen-specific T cell proliferation is calculated as the ratio of 3H-thymidine incorporation in the presence of antigen divided by the 3H-thymidine incorporation in the absence of antigen.
Example 18
Induction of Specific CTL Response in Humans
[0401]A human clinical trial for an immunogenic composition comprising CTL and HTL epitopes of the invention is set up as an IND Phase I, dose escalation study and carried out as a randomized, double-blind, placebo-controlled trial. Such a trial is designed, for example, as follows:
[0402]A total of about 27 individuals are enrolled and divided into 3 groups:
[0403]Group I: 3 subjects are injected with placebo and 6 subjects are injected with 5 μg of peptide composition;
[0404]Group II: 3 subjects are injected with placebo and 6 subjects are injected with 50 μg peptide composition;
[0405]Group III: 3 subjects are injected with placebo and 6 subjects are injected with 500 μg of peptide composition.
[0406]After 4 weeks following the first injection, all subjects receive a booster inoculation at the same dosage.
[0407]The endpoints measured in this study relate to the safety and tolerability of the peptide composition as well as its immunogenicity. Cellular immune responses to the peptide composition are an index of the intrinsic activity of this the peptide composition, and can therefore be viewed as a measure of biological efficacy. The following summarize the clinical and laboratory data that relate to safety and efficacy endpoints.
[0408]Safety: The incidence of adverse events is monitored in the placebo and drug treatment group and assessed in terms of degree and reversibility.
[0409]Evaluation of Vaccine Efficacy: For evaluation of vaccine efficacy, subjects are bled before and after injection. Peripheral blood mononuclear cells are isolated from fresh heparinized blood by Ficoll-Hypaque density gradient centrifugation, aliquoted in freezing media and stored frozen. Samples are assayed for CTL and HTL activity.
[0410]The vaccine is found to be both safe and efficacious.
Example 19
Phase II Trials In Patients Infected With HPV
[0411]Phase II trials are performed to study the effect of administering the CTL-HTL peptide compositions to patients having cancer associated with HPV infection. The main objectives of the trials are to determine an effective dose and regimen for inducing CTLs in HPV-infected patients with cancer, to establish the safety of inducing a CTL and HTL response in these patients, and to see to what extent activation of CTLs improves the clinical picture of chronically infected HPV patients, as manifested by a reduction in viral load, e.g., the reduction and/or shrinking of lesions. Such a study is designed, for example, as follows:
[0412]The studies are performed in multiple centers. The trial design is an open-label, uncontrolled, dose escalation protocol wherein the peptide composition is administered as a single dose followed six weeks later by a single booster shot of the same dose. The dosages are 50, 500 and 5,000 micrograms per injection. Drug-associated adverse effects (severity and reversibility) are recorded.
[0413]There are three patient groupings. The first group is injected with 50 micrograms of the peptide composition and the second and third groups with 500 and 5,000 micrograms of peptide composition, respectively. The patients within each group range in age from 21-65 and represent diverse ethnic backgrounds. All of them are infected with HPV and are HIV, HCV, HBV and delta hepatitis virus (HDV) negative, but are positive for HPV DNA as monitored by PCR.
[0414]Clinical manifestations or antigen-specific T-cell responses are monitored to assess the effects of administering the peptide compositions. The vaccine composition is found to be both safe and efficacious in the treatment of HPV infection.
Example 20
Induction of CTL Responses Using a Prime Boost Protocol
[0415]A prime boost protocol similar in its underlying principle to that used to evaluate the efficacy of a DNA vaccine in transgenic mice, such as described in Example 12, can also be used for the administration of the vaccine to humans. Such a vaccine regimen can include an initial administration of, for example, naked DNA followed by a boost using recombinant virus encoding the vaccine, or recombinant protein/polypeptide or a peptide mixture administered in an adjuvant.
[0416]For example, the initial immunization may be performed using an expression vector, such as that constructed in Example 11, in the form of naked nucleic acid administered IM (or SC or ID) in the amounts of 0.5-5 mg at multiple sites. The nucleic acid (0.1 to 1000 μg) can also be administered using a gene gun. Following an incubation period of 3-4 weeks, a booster dose is then administered. The booster can be recombinant fowlpox virus administered at a dose of 5-107 to 5×109 pfu. An alternative recombinant virus, such as an MVA, canarypox, adenovirus, or adeno-associated virus, can also be used for the booster, or the polyepitopic protein or a mixture of the peptides can be administered. For evaluation of vaccine efficacy, patient blood samples will be obtained before immunization as well as at intervals following administration of the initial vaccine and booster doses of the vaccine. Peripheral blood mononuclear cells are isolated from fresh heparinized blood by Ficoll-Hypaque density gradient centrifugation, aliquoted in freezing media and stored frozen. Samples are assayed for CTL and HTL activity.
[0417]Analysis of the results indicates that a magnitude of response sufficient to achieve protective immunity against HPV is generated.
Example 21
Administration of Vaccine Compositions Using Dendritic Cells (DC)
[0418]Vaccines comprising peptide epitopes of the invention can be administered using APCs, or "professional" APCs such as DC. In this example, the peptide-pulsed DC are administered to a patient to stimulate a CTL response in vivo. In this method, dendritic cells are isolated, expanded, and pulsed with a vaccine comprising peptide CTL and HTL epitopes of the invention. The dendritic cells are infused back into the patient to elicit CTL and HTL responses in vivo. The induced CTL and HTL then destroy or facilitate destruction of the specific target cells that bear the proteins from which the epitopes in the vaccine are derived.
[0419]For example, a cocktail of epitope-bearing peptides is administered ex vivo to PBMC, or isolated DC therefrom. A pharmaceutical to facilitate harvesting of DC can be used, such as Progenipoietinquadrature (Monsanto, St. Louis, Mo.) or GM-CSF/IL-4. After pulsing the DC with peptides and prior to reinfusion into patients, the DC are washed to remove unbound peptides.
[0420]As appreciated clinically, and readily determined by one of skill based on clinical outcomes, the number of DC reinfused into the patient can vary (see, e.g., Nature Med. 4:328, 1998; Nature Med. 2:52, 1996 and Prostate 32:272, 1997). Although 2-50×106 DC per patient are typically administered, larger number of DC, such as 107 or 108 can also be provided. Such cell populations typically contain between 50-90% DC.
[0421]In some embodiments, peptide-loaded PBMC are injected into patients without purification of the DC. For example, PBMC containing DC generated after treatment with an agent such as Progenipoietinquadrature are injected into patients without purification of the DC. The total number of PBMC that are administered often ranges from 108 to 1010. Generally, the cell doses injected into patients is based on the percentage of DC in the blood of each patient, as determined, for example, by immunofluorescence analysis with specific anti-DC antibodies. Thus, for example, if Progenipoietin® mobilizes 2% DC in the peripheral blood of a given patient, and that patient is to receive 5×106 DC, then the patient will be injected with a total of 2.5×108 peptide-loaded PBMC. The percent DC mobilized by an agent such as Progenipoietin® is typically estimated to be between 2-10%, but can vary as appreciated by one of skill in the art.
Ex Vivo Activation of CTL/HTL Responses
[0422]Alternatively, ex vivo CTL or HTL responses to HPV antigens can be induced by incubating in tissue culture the patient's, or genetically compatible, CTL or HTL precursor cells together with a source of APC, such as DC, and the appropriate immunogenic peptides. After an appropriate incubation time (typically about 7-28 days), in which the precursor cells are activated and expanded into effector cells, the cells are infused back into the patient, where they will destroy (CTL) or facilitate destruction (HTL) of their specific target cells, i.e., tumor cells.
Example 22
Alternative Method of Identifying Motif-Bearing Peptides
[0423]Another method of identifying motif-bearing peptides is to elute them from cells bearing defined MHC molecules. For example, EBV transformed B cell lines used for tissue typing have been extensively characterized to determine which HLA molecules they express. In certain cases these cells express only a single type of HLA molecule. These cells can be infected with a pathogenic organism or transfected with nucleic acids that express the antigen of interest, e.g. HPV regulatory or structural proteins. Peptides produced by endogenous antigen processing of peptides produced consequent to infection (or as a result of transfection) will then bind to HLA molecules within the cell and be transported and displayed on the cell surface. Peptides are then eluted from the HLA molecules by exposure to mild acid conditions and their amino acid sequence determined, e.g., by mass spectral analysis (e.g., Kubo et al., J. Immunol. 152:3913, 1994). Because the majority of peptides that bind a particular HLA molecule are motif-bearing, this is an alternative modality for obtaining the motif-bearing peptides correlated with the particular HLA molecule expressed on the cell.
[0424]Alternatively, cell lines that do not express endogenous HLA molecules can be transfected with an expression construct encoding a single HLA allele. These cells can then be used as described, i.e., they can be infected with a pathogen or transfected with nucleic acid encoding an antigen of interest to isolate peptides corresponding to the pathogen or antigen of interest that have been presented on the cell surface. Peptides obtained from such an analysis will bear motif(s) that correspond to binding to the single HLA allele that is expressed in the cell.
[0425]As appreciated by one in the art, one can perform a similar analysis on a cell bearing more than one HLA allele and subsequently determine peptides specific for each HLA allele expressed. Moreover, one of skill would also recognize that means other than infection or transfection, such as loading with a protein antigen, can be used to provide a source of antigen to the cell.
[0426]The above examples are provided to illustrate the invention but not to limit its scope. For example, the human terminology for the Major Histocompatibility Complex, namely HLA, is used throughout this document. It is to be appreciated that these principles can be extended to other species as well. Thus, other variants of the invention will be readily apparent to one of ordinary skill in the art and are encompassed by the appended claims. All publications, patents, and patent application cited herein are hereby incorporated by reference for all purposes.
Sequence CWU
1
88110PRTArtificial SequenceDescription of Artificial Sequencepeptide
epitope HPV 16 protein E1 starting at position 206 1Ala Met Leu Ala Lys
Phe Lys Glu Leu Tyr1 5 102649PRTHuman
papillomavirus type 6a 2Met Ala Asp Asp Ser Gly Thr Glu Asn Glu Gly Ser
Gly Cys Thr Gly1 5 10
15Trp Phe Met Val Glu Ala Ile Val Gln His Pro Thr Gly Thr Gln Ile20
25 30Ser Asp Asp Glu Asp Glu Glu Val Glu Asp
Ser Gly Tyr Asp Met Val35 40 45Asp Phe
Ile Asp Asp Ser Asn Ile Thr His Asn Ser Leu Glu Ala Gln50
55 60Ala Leu Phe Asn Arg Gln Glu Ala Asp Thr His Tyr
Ala Thr Val Gln65 70 75
80Asp Leu Lys Arg Lys Tyr Leu Gly Ser Pro Tyr Val Ser Pro Ile Asn85
90 95Thr Ile Ala Glu Ala Val Glu Ser Glu Ile
Ser Pro Arg Leu Asp Ala100 105 110Ile Lys
Leu Thr Arg Gln Pro Lys Lys Val Lys Arg Arg Leu Phe Gln115
120 125Thr Arg Glu Leu Thr Asp Ser Gly Tyr Gly Tyr Ser
Glu Val Glu Ala130 135 140Gly Thr Gly Thr
Gln Val Glu Lys His Gly Val Pro Glu Asn Gly Gly145 150
155 160Asp Gly Gln Glu Lys Asp Thr Gly Arg
Asp Ile Glu Gly Glu Glu His165 170 175Thr
Glu Ala Glu Ala Pro Thr Asn Ser Val Arg Glu His Ala Gly Thr180
185 190Ala Gly Ile Leu Glu Leu Leu Lys Cys Lys Asp
Leu Arg Ala Ala Leu195 200 205Leu Gly Lys
Phe Lys Glu Cys Phe Gly Leu Ser Phe Ile Asp Leu Ile210
215 220Arg Pro Phe Lys Ser Asp Lys Thr Thr Cys Ala Asp
Trp Val Val Ala225 230 235
240Gly Phe Gly Ile His His Ser Ile Ser Glu Ala Phe Gln Lys Leu Ile245
250 255Glu Pro Leu Ser Leu Tyr Ala His Ile
Gln Trp Leu Thr Asn Ala Trp260 265 270Gly
Met Val Leu Leu Val Leu Val Arg Phe Lys Val Asn Lys Ser Arg275
280 285Ser Thr Val Ala Arg Thr Leu Ala Thr Leu Leu
Asn Ile Pro Asp Asn290 295 300Gln Met Leu
Ile Glu Pro Pro Lys Ile Gln Ser Gly Val Ala Ala Leu305
310 315 320Tyr Trp Phe Arg Thr Gly Ile
Ser Asn Ala Ser Thr Val Ile Gly Glu325 330
335Ala Pro Glu Trp Ile Thr Arg Gln Thr Val Ile Glu His Gly Leu Ala340
345 350Asp Ser Gln Phe Lys Leu Thr Glu Met
Val Gln Trp Ala Tyr Asp Asn355 360 365Asp
Ile Cys Glu Glu Ser Glu Ile Ala Phe Glu Tyr Ala Gln Arg Gly370
375 380Asp Phe Asp Ser Asn Ala Arg Ala Phe Leu Asn
Ser Asn Met Gln Ala385 390 395
400Lys Tyr Val Lys Asp Cys Ala Thr Met Cys Arg His Tyr Lys His
Ala405 410 415Glu Met Arg Lys Met Ser Ile
Lys Gln Trp Ile Lys His Arg Gly Ser420 425
430Lys Ile Glu Gly Thr Gly Asn Trp Lys Pro Ile Val Gln Phe Leu Arg435
440 445His Gln Asn Ile Glu Phe Ile Pro Phe
Leu Ser Lys Phe Lys Leu Trp450 455 460Leu
His Gly Thr Pro Lys Lys Asn Cys Ile Ala Ile Val Gly Pro Pro465
470 475 480Asp Thr Gly Lys Ser Tyr
Phe Cys Met Ser Leu Ile Ser Phe Leu Gly485 490
495Gly Thr Val Ile Ser His Val Asn Ser Ser Ser His Phe Trp Leu
Gln500 505 510Pro Leu Val Asp Ala Lys Val
Ala Leu Leu Asp Asp Ala Thr Gln Pro515 520
525Cys Trp Ile Tyr Met Asp Thr Tyr Met Arg Asn Leu Leu Asp Gly Asn530
535 540Pro Met Ser Ile Asp Arg Lys His Lys
Ala Leu Thr Leu Ile Lys Cys545 550 555
560Pro Pro Leu Leu Val Thr Ser Asn Ile Asp Ile Thr Lys Glu
Glu Lys565 570 575Tyr Lys Tyr Leu His Thr
Arg Val Thr Thr Phe Thr Phe Pro Asn Pro580 585
590Phe Pro Phe Asp Arg Asn Gly Asn Ala Val Tyr Glu Leu Ser Asn
Ala595 600 605Asn Trp Lys Cys Phe Phe Glu
Arg Leu Ser Ser Ser Leu Asp Ile Gln610 615
620Asp Ser Glu Asp Glu Glu Asp Gly Ser Asn Ser Gln Ala Phe Arg Cys625
630 635 640Val Pro Gly Thr
Val Val Arg Thr Leu6453368PRTHuman papillomavirus type 6a 3Met Glu Ala
Ile Ala Lys Arg Leu Asp Ala Cys Gln Glu Gln Leu Leu1 5
10 15Glu Leu Tyr Glu Glu Asn Ser Thr Asp Leu
Asn Lys His Val Leu His20 25 30Trp Lys
Cys Met Arg His Glu Ser Val Leu Leu Tyr Lys Ala Lys Gln35
40 45Met Gly Leu Ser His Ile Gly Met Gln Val Val Pro
Pro Leu Lys Val50 55 60Ser Glu Ala Lys
Gly His Asn Ala Ile Glu Met Gln Met His Leu Glu65 70
75 80Ser Leu Leu Lys Thr Glu Tyr Ser Met
Glu Pro Trp Thr Leu Gln Glu85 90 95Thr
Ser Tyr Glu Met Trp Gln Thr Pro Pro Lys Arg Cys Phe Lys Lys100
105 110Arg Gly Lys Thr Val Glu Val Lys Phe Asp Gly
Cys Ala Asn Asn Thr115 120 125Met Asp Tyr
Val Val Trp Thr Asp Val Tyr Val Gln Asp Thr Asp Ser130
135 140Trp Val Lys Val His Ser Met Val Asp Ala Lys Gly
Ile Tyr Tyr Thr145 150 155
160Cys Gly Gln Phe Lys Thr Tyr Tyr Val Asn Phe Val Lys Glu Ala Glu165
170 175Lys Tyr Gly Ser Thr Lys Gln Trp Glu
Val Cys Tyr Gly Ser Thr Val180 185 190Ile
Cys Ser Pro Ala Ser Val Ser Ser Thr Thr Gln Glu Val Ser Ile195
200 205Pro Glu Ser Thr Thr Tyr Thr Pro Ala Gln Thr
Ser Thr Pro Val Ser210 215 220Ser Ser Thr
Gln Glu Asp Ala Val Gln Thr Pro Pro Arg Lys Arg Ala225
230 235 240Arg Gly Val Gln Gln Ser Pro
Cys Asn Ala Leu Cys Val Ala His Ile245 250
255Gly Pro Val Asp Ser Gly Asn His Asn Leu Ile Thr Asn Asn His Asp260
265 270Gln His Gln Arg Arg Asn Asn Ser Asn
Ser Ser Ala Thr Pro Ile Val275 280 285Gln
Phe Gln Gly Glu Ser Asn Cys Leu Lys Cys Phe Arg Tyr Arg Leu290
295 300Asn Asp Lys His Arg His Leu Phe Asp Leu Ile
Ser Ser Thr Trp His305 310 315
320Trp Ala Ser Pro Lys Ala Pro His Lys His Ala Ile Val Thr Val
Thr325 330 335Tyr His Ser Glu Glu Gln Arg
Gln Gln Phe Leu Asn Val Val Lys Ile340 345
350Pro Pro Thr Ile Arg His Lys Leu Gly Phe Met Ser Leu His Leu Leu355
360 365499PRTHuman papillomavirus type 6a
4Met Ala Ala Gln Leu Tyr Val Leu Leu His Leu Tyr Leu Ala Leu His1
5 10 15Lys Lys Tyr Pro Phe Leu
Asn Leu Leu His Thr Pro Pro His Arg Pro20 25
30Pro Pro Leu Cys Pro Gln Ala Pro Arg Lys Thr Gln Cys Lys Arg Arg35
40 45Leu Glu Asn Glu His Glu Glu Ser Asn
Ser His Leu Ala Thr Pro Cys50 55 60Val
Trp Pro Thr Leu Asp Pro Trp Thr Val Glu Thr Thr Thr Ser Ser65
70 75 80Leu Thr Ile Thr Thr Ser
Thr Lys Glu Gly Thr Thr Val Thr Val Gln85 90
95Leu Arg Leu591PRTHuman papillomavirus type 6a 5Met Glu Val Val Pro
Val Gln Ile Ala Ala Gly Thr Thr Ser Thr Leu1 5
10 15Ile Leu Pro Val Ile Ile Ala Phe Val Val Cys Phe
Val Ser Ile Ile20 25 30Leu Ile Val Trp
Ile Ser Asp Phe Ile Val Tyr Thr Ser Val Leu Val35 40
45Leu Thr Leu Leu Leu Tyr Leu Leu Leu Trp Leu Leu Leu Thr
Thr Pro50 55 60Leu Gln Phe Phe Leu Leu
Thr Leu Leu Val Cys Tyr Cys Pro Ala Leu65 70
75 80Tyr Ile His His Tyr Ile Val Asn Thr Gln Gln85
906150PRTHuman papillomavirus type 6a 6Met Glu Ser Ala
Asn Ala Ser Thr Ser Ala Thr Thr Ile Asp Gln Leu1 5
10 15Cys Lys Thr Phe Asn Leu Ser Met His Thr Leu
Gln Ile Asn Cys Val20 25 30Phe Cys Lys
Asn Ala Leu Thr Thr Ala Glu Ile Tyr Ser Tyr Ala Tyr35 40
45Lys Gln Leu Lys Val Leu Phe Arg Gly Gly Tyr Pro Tyr
Ala Ala Cys50 55 60Ala Cys Cys Leu Glu
Phe His Gly Lys Ile Asn Gln Tyr Arg His Phe65 70
75 80Asp Tyr Ala Gly Tyr Ala Thr Thr Val Glu
Glu Glu Thr Lys Gln Asp85 90 95Ile Leu
Asp Val Leu Ile Arg Cys Tyr Leu Cys His Lys Pro Leu Cys100
105 110Glu Val Glu Lys Val Lys His Ile Leu Thr Lys Ala
Arg Phe Ile Lys115 120 125Leu Asn Cys Thr
Trp Lys Gly Arg Cys Leu His Cys Trp Thr Thr Cys130 135
140Met Glu Asp Met Leu Pro145 150798PRTHuman
papillomavirus type 6a 7Met His Gly Arg His Val Thr Leu Lys Asp Ile Val
Leu Asp Leu Gln1 5 10
15Pro Pro Asp Pro Val Gly Leu His Cys Tyr Glu Gln Leu Val Asp Ser20
25 30Ser Glu Asp Glu Val Asp Glu Val Asp Gly
Gln Asp Ser Gln Pro Leu35 40 45Lys Gln
His Phe Gln Ile Val Thr Cys Cys Cys Gly Cys Asp Ser Asn50
55 60Val Arg Leu Val Val Gln Cys Thr Glu Thr Asp Ile
Arg Glu Val Gln65 70 75
80Gln Leu Leu Leu Gly Thr Leu Asp Ile Val Cys Pro Ile Cys Ala Pro85
90 95Lys Thr8500PRTHuman papillomavirus type
6a 8Met Trp Arg Pro Ser Asp Ser Thr Val Tyr Val Pro Pro Pro Asn Pro1
5 10 15Val Ser Lys Val Val Ala
Thr Asp Ala Tyr Val Thr Arg Thr Asn Ile20 25
30Phe Tyr His Ala Ser Ser Ser Arg Leu Leu Ala Val Gly His Pro Tyr35
40 45Phe Ser Ile Lys Arg Ala Asn Lys Thr
Val Val Pro Lys Val Ser Gly50 55 60Tyr
Gln Tyr Arg Val Phe Lys Val Val Leu Pro Asp Pro Asn Lys Phe65
70 75 80Ala Leu Pro Asp Ser Ser
Leu Phe Asp Pro Thr Thr Gln Arg Leu Val85 90
95Trp Ala Cys Thr Gly Leu Glu Val Gly Arg Gly Gln Pro Leu Gly Val100
105 110Gly Val Ser Gly His Pro Phe Leu
Asn Lys Tyr Asp Asp Val Glu Asn115 120
125Ser Gly Ser Gly Gly Asn Pro Gly Gln Asp Asn Arg Val Asn Val Gly130
135 140Met Asp Tyr Lys Gln Thr Gln Leu Cys
Met Val Gly Cys Ala Pro Pro145 150 155
160Leu Gly Glu His Trp Gly Lys Gly Lys Gln Cys Thr Asn Thr
Pro Val165 170 175Gln Ala Gly Asp Cys Pro
Pro Leu Glu Leu Ile Thr Ser Val Ile Gln180 185
190Asp Gly Asp Met Val Asp Thr Gly Phe Gly Ala Met Asn Phe Ala
Asp195 200 205Leu Gln Thr Asn Lys Ser Asp
Val Pro Ile Asp Ile Cys Gly Thr Thr210 215
220Cys Lys Tyr Pro Asp Tyr Leu Gln Met Ala Ala Asp Pro Tyr Gly Asp225
230 235 240Arg Leu Phe Phe
Phe Leu Arg Lys Glu Gln Met Phe Ala Arg His Phe245 250
255Phe Asn Arg Ala Gly Glu Val Gly Glu Pro Val Pro Asp Thr
Leu Ile260 265 270Ile Lys Gly Ser Gly Asn
Arg Thr Ser Val Gly Ser Ser Ile Tyr Val275 280
285Asn Thr Pro Ser Gly Ser Leu Val Ser Ser Glu Ala Gln Leu Phe
Asn290 295 300Lys Pro Tyr Trp Leu Gln Lys
Ala Gln Gly His Asn Asn Gly Ile Cys305 310
315 320Trp Gly Asn Gln Leu Phe Val Thr Val Val Asp Thr
Thr Arg Ser Thr325 330 335Asn Met Thr Leu
Cys Ala Ser Val Thr Thr Ser Ser Thr Tyr Thr Asn340 345
350Ser Asp Tyr Lys Glu Tyr Met Arg His Val Glu Glu Tyr Asp
Leu Gln355 360 365Phe Ile Phe Gln Leu Cys
Ser Ile Thr Leu Ser Ala Glu Val Met Ala370 375
380Tyr Ile His Thr Met Asn Pro Ser Val Leu Glu Asp Trp Asn Phe
Gly385 390 395 400Leu Ser
Pro Pro Pro Asn Gly Thr Leu Glu Asp Thr Tyr Arg Tyr Val405
410 415Gln Ser Gln Ala Ile Thr Cys Gln Lys Pro Thr Pro
Glu Lys Glu Lys420 425 430Pro Asp Pro Tyr
Lys Asn Leu Ser Phe Trp Glu Val Asn Leu Lys Glu435 440
445Lys Phe Ser Ser Glu Leu Asp Gln Tyr Pro Leu Gly Arg Lys
Phe Leu450 455 460Leu Gln Ser Gly Tyr Arg
Gly Arg Ser Ser Ile Arg Thr Gly Val Lys465 470
475 480Arg Pro Ala Val Ser Lys Ala Ser Ala Ala Pro
Lys Arg Lys Arg Ala485 490 495Lys Thr Lys
Arg5009459PRTHuman papillomavirus type 6a 9Met Ala His Ser Arg Ala Arg
Arg Arg Lys Arg Ala Ser Ala Thr Gln1 5 10
15Leu Tyr Gln Thr Cys Lys Leu Thr Gly Thr Cys Pro Pro Asp
Val Ile20 25 30Pro Lys Val Glu His Asn
Thr Ile Ala Asp Gln Ile Leu Lys Trp Gly35 40
45Ser Leu Gly Val Phe Phe Gly Gly Leu Gly Ile Gly Thr Gly Ser Gly50
55 60Thr Gly Gly Arg Thr Gly Tyr Val Pro
Leu Gly Thr Ser Ala Lys Pro65 70 75
80Ser Ile Thr Ser Gly Pro Met Ala Arg Pro Pro Val Val Val
Glu Pro85 90 95Val Ala Pro Ser Asp Pro
Ser Ile Val Ser Leu Ile Glu Glu Ser Ala100 105
110Ile Ile Asn Ala Gly Ala Pro Glu Ile Val Pro Pro Ala His Gly
Gly115 120 125Phe Thr Ile Thr Ser Ser Glu
Thr Thr Thr Pro Ala Ile Leu Asp Val130 135
140Ser Val Thr Ser His Thr Thr Thr Ser Ile Phe Arg Asn Pro Val Phe145
150 155 160Thr Glu Pro Ser
Val Thr Gln Pro Gln Pro Pro Val Glu Ala Asn Gly165 170
175His Ile Leu Ile Ser Ala Pro Thr Ile Thr Ser His Pro Ile
Glu Glu180 185 190Ile Pro Leu Asp Thr Phe
Val Ile Ser Ser Ser Asp Ser Gly Pro Thr195 200
205Ser Ser Thr Pro Val Pro Gly Thr Ala Pro Arg Pro Arg Val Gly
Leu210 215 220Tyr Ser Arg Ala Leu His Gln
Val Gln Val Thr Asp Pro Ala Phe Leu225 230
235 240Ser Thr Pro Gln Arg Leu Ile Thr Tyr Asp Asn Pro
Val Tyr Glu Gly245 250 255Glu Asp Val Ser
Val Gln Phe Ser His Asp Ser Ile His Asn Ala Pro260 265
270Asp Glu Ala Phe Met Asp Ile Ile Arg Leu His Arg Pro Ala
Ile Ala275 280 285Ser Arg Arg Gly Leu Val
Arg Tyr Ser Arg Ile Gly Gln Arg Gly Ser290 295
300Met His Thr Arg Ser Gly Lys His Ile Gly Ala Arg Ile His Tyr
Phe305 310 315 320Tyr Asp
Ile Ser Pro Ile Ala Gln Ala Ala Glu Glu Ile Glu Met His325
330 335Pro Leu Val Ala Ala Gln Asp Asp Thr Phe Asp Ile
Tyr Ala Glu Ser340 345 350Phe Glu Pro Asp
Ile Asn Pro Thr Gln His Pro Val Thr Asn Ile Ser355 360
365Asp Thr Tyr Leu Thr Ser Thr Pro Asn Thr Val Thr Gln Pro
Trp Gly370 375 380Asn Thr Thr Val Pro Leu
Ser Ser Ile Pro Asn Asp Leu Phe Leu Gln385 390
395 400Ser Gly Pro Asp Ile Thr Phe Pro Thr Ala Pro
Met Gly Thr Pro Phe405 410 415Ser Pro Val
Thr Ala Leu Pro Thr Gly Pro Val Phe Ile Thr Gly Ser420
425 430Gly Phe Tyr Leu His Pro Ala Trp Tyr Phe Ala Arg
Lys Arg Arg Lys435 440 445Arg Ile Pro Leu
Phe Phe Ser Asp Val Ala Ala450 45510649PRTHuman
papillomavirus type 6b 10Met Ala Asp Asp Ser Gly Thr Glu Asn Glu Gly Ser
Gly Cys Thr Gly1 5 10
15Trp Phe Met Val Glu Ala Ile Val Gln His Pro Thr Gly Thr Gln Ile20
25 30Ser Asp Asp Glu Asp Glu Glu Val Glu Asp
Ser Gly Tyr Asp Met Val35 40 45Asp Phe
Ile Asp Asp Ser Asn Ile Thr His Asn Ser Leu Glu Ala Gln50
55 60Ala Leu Phe Asn Arg Gln Glu Ala Asp Thr His Tyr
Ala Thr Val Gln65 70 75
80Asp Leu Lys Arg Lys Tyr Leu Gly Ser Pro Tyr Val Ser Pro Ile Asn85
90 95Thr Ile Ala Glu Ala Val Glu Ser Glu Ile
Ser Pro Arg Leu Asp Ala100 105 110Ile Lys
Leu Thr Arg Gln Pro Lys Lys Val Lys Arg Arg Leu Phe Gln115
120 125Thr Arg Glu Leu Thr Asp Ser Gly Tyr Gly Tyr Ser
Glu Val Glu Ala130 135 140Gly Thr Gly Thr
Gln Val Glu Lys His Gly Val Pro Glu Asn Gly Gly145 150
155 160Asp Gly Gln Glu Lys Asp Thr Gly Arg
Asp Ile Glu Gly Glu Glu His165 170 175Thr
Glu Ala Glu Ala Pro Thr Asn Ser Val Arg Glu His Ala Gly Thr180
185 190Ala Gly Ile Leu Glu Leu Leu Lys Cys Lys Asp
Leu Arg Ala Ala Leu195 200 205Leu Gly Lys
Phe Lys Glu Cys Phe Gly Leu Ser Phe Ile Asp Leu Ile210
215 220Arg Pro Phe Lys Ser Asp Lys Thr Thr Cys Leu Asp
Trp Val Val Ala225 230 235
240Gly Phe Gly Ile His His Ser Ile Ser Glu Ala Phe Gln Lys Leu Ile245
250 255Glu Pro Leu Ser Leu Tyr Ala His Ile
Gln Trp Leu Thr Asn Ala Trp260 265 270Gly
Met Val Leu Leu Val Leu Leu Arg Phe Lys Val Asn Lys Ser Arg275
280 285Ser Thr Val Ala Arg Thr Leu Ala Thr Leu Leu
Asn Ile Pro Glu Asn290 295 300Gln Met Leu
Ile Glu Pro Pro Lys Ile Gln Ser Gly Val Ala Ala Leu305
310 315 320Tyr Trp Phe Arg Thr Gly Ile
Ser Asn Ala Ser Thr Val Ile Gly Glu325 330
335Ala Pro Glu Trp Ile Thr Arg Gln Thr Val Ile Glu His Gly Leu Ala340
345 350Asp Ser Gln Phe Lys Leu Thr Glu Met
Val Gln Trp Ala Tyr Asp Asn355 360 365Asp
Ile Cys Glu Glu Ser Glu Ile Ala Phe Glu Tyr Ala Gln Arg Gly370
375 380Asp Phe Asp Ser Asn Ala Arg Ala Phe Leu Asn
Ser Asn Met Gln Ala385 390 395
400Lys Tyr Val Lys Asp Cys Ala Thr Met Cys Arg His Tyr Lys His
Ala405 410 415Glu Met Arg Lys Met Ser Ile
Lys Gln Trp Ile Lys His Arg Gly Ser420 425
430Lys Ile Glu Gly Thr Gly Asn Trp Lys Pro Ile Val Gln Phe Leu Arg435
440 445His Gln Asn Ile Glu Phe Ile Pro Phe
Leu Thr Lys Phe Lys Leu Trp450 455 460Leu
His Gly Thr Pro Lys Lys Asn Cys Ile Ala Ile Val Gly Pro Pro465
470 475 480Asp Thr Gly Lys Ser Tyr
Phe Cys Met Ser Leu Ile Ser Phe Leu Gly485 490
495Gly Thr Val Ile Ser His Val Asn Ser Ser Ser His Phe Trp Leu
Gln500 505 510Pro Leu Val Asp Ala Lys Val
Ala Leu Leu Asp Asp Ala Thr Gln Pro515 520
525Cys Trp Ile Tyr Met Asp Thr Tyr Met Arg Asn Leu Leu Asp Gly Asn530
535 540Pro Met Ser Ile Asp Arg Lys His Lys
Ala Leu Thr Leu Ile Lys Cys545 550 555
560Pro Pro Leu Leu Val Thr Ser Asn Ile Asp Ile Thr Lys Glu
Asp Lys565 570 575Tyr Lys Tyr Leu His Thr
Arg Val Thr Thr Phe Thr Phe Pro Asn Pro580 585
590Phe Pro Phe Asp Arg Asn Gly Asn Ala Val Tyr Glu Leu Ser Asn
Thr595 600 605Asn Trp Lys Cys Phe Phe Glu
Arg Leu Ser Ser Ser Leu Asp Ile Gln610 615
620Asp Ser Glu Asp Glu Glu Asp Gly Ser Asn Ser Gln Ala Phe Arg Cys625
630 635 640Val Pro Gly Thr
Val Val Arg Thr Leu64511368PRTHuman papillomavirus type 6b 11Met Glu Ala
Ile Ala Lys Arg Leu Asp Ala Cys Gln Glu Gln Leu Leu1 5
10 15Glu Leu Tyr Glu Glu Asn Ser Thr Asp Leu
His Lys His Val Leu His20 25 30Trp Lys
Cys Met Arg His Glu Ser Val Leu Leu Tyr Lys Ala Lys Gln35
40 45Met Gly Leu Ser His Ile Gly Met Gln Val Val Pro
Pro Leu Lys Val50 55 60Ser Glu Ala Lys
Gly His Asn Ala Ile Glu Met Gln Met His Leu Glu65 70
75 80Ser Leu Leu Arg Thr Glu Tyr Ser Met
Glu Pro Trp Thr Leu Gln Glu85 90 95Thr
Ser Tyr Glu Met Trp Gln Thr Pro Pro Lys Arg Cys Phe Lys Lys100
105 110Arg Gly Lys Thr Val Glu Val Lys Phe Asp Gly
Cys Ala Asn Asn Thr115 120 125Met Asp Tyr
Val Val Trp Thr Asp Val Tyr Val Gln Asp Asn Asp Thr130
135 140Trp Val Lys Val His Ser Met Val Asp Ala Lys Gly
Ile Tyr Tyr Thr145 150 155
160Cys Gly Gln Phe Lys Thr Tyr Tyr Val Asn Phe Val Lys Glu Ala Glu165
170 175Lys Tyr Gly Ser Thr Lys His Trp Glu
Val Cys Tyr Gly Ser Thr Val180 185 190Ile
Cys Ser Pro Ala Ser Val Ser Ser Thr Thr Gln Glu Val Ser Ile195
200 205Pro Glu Ser Thr Thr Tyr Thr Pro Ala Gln Thr
Ser Thr Leu Val Ser210 215 220Ser Ser Thr
Lys Glu Asp Ala Val Gln Thr Pro Pro Arg Lys Arg Ala225
230 235 240Arg Gly Val Gln Gln Ser Pro
Cys Asn Ala Leu Cys Val Ala His Ile245 250
255Gly Pro Val Asp Ser Gly Asn His Asn Leu Ile Thr Asn Asn His Asp260
265 270Gln His Gln Arg Arg Asn Asn Ser Asn
Ser Ser Ala Thr Pro Ile Val275 280 285Gln
Phe Gln Gly Glu Ser Asn Cys Leu Lys Cys Phe Arg Tyr Arg Leu290
295 300Asn Asp Arg His Arg His Leu Phe Asp Leu Ile
Ser Ser Thr Trp His305 310 315
320Trp Ala Ser Ser Lys Ala Pro His Lys His Ala Ile Val Thr Val
Thr325 330 335Tyr Asp Ser Glu Glu Gln Arg
Gln Gln Phe Leu Asp Val Val Lys Ile340 345
350Pro Pro Thr Ile Ser His Lys Leu Gly Phe Met Ser Leu His Leu Leu355
360 36512109PRTHuman papillomavirus type 6b
12Met Gly Ala Pro Asn Ile Gly Lys Tyr Val Met Ala Ala Gln Leu Tyr1
5 10 15Val Leu Leu His Leu Tyr
Leu Ala Leu His Lys Lys Tyr Pro Phe Leu20 25
30Asn Leu Leu His Thr Pro Pro His Arg Pro Pro Pro Leu Cys Pro Gln35
40 45Ala Pro Arg Lys Thr Gln Cys Lys Arg
Arg Leu Gly Asn Glu His Glu50 55 60Glu
Ser Asn Ser Pro Leu Ala Thr Pro Cys Val Trp Pro Thr Leu Asp65
70 75 80Pro Trp Thr Val Glu Thr
Thr Thr Ser Ser Leu Thr Ile Thr Thr Ser85 90
95Thr Lys Asp Gly Thr Thr Val Thr Val Gln Leu Arg Leu100
1051391PRTHuman papillomavirus type 6b 13Met Glu Val Val Pro Val Gln
Ile Ala Ala Gly Thr Thr Ser Thr Phe1 5 10
15Ile Leu Pro Val Ile Ile Ala Phe Val Val Cys Phe Val Ser
Ile Ile20 25 30Leu Ile Val Trp Ile Ser
Glu Phe Ile Val Tyr Thr Ser Val Leu Val35 40
45Leu Thr Leu Leu Leu Tyr Leu Leu Leu Trp Leu Leu Leu Thr Thr Pro50
55 60Leu Gln Phe Phe Leu Leu Thr Leu Leu
Val Cys Tyr Cys Pro Ala Leu65 70 75
80Tyr Ile His Tyr Tyr Ile Val Thr Thr Gln Gln85
901472PRTHuman papillomavirus type 6b 14Met Met Leu Thr Cys Gln Phe
Asn Asp Gly Asp Thr Trp Leu Gly Leu1 5 10
15Trp Leu Leu Cys Ala Phe Ile Val Gly Met Leu Gly Leu Leu
Leu Met20 25 30His Tyr Arg Ala Val Gln
Gly Asp Lys His Thr Lys Cys Lys Lys Cys35 40
45Asn Lys His Asn Cys Asn Asp Asp Tyr Val Thr Met His Tyr Thr Thr50
55 60Asp Gly Asp Tyr Ile Tyr Met Asn65
7015150PRTHuman papillomavirus type 6b 15Met Glu Ser Ala
Asn Ala Ser Thr Ser Ala Thr Thr Ile Asp Gln Leu1 5
10 15Cys Lys Thr Phe Asn Leu Ser Met His Thr Leu
Gln Ile Asn Cys Val20 25 30Phe Cys Lys
Asn Ala Leu Thr Thr Ala Glu Ile Tyr Ser Tyr Ala Tyr35 40
45Lys His Leu Lys Val Leu Phe Arg Gly Gly Tyr Pro Tyr
Ala Ala Cys50 55 60Ala Cys Cys Leu Glu
Phe His Gly Lys Ile Asn Gln Tyr Arg His Phe65 70
75 80Asp Tyr Ala Gly Tyr Ala Thr Thr Val Glu
Glu Glu Thr Lys Gln Asp85 90 95Ile Leu
Asp Val Leu Ile Arg Cys Tyr Leu Cys His Lys Pro Leu Cys100
105 110Glu Val Glu Lys Val Lys His Ile Leu Thr Lys Ala
Arg Phe Ile Lys115 120 125Leu Asn Cys Thr
Trp Lys Gly Arg Cys Leu His Cys Trp Thr Thr Cys130 135
140Met Glu Asp Met Leu Pro145
1501698PRTHuman papillomavirus type 6b 16Met His Gly Arg His Val Thr Leu
Lys Asp Ile Val Leu Asp Leu Gln1 5 10
15Pro Pro Asp Pro Val Gly Leu His Cys Tyr Glu Gln Leu Val Asp
Ser20 25 30Ser Glu Asp Glu Val Asp Glu
Val Asp Gly Gln Asp Ser Gln Pro Leu35 40
45Lys Gln His Phe Gln Ile Val Thr Cys Cys Cys Gly Cys Asp Ser Asn50
55 60Val Arg Leu Val Val Gln Cys Thr Glu Thr
Asp Ile Arg Glu Val Gln65 70 75
80Gln Leu Leu Leu Gly Thr Leu Asn Ile Val Cys Pro Ile Cys Ala
Pro85 90 95Lys Thr17500PRTHuman
papillomavirus type 6a 17Met Trp Arg Pro Ser Asp Ser Thr Val Tyr Val Pro
Pro Pro Asn Pro1 5 10
15Val Ser Lys Val Val Ala Thr Asp Ala Tyr Val Thr Arg Thr Asn Ile20
25 30Phe Tyr His Ala Ser Ser Ser Arg Leu Leu
Ala Val Gly His Pro Tyr35 40 45Phe Ser
Ile Lys Arg Ala Asn Lys Thr Val Val Pro Lys Val Ser Gly50
55 60Tyr Gln Tyr Arg Val Phe Lys Val Val Leu Pro Asp
Pro Asn Lys Phe65 70 75
80Ala Leu Pro Asp Ser Ser Leu Phe Asp Pro Thr Thr Gln Arg Leu Val85
90 95Trp Ala Cys Thr Gly Leu Glu Val Gly Arg
Gly Gln Pro Leu Gly Val100 105 110Gly Val
Ser Gly His Pro Phe Leu Asn Lys Tyr Asp Asp Val Glu Asn115
120 125Ser Gly Ser Gly Gly Asn Pro Gly Gln Asp Asn Arg
Val Asn Val Gly130 135 140Met Asp Tyr Lys
Gln Thr Gln Leu Cys Met Val Gly Cys Ala Pro Pro145 150
155 160Leu Gly Glu His Trp Gly Lys Gly Lys
Gln Cys Thr Asn Thr Pro Val165 170 175Gln
Ala Gly Asp Cys Pro Pro Leu Glu Leu Ile Thr Ser Val Ile Gln180
185 190Asp Gly Asp Met Val Asp Thr Gly Phe Gly Ala
Met Asn Phe Ala Asp195 200 205Leu Gln Thr
Asn Lys Ser Asp Val Pro Ile Asp Ile Cys Gly Thr Thr210
215 220Cys Lys Tyr Pro Asp Tyr Leu Gln Met Ala Ala Asp
Pro Tyr Gly Asp225 230 235
240Arg Leu Phe Phe Phe Leu Arg Lys Glu Gln Met Phe Ala Arg His Phe245
250 255Phe Asn Arg Ala Gly Glu Val Gly Glu
Pro Val Pro Asp Thr Leu Ile260 265 270Ile
Lys Gly Ser Gly Asn Arg Thr Ser Val Gly Ser Ser Ile Tyr Val275
280 285Asn Thr Pro Ser Gly Ser Leu Val Ser Ser Glu
Ala Gln Leu Phe Asn290 295 300Lys Pro Tyr
Trp Leu Gln Lys Ala Gln Gly His Asn Asn Gly Ile Cys305
310 315 320Trp Gly Asn Gln Leu Phe Val
Thr Val Val Asp Thr Thr Arg Ser Thr325 330
335Asn Met Thr Leu Cys Ala Ser Val Thr Thr Ser Ser Thr Tyr Thr Asn340
345 350Ser Asp Tyr Lys Glu Tyr Met Arg His
Val Glu Glu Tyr Asp Leu Gln355 360 365Phe
Ile Phe Gln Leu Cys Ser Ile Thr Leu Ser Ala Glu Val Met Ala370
375 380Tyr Ile His Thr Met Asn Pro Ser Val Leu Glu
Asp Trp Asn Phe Gly385 390 395
400Leu Ser Pro Pro Pro Asn Gly Thr Leu Glu Asp Thr Tyr Arg Tyr
Val405 410 415Gln Ser Gln Ala Ile Thr Cys
Gln Lys Pro Thr Pro Glu Lys Glu Lys420 425
430Pro Asp Pro Tyr Lys Asn Leu Ser Phe Trp Glu Val Asn Leu Lys Glu435
440 445Lys Phe Ser Ser Glu Leu Asp Gln Tyr
Pro Leu Gly Arg Lys Phe Leu450 455 460Leu
Gln Ser Gly Tyr Arg Gly Arg Ser Ser Ile Arg Thr Gly Val Lys465
470 475 480Arg Pro Ala Val Ser Lys
Ala Ser Ala Ala Pro Lys Arg Lys Arg Ala485 490
495Lys Thr Lys Arg50018459PRTHuman papillomavirus type 6b 18Met Ala
His Ser Arg Ala Arg Arg Arg Lys Arg Ala Ser Ala Thr Gln1 5
10 15Leu Tyr Gln Thr Cys Lys Leu Thr Gly
Thr Cys Pro Pro Asp Val Ile20 25 30Pro
Lys Val Glu His Asn Thr Ile Ala Asp Gln Ile Leu Lys Trp Gly35
40 45Ser Leu Gly Val Phe Phe Gly Gly Leu Gly Ile
Gly Thr Gly Ser Gly50 55 60Thr Gly Gly
Arg Thr Gly Tyr Val Pro Leu Gln Thr Ser Ala Lys Pro65 70
75 80Ser Ile Thr Ser Gly Pro Met Ala
Arg Pro Pro Val Val Val Glu Pro85 90
95Val Ala Pro Ser Asp Pro Ser Ile Val Ser Leu Ile Glu Glu Ser Ala100
105 110Ile Ile Asn Ala Gly Ala Pro Glu Ile Val
Pro Pro Ala His Gly Gly115 120 125Phe Thr
Ile Thr Ser Ser Glu Thr Thr Thr Pro Ala Ile Leu Asp Val130
135 140Ser Val Thr Ser His Thr Thr Thr Ser Ile Phe Arg
Asn Pro Val Phe145 150 155
160Thr Glu Pro Ser Val Thr Gln Pro Gln Pro Pro Val Glu Ala Asn Gly165
170 175His Ile Leu Ile Ser Ala Pro Thr Val
Thr Ser His Pro Ile Glu Glu180 185 190Ile
Pro Leu Asp Thr Phe Val Val Ser Ser Ser Asp Ser Gly Pro Thr195
200 205Ser Ser Thr Pro Val Pro Gly Thr Ala Pro Arg
Pro Arg Val Gly Leu210 215 220Tyr Ser Arg
Ala Leu His Gln Val Gln Val Thr Asp Pro Ala Phe Leu225
230 235 240Ser Thr Pro Gln Arg Leu Ile
Thr Tyr Asp Asn Pro Val Tyr Glu Gly245 250
255Glu Asp Val Ser Val Gln Phe Ser His Asp Ser Ile His Asn Ala Pro260
265 270Asp Glu Ala Phe Met Asp Ile Ile Arg
Leu His Arg Pro Ala Ile Ala275 280 285Ser
Arg Arg Gly Leu Val Arg Tyr Ser Arg Ile Gly Gln Arg Gly Ser290
295 300Met His Thr Arg Ser Gly Lys His Ile Gly Ala
Arg Ile His Tyr Phe305 310 315
320Tyr Asp Ile Ser Pro Ile Ala Gln Ala Ala Glu Glu Ile Glu Met
His325 330 335Pro Leu Val Ala Ala Gln Asp
Asp Thr Phe Asp Ile Tyr Ala Glu Ser340 345
350Phe Glu Pro Gly Ile Asn Pro Thr Gln His Pro Val Thr Asn Ile Ser355
360 365Asp Thr Tyr Leu Thr Ser Thr Pro Asn
Thr Val Thr Gln Pro Trp Gly370 375 380Asn
Thr Thr Val Pro Leu Ser Leu Pro Asn Asp Leu Phe Leu Gln Ser385
390 395 400Gly Pro Asp Ile Thr Phe
Pro Thr Ala Pro Met Gly Thr Pro Phe Ser405 410
415Pro Val Thr Pro Ala Leu Pro Thr Gly Pro Val Phe Ile Thr Gly
Ser420 425 430Gly Phe Tyr Leu His Pro Ala
Trp Tyr Phe Ala Arg Lys Arg Arg Lys435 440
445Arg Ile Pro Leu Phe Phe Ser Asp Val Ala Ala450
45519649PRTHuman papillomavirus type 11 19Met Ala Asp Asp Ser Gly Thr Glu
Asn Glu Gly Ser Gly Cys Thr Gly1 5 10
15Trp Phe Met Val Glu Ala Ile Val Glu His Thr Thr Gly Thr Gln
Ile20 25 30Ser Glu Asp Glu Glu Glu Glu
Val Glu Asp Ser Gly Tyr Asp Met Val35 40
45Asp Phe Ile Asp Asp Arg His Ile Thr Gln Asn Ser Val Glu Ala Gln50
55 60Ala Leu Phe Asn Arg Gln Glu Ala Asp Ala
His Tyr Ala Thr Val Gln65 70 75
80Asp Leu Lys Arg Lys Tyr Leu Gly Ser Pro Tyr Val Ser Pro Ile
Ser85 90 95Asn Val Ala Asn Ala Val Glu
Ser Glu Ile Ser Pro Arg Leu Asp Ala100 105
110Ile Lys Leu Thr Thr Gln Pro Lys Lys Val Lys Arg Arg Leu Phe Glu115
120 125Thr Arg Glu Leu Thr Asp Ser Gly Tyr
Gly Tyr Ser Glu Val Glu Ala130 135 140Ala
Thr Gln Val Glu Lys His Gly Asp Pro Glu Asn Gly Gly Asp Gly145
150 155 160Gln Glu Arg Asp Thr Gly
Arg Asp Ile Glu Gly Glu Gly Val Glu His165 170
175Arg Glu Ala Glu Ala Val Asp Asp Ser Thr Arg Glu His Ala Asp
Thr180 185 190Ser Gly Ile Leu Glu Leu Leu
Lys Cys Lys Asp Ile Arg Ser Thr Leu195 200
205His Gly Lys Phe Lys Asp Cys Phe Gly Leu Ser Phe Val Asp Leu Ile210
215 220Arg Pro Phe Lys Ser Asp Arg Thr Thr
Cys Ala Asp Trp Val Val Ala225 230 235
240Gly Phe Gly Ile His His Ser Ile Ala Asp Ala Phe Gln Lys
Leu Ile245 250 255Glu Pro Leu Ser Leu Tyr
Ala His Ile Gln Trp Leu Thr Asn Ala Trp260 265
270Gly Met Val Leu Leu Val Leu Ile Arg Phe Lys Val Asn Lys Ser
Arg275 280 285Cys Thr Val Ala Arg Thr Leu
Gly Thr Leu Leu Asn Ile Pro Glu Asn290 295
300His Met Leu Ile Glu Pro Pro Lys Ile Gln Ser Gly Val Arg Ala Leu305
310 315 320Tyr Trp Phe Arg
Thr Gly Ile Ser Asn Ala Ser Thr Val Ile Gly Glu325 330
335Ala Pro Glu Trp Ile Thr Arg Gln Thr Val Ile Glu His Ser
Leu Ala340 345 350Asp Ser Gln Phe Lys Leu
Thr Glu Met Val Gln Trp Ala Tyr Asp Asn355 360
365Asp Ile Cys Glu Glu Ser Glu Ile Ala Phe Glu Tyr Ala Gln Arg
Gly370 375 380Asp Phe Asp Ser Asn Ala Arg
Ala Phe Leu Asn Ser Asn Met Gln Ala385 390
395 400Lys Tyr Val Lys Asp Cys Ala Ile Met Cys Arg His
Tyr Lys His Ala405 410 415Glu Met Lys Lys
Met Ser Ile Lys Gln Trp Ile Lys Tyr Arg Gly Thr420 425
430Lys Val Asp Ser Val Gly Asn Trp Lys Pro Ile Val Gln Phe
Leu Arg435 440 445His Gln Asn Ile Glu Phe
Ile Pro Phe Leu Ser Lys Leu Lys Leu Trp450 455
460Leu His Gly Thr Pro Lys Lys Asn Cys Ile Ala Ile Val Gly Pro
Pro465 470 475 480Asp Thr
Gly Lys Ser Cys Phe Cys Met Ser Leu Ile Lys Phe Leu Gly485
490 495Gly Thr Val Ile Ser Tyr Val Asn Ser Cys Ser His
Phe Trp Leu Gln500 505 510Pro Leu Thr Asp
Ala Lys Val Ala Leu Leu Asp Asp Ala Thr Gln Pro515 520
525Cys Trp Thr Tyr Met Asp Thr Tyr Met Arg Asn Leu Leu Asp
Gly Asn530 535 540Pro Met Ser Ile Asp Arg
Lys His Arg Ala Leu Thr Leu Ile Lys Cys545 550
555 560Pro Pro Leu Leu Val Thr Ser Asn Ile Asp Ile
Ser Lys Glu Glu Lys565 570 575Tyr Lys Tyr
Leu His Ser Arg Val Thr Thr Phe Thr Phe Pro Asn Pro580
585 590Phe Pro Phe Asp Arg Asn Gly Asn Ala Val Tyr Glu
Leu Ser Asp Ala595 600 605Asn Trp Lys Cys
Phe Phe Glu Arg Leu Ser Ser Ser Leu Asp Ile Glu610 615
620Asp Ser Glu Asp Glu Glu Asp Gly Ser Asn Ser Gln Ala Phe
Arg Cys625 630 635 640Val
Pro Gly Ser Val Val Arg Thr Leu64520367PRTHuman papillomavirus type 11
20Met Glu Ala Ile Ala Lys Arg Leu Asp Ala Cys Gln Asp Gln Leu Leu1
5 10 15Glu Leu Tyr Glu Glu Asn
Ser Ile Asp Ile His Lys His Ile Met His20 25
30Trp Lys Cys Ile Arg Leu Glu Ser Val Leu Leu His Lys Ala Lys Gln35
40 45Met Gly Leu Ser His Ile Gly Leu Gln
Val Val Pro Pro Leu Thr Val50 55 60Ser
Glu Thr Lys Gly His Asn Ala Ile Glu Met Gln Met His Leu Glu65
70 75 80Ser Leu Ala Lys Thr Gln
Tyr Gly Val Glu Pro Trp Thr Leu Gln Asp85 90
95Thr Ser Tyr Glu Met Trp Leu Thr Pro Pro Lys Arg Cys Phe Lys Lys100
105 110Gln Gly Asn Thr Val Glu Val Lys
Phe Asp Gly Cys Glu Asp Asn Val115 120
125Met Glu Tyr Val Val Trp Thr His Ile Tyr Leu Gln Asp Asn Asp Ser130
135 140Trp Val Lys Val Thr Ser Ser Val Asp
Ala Lys Gly Ile Tyr Tyr Thr145 150 155
160Cys Gly Gln Phe Lys Thr Tyr Tyr Val Asn Phe Asn Lys Glu
Ala Gln165 170 175Lys Tyr Gly Ser Thr Asn
His Trp Glu Val Cys Tyr Gly Ser Thr Val180 185
190Ile Cys Ser Pro Ala Ser Val Ser Ser Thr Val Arg Glu Val Ser
Ile195 200 205Ala Glu Pro Thr Thr Tyr Thr
Pro Ala Gln Thr Thr Ala Pro Thr Val210 215
220Ser Ala Cys Thr Thr Glu Asp Gly Val Ser Ala Pro Pro Arg Lys Arg225
230 235 240Ala Arg Gly Pro
Ser Thr Asn Asn Thr Leu Cys Val Ala Asn Ile Arg245 250
255Ser Val Asp Ser Thr Ile Asn Asn Ile Val Thr Asp Asn Tyr
Asn Lys260 265 270His Gln Arg Arg Asn Asn
Cys His Ser Ala Ala Thr Pro Ile Val Gln275 280
285Leu Gln Gly Asp Ser Asn Cys Leu Lys Cys Phe Arg Tyr Arg Leu
Asn290 295 300Asp Lys Tyr Lys His Leu Phe
Glu Leu Ala Ser Ser Thr Trp His Trp305 310
315 320Ala Ser Pro Glu Ala Pro His Lys Asn Ala Ile Val
Thr Leu Thr Tyr325 330 335Ser Ser Glu Glu
Gln Arg Gln Gln Phe Leu Asn Ser Val Lys Ile Pro340 345
350Pro Thr Ile Arg His Lys Val Gly Phe Met Ser Leu His Leu
Leu355 360 36521108PRTHuman
papillomavirus type 11 21Met Val Val Pro Ile Ile Gly Lys Tyr Val Met Ala
Ala Gln Leu Tyr1 5 10
15Val Leu Leu His Leu Tyr Leu Ala Leu Tyr Glu Lys Tyr Pro Leu Leu20
25 30Asn Leu Leu His Thr Pro Pro His Arg Pro
Pro Pro Leu Gln Cys Pro35 40 45Pro Ala
Pro Arg Lys Thr Ala Cys Arg Arg Arg Leu Gly Ser Glu His50
55 60Val Asp Arg Pro Leu Thr Thr Pro Cys Val Trp Pro
Thr Ser Asp Pro65 70 75
80Trp Thr Val Gln Ser Thr Thr Ser Ser Leu Thr Ile Thr Thr Ser Thr85
90 95Lys Glu Gly Thr Thr Val Thr Val Gln Leu
Arg Leu100 1052291PRTHuman papillomavirus type 11 22Met
Glu Val Val Pro Val Gln Ile Ala Ala Ala Thr Thr Thr Thr Leu1
5 10 15Ile Leu Pro Val Val Ile Ala Phe
Ala Val Cys Ile Leu Ser Ile Val20 25
30Leu Ile Ile Leu Ile Ser Asp Phe Val Val Tyr Thr Ser Val Leu Val35
40 45Leu Thr Leu Leu Leu Tyr Leu Leu Leu Trp
Leu Leu Leu Thr Thr Pro50 55 60Leu Gln
Phe Phe Leu Leu Thr Leu Cys Val Cys Tyr Phe Pro Ala Phe65
70 75 80Tyr Ile His Ile Tyr Ile Val
Gln Thr Gln Gln85 902374PRTHuman papillomavirus type 11
23Met Val Met Leu Thr Cys His Leu Asn Asp Gly Asp Thr Trp Leu Phe1
5 10 15Leu Trp Leu Phe Thr Ala
Phe Val Val Ala Val Leu Gly Leu Leu Leu20 25
30Leu His Tyr Arg Ala Val His Gly Thr Glu Lys Thr Lys Cys Ala Lys35
40 45Cys Lys Ser Asn Arg Asn Thr Thr Val
Asp Tyr Val Tyr Met Ser His50 55 60Gly
Asp Asn Gly Asp Tyr Val Tyr Met Asn65 7024150PRTHuman
papillomavirus type 11 24Met Glu Ser Lys Asp Ala Ser Thr Ser Ala Thr Ser
Ile Asp Gln Leu1 5 10
15Cys Lys Thr Phe Asn Leu Ser Leu His Thr Leu Gln Ile Gln Cys Val20
25 30Phe Cys Arg Asn Ala Leu Thr Thr Ala Glu
Ile Tyr Ala Tyr Ala Tyr35 40 45Lys Asn
Leu Lys Val Val Trp Arg Asp Asn Phe Pro Phe Ala Ala Cys50
55 60Ala Cys Cys Leu Glu Leu Gln Gly Lys Ile Asn Gln
Tyr Arg His Phe65 70 75
80Asn Tyr Ala Ala Tyr Ala Pro Thr Val Glu Glu Glu Thr Asn Glu Asp85
90 95Ile Leu Lys Val Leu Ile Arg Cys Tyr Leu
Cys His Lys Pro Leu Cys100 105 110Glu Ile
Glu Lys Leu Lys His Ile Leu Gly Lys Ala Arg Phe Ile Lys115
120 125Leu Asn Asn Gln Trp Lys Gly Arg Cys Leu His Cys
Trp Thr Thr Cys130 135 140Met Glu Asp Leu
Leu Pro145 1502598PRTHuman papillomavirus type 11 25Met
His Gly Arg Leu Val Thr Leu Lys Asp Ile Val Leu Asp Leu Gln1
5 10 15Pro Pro Asp Pro Val Gly Leu His
Cys Tyr Glu Gln Leu Glu Asp Ser20 25
30Ser Glu Asp Glu Val Asp Lys Val Asp Lys Gln Asp Ala Gln Pro Leu35
40 45Thr Gln His Tyr Gln Ile Leu Thr Cys Cys
Cys Gly Cys Asp Ser Asn50 55 60Val Arg
Leu Val Val Glu Cys Thr Asp Gly Asp Ile Arg Gln Leu Gln65
70 75 80Asp Leu Leu Leu Gly Thr Leu
Asn Ile Val Cys Pro Ile Cys Ala Pro85 90
95Lys Pro26501PRTHuman papillomavirus type 11 26Met Trp Arg Pro Ser Asp
Ser Thr Val Tyr Val Pro Pro Pro Asn Pro1 5
10 15Val Ser Lys Val Val Ala Thr Asp Ala Tyr Val Lys Arg
Thr Asn Ile20 25 30Phe Tyr His Ala Ser
Ser Ser Arg Leu Leu Ala Val Gly His Pro Tyr35 40
45Tyr Ser Ile Lys Lys Val Asn Lys Thr Val Val Pro Lys Val Ser
Gly50 55 60Tyr Gln Tyr Arg Val Phe Lys
Val Val Leu Pro Asp Pro Asn Lys Phe65 70
75 80Ala Leu Pro Asp Ser Ser Leu Phe Asp Pro Thr Thr
Gln Arg Leu Val85 90 95Trp Ala Cys Thr
Gly Leu Glu Val Gly Arg Gly Gln Pro Leu Gly Val100 105
110Gly Val Ser Gly His Pro Leu Leu Asn Lys Tyr Asp Asp Val
Glu Asn115 120 125Ser Gly Gly Tyr Gly Gly
Asn Pro Gly Gln Asp Asn Arg Val Asn Val130 135
140Gly Met Asp Tyr Lys Gln Thr Gln Leu Cys Met Val Gly Cys Ala
Pro145 150 155 160Pro Leu
Gly Glu His Trp Gly Lys Gly Thr Gln Cys Ser Asn Thr Ser165
170 175Val Gln Asn Gly Asp Cys Pro Pro Leu Glu Leu Ile
Thr Ser Val Ile180 185 190Gln Asp Gly Asp
Met Val Asp Thr Gly Phe Gly Ala Met Asn Phe Ala195 200
205Asp Leu Gln Thr Asn Lys Ser Asp Val Pro Leu Asp Ile Cys
Gly Thr210 215 220Val Cys Lys Tyr Pro Asp
Tyr Leu Gln Met Ala Ala Asp Pro Tyr Gly225 230
235 240Asp Arg Leu Phe Phe Tyr Leu Arg Lys Glu Gln
Met Phe Ala Arg His245 250 255Phe Phe Asn
Arg Ala Gly Thr Val Gly Glu Pro Val Pro Asp Asp Leu260
265 270Leu Val Lys Gly Gly Asn Asn Arg Ser Ser Val Ala
Ser Ser Ile Tyr275 280 285Val His Thr Pro
Ser Gly Ser Leu Val Ser Ser Glu Ala Gln Leu Phe290 295
300Asn Lys Pro Tyr Trp Leu Gln Lys Ala Gln Gly His Asn Asn
Gly Ile305 310 315 320Cys
Trp Gly Asn His Leu Phe Val Thr Val Val Asp Thr Thr Arg Ser325
330 335Thr Asn Met Thr Leu Cys Ala Ser Val Ser Lys
Ser Ala Thr Tyr Thr340 345 350Asn Ser Asp
Tyr Lys Glu Tyr Met Arg His Val Glu Glu Phe Asp Leu355
360 365Gln Phe Ile Phe Gln Leu Cys Ser Ile Thr Leu Ser
Ala Glu Val Met370 375 380Ala Tyr Ile His
Thr Met Asn Pro Ser Val Leu Glu Asp Trp Asn Phe385 390
395 400Gly Leu Ser Pro Pro Pro Asn Gly Thr
Leu Glu Asp Thr Tyr Arg Tyr405 410 415Val
Gln Ser Gln Ala Ile Thr Cys Gln Lys Pro Thr Pro Glu Lys Glu420
425 430Lys Gln Asp Pro Tyr Lys Asp Met Ser Phe Trp
Glu Val Asn Leu Lys435 440 445Glu Lys Phe
Ser Ser Glu Leu Asp Gln Phe Pro Leu Gly Arg Lys Phe450
455 460Leu Leu Gln Ser Gly Tyr Arg Gly Arg Thr Ser Ala
Arg Thr Gly Ile465 470 475
480Lys Arg Pro Ala Val Ser Lys Pro Ser Thr Ala Pro Lys Arg Lys Arg485
490 495Thr Lys Thr Lys Lys50027455PRTHuman
papillomavirus type 11 27Met Lys Pro Arg Ala Arg Arg Arg Lys Arg Ala Ser
Ala Thr Gln Leu1 5 10
15Tyr Gln Thr Cys Lys Ala Thr Gly Thr Cys Pro Pro Asp Val Ile Pro20
25 30Lys Val Glu His Thr Thr Ile Ala Asp Gln
Ile Leu Lys Trp Gly Ser35 40 45Leu Gly
Val Phe Phe Gly Gly Leu Gly Ile Gly Thr Gly Ala Gly Ser50
55 60Gly Gly Arg Ala Gly Tyr Ile Pro Leu Gly Ser Ser
Pro Lys Pro Ala65 70 75
80Ile Thr Gly Gly Pro Ala Ala Arg Pro Pro Val Leu Val Glu Pro Val85
90 95Ala Pro Ser Asp Pro Ser Ile Val Ser Leu
Ile Glu Glu Ser Ala Ile100 105 110Ile Asn
Ala Gly Ala Pro Glu Val Val Pro Pro Thr Gln Gly Gly Phe115
120 125Thr Ile Thr Ser Ser Glu Ser Thr Thr Pro Ala Ile
Leu Asp Val Ser130 135 140Val Thr Asn His
Thr Thr Thr Ser Val Phe Gln Asn Pro Leu Phe Thr145 150
155 160Glu Pro Ser Val Ile Gln Pro Gln Pro
Pro Val Glu Ala Ser Gly His165 170 175Ile
Leu Ile Ser Ala Pro Thr Ile Thr Ser Gln His Val Glu Asp Ile180
185 190Pro Leu Asp Thr Phe Val Val Ser Ser Ser Asp
Ser Gly Pro Thr Ser195 200 205Ser Thr Pro
Leu Pro Arg Ala Phe Pro Arg Pro Arg Val Gly Leu Tyr210
215 220Ser Arg Ala Leu Gln Gln Val Gln Val Thr Asp Pro
Ala Phe Leu Ser225 230 235
240Thr Pro Gln Arg Leu Val Thr Tyr Asp Asn Pro Val Tyr Glu Gly Glu245
250 255Asp Val Ser Leu Gln Phe Thr His Glu
Ser Ile His Asn Ala Pro Asp260 265 270Glu
Ala Phe Met Asp Ile Ile Arg Leu His Arg Pro Ala Ile Thr Ser275
280 285Arg Arg Gly Leu Val Arg Phe Ser Arg Ile Gly
Gln Arg Gly Ser Met290 295 300Tyr Thr Arg
Ser Gly Gln His Ile Gly Ala Arg Ile His Tyr Phe Gln305
310 315 320Asp Ile Ser Pro Val Thr Gln
Ala Ala Glu Glu Ile Glu Leu His Pro325 330
335Leu Val Ala Ala Glu Asn Asp Thr Phe Asp Ile Tyr Ala Glu Pro Phe340
345 350Asp Pro Ile Pro Asp Pro Val Gln His
Ser Val Thr Gln Ser Tyr Leu355 360 365Thr
Ser Thr Pro Asn Thr Leu Ser Gln Ser Trp Gly Asn Thr Thr Val370
375 380Pro Leu Ser Ile Pro Ser Asp Trp Phe Val Gln
Ser Gly Pro Asp Ile385 390 395
400Thr Phe Pro Thr Ala Ser Met Gly Thr Pro Phe Ser Pro Val Thr
Pro405 410 415Ala Leu Pro Thr Gly Pro Val
Phe Ile Thr Gly Ser Asp Phe Tyr Leu420 425
430His Pro Thr Trp Tyr Phe Ala Arg Arg Arg Arg Lys Arg Ile Pro Leu435
440 445Phe Phe Thr Asp Val Ala Ala450
45528649PRTHuman papillomavirus type 16 28Met Ala Asp Pro Ala
Gly Thr Asn Gly Glu Glu Gly Thr Gly Cys Asn1 5
10 15Gly Trp Phe Tyr Val Glu Ala Val Val Glu Lys Lys
Thr Gly Asp Ala20 25 30Ile Ser Asp Asp
Glu Asn Glu Asn Asp Ser Asp Thr Gly Glu Asp Leu35 40
45Val Asp Phe Ile Val Asn Asp Asn Asp Tyr Leu Thr Gln Ala
Glu Thr50 55 60Glu Thr Ala His Ala Leu
Phe Thr Ala Gln Glu Ala Lys Gln His Arg65 70
75 80Asp Ala Val Gln Val Leu Lys Arg Lys Tyr Leu
Val Ser Pro Leu Ser85 90 95Asp Ile Ser
Gly Cys Val Asp Asn Asn Ile Ser Pro Arg Leu Lys Ala100
105 110Ile Cys Ile Glu Lys Gln Ser Arg Ala Ala Lys Arg
Arg Leu Phe Glu115 120 125Ser Glu Asp Ser
Gly Tyr Gly Asn Thr Glu Val Glu Thr Gln Gln Met130 135
140Leu Gln Val Glu Gly Arg His Glu Thr Glu Thr Pro Cys Ser
Gln Tyr145 150 155 160Ser
Gly Gly Ser Gly Gly Gly Cys Ser Gln Tyr Ser Ser Gly Ser Gly165
170 175Gly Glu Gly Val Ser Glu Arg His Thr Ile Cys
Gln Thr Pro Leu Thr180 185 190Asn Ile Leu
Asn Val Leu Lys Thr Ser Asn Ala Lys Ala Ala Met Leu195
200 205Ala Lys Phe Lys Glu Leu Tyr Gly Val Ser Phe Ser
Glu Leu Val Arg210 215 220Pro Phe Lys Ser
Asn Lys Ser Thr Cys Cys Asp Trp Cys Ile Ala Ala225 230
235 240Phe Gly Leu Thr Pro Ser Ile Ala Asp
Ser Ile Lys Thr Leu Leu Gln245 250 255Gln
Tyr Cys Leu Tyr Leu His Ile Gln Ser Leu Ala Cys Ser Trp Gly260
265 270Met Val Val Leu Leu Leu Val Arg Tyr Lys Cys
Gly Lys Asn Arg Glu275 280 285Thr Ile Glu
Lys Leu Leu Ser Lys Leu Leu Cys Val Ser Pro Met Cys290
295 300Met Met Ile Glu Pro Pro Lys Leu Arg Ser Thr Ala
Ala Ala Leu Tyr305 310 315
320Trp Tyr Lys Thr Gly Ile Ser Asn Ile Ser Glu Val Tyr Gly Asp Thr325
330 335Pro Glu Trp Ile Gln Arg Gln Thr Val
Leu Gln His Ser Phe Asn Asp340 345 350Cys
Thr Phe Glu Leu Ser Gln Met Val Gln Trp Ala Tyr Asp Asn Asp355
360 365Ile Val Asp Asp Ser Glu Ile Ala Tyr Lys Tyr
Ala Gln Leu Ala Asp370 375 380Thr Asn Ser
Asn Ala Ser Ala Phe Leu Lys Ser Asn Ser Gln Ala Lys385
390 395 400Ile Val Lys Asp Cys Ala Thr
Met Cys Arg His Tyr Lys Arg Ala Glu405 410
415Lys Lys Gln Met Ser Met Ser Gln Trp Ile Lys Tyr Arg Cys Asp Arg420
425 430Val Asp Asp Gly Gly Asp Trp Lys Gln
Ile Val Met Phe Leu Arg Tyr435 440 445Gln
Gly Val Glu Phe Met Ser Phe Leu Thr Ala Leu Lys Arg Phe Leu450
455 460Gln Gly Ile Pro Lys Lys Asn Cys Ile Leu Leu
Tyr Gly Ala Ala Asn465 470 475
480Thr Gly Lys Ser Leu Phe Gly Met Ser Leu Met Lys Phe Leu Gln
Gly485 490 495Ser Val Ile Cys Phe Val Asn
Ser Lys Ser His Phe Trp Leu Gln Pro500 505
510Leu Ala Asp Ala Lys Ile Gly Met Leu Asp Asp Ala Thr Val Pro Cys515
520 525Trp Asn Tyr Ile Asp Asp Asn Leu Arg
Asn Ala Leu Asp Gly Asn Leu530 535 540Val
Ser Met Asp Val Lys His Arg Pro Leu Val Gln Leu Lys Cys Pro545
550 555 560Pro Leu Leu Ile Thr Ser
Asn Ile Asn Ala Gly Thr Asp Ser Arg Trp565 570
575Pro Tyr Leu His Asn Arg Leu Val Val Phe Thr Phe Pro Asn Glu
Phe580 585 590Pro Phe Asp Glu Asn Gly Asn
Pro Val Tyr Glu Leu Asn Asp Lys Asn595 600
605Trp Lys Ser Phe Phe Ser Arg Thr Trp Ser Arg Leu Ser Leu His Glu610
615 620Asp Glu Asp Lys Glu Asn Asp Gly Asp
Ser Leu Pro Thr Phe Lys Cys625 630 635
640Val Ser Gly Gln Asn Thr Asn Thr Leu64529365PRTHuman
papillomavirus type 16 29Met Glu Thr Leu Cys Gln Arg Leu Asn Val Cys Gln
Asp Lys Ile Leu1 5 10
15Thr His Tyr Glu Asn Asp Ser Thr Asp Leu Arg Asp His Ile Asp Tyr20
25 30Trp Lys His Met Arg Leu Glu Cys Ala Ile
Tyr Tyr Lys Ala Arg Glu35 40 45Met Gly
Phe Lys His Ile Asn His Gln Val Val Pro Thr Leu Ala Val50
55 60Ser Lys Asn Lys Ala Leu Gln Ala Ile Glu Leu Gln
Leu Thr Leu Glu65 70 75
80Thr Ile Tyr Asn Ser Gln Tyr Ser Asn Glu Lys Trp Thr Leu Gln Asp85
90 95Val Ser Leu Glu Val Tyr Leu Thr Ala Pro
Thr Gly Cys Ile Lys Lys100 105 110His Gly
Tyr Thr Val Glu Val Gln Phe Asp Gly Asp Ile Cys Asn Thr115
120 125Met His Tyr Thr Asn Trp Thr His Ile Tyr Ile Cys
Glu Glu Ala Ser130 135 140Val Thr Val Val
Glu Gly Gln Val Asp Tyr Tyr Gly Leu Tyr Tyr Val145 150
155 160His Glu Gly Ile Arg Thr Tyr Phe Val
Gln Phe Lys Asp Asp Ala Glu165 170 175Lys
Tyr Ser Lys Asn Lys Val Trp Glu Val His Ala Gly Gly Gln Val180
185 190Ile Leu Cys Pro Thr Ser Val Phe Ser Ser Asn
Glu Val Ser Ser Pro195 200 205Glu Ile Ile
Arg Gln His Leu Ala Asn His Pro Ala Ala Thr His Thr210
215 220Lys Ala Val Ala Leu Gly Thr Glu Glu Thr Gln Thr
Thr Ile Gln Arg225 230 235
240Pro Arg Ser Glu Pro Asp Thr Gly Asn Pro Cys His Thr Thr Lys Leu245
250 255Leu His Arg Asp Ser Val Asp Ser Ala
Pro Ile Leu Thr Ala Phe Asn260 265 270Ser
Ser His Lys Gly Arg Ile Asn Cys Asn Ser Asn Thr Thr Pro Ile275
280 285Val His Leu Lys Gly Asp Ala Asn Thr Leu Lys
Cys Leu Arg Tyr Arg290 295 300Phe Lys Lys
His Cys Thr Leu Tyr Thr Ala Val Ser Ser Thr Trp His305
310 315 320Trp Thr Gly His Asn Val Lys
His Lys Ser Ala Ile Val Thr Leu Thr325 330
335Tyr Asp Ser Glu Trp Gln Arg Asp Gln Phe Leu Ser Gln Val Lys Ile340
345 350Pro Lys Thr Ile Thr Val Ser Thr Gly
Phe Met Ser Ile355 360 3653083PRTHuman
papillomavirus type 16 30Met Thr Asn Leu Asp Thr Ala Ser Thr Thr Leu Leu
Ala Cys Phe Leu1 5 10
15Leu Cys Phe Cys Val Leu Leu Cys Val Cys Leu Leu Ile Arg Pro Leu20
25 30Leu Leu Ser Val Ser Thr Tyr Thr Ser Leu
Ile Ile Leu Val Leu Leu35 40 45Leu Trp
Ile Thr Ala Ala Ser Ala Phe Arg Cys Phe Ile Val Tyr Ile50
55 60Ile Phe Val Tyr Ile Pro Leu Phe Leu Ile His Thr
His Ala Arg Phe65 70 75
80Leu Ile Thr31158PRTHuman papillomavirus type 16 31Met His Gln Lys Arg
Thr Ala Met Phe Gln Asp Pro Gln Glu Arg Pro1 5
10 15Arg Lys Leu Pro Gln Leu Cys Thr Glu Leu Gln Thr
Thr Ile His Asp20 25 30Ile Ile Leu Glu
Cys Val Tyr Cys Lys Gln Gln Leu Leu Arg Arg Glu35 40
45Val Tyr Asp Phe Ala Phe Arg Asp Leu Cys Ile Val Tyr Arg
Asp Gly50 55 60Asn Pro Tyr Ala Val Cys
Asp Lys Cys Leu Lys Phe Tyr Ser Lys Ile65 70
75 80Ser Glu Tyr Arg His Tyr Cys Tyr Ser Leu Tyr
Gly Thr Thr Leu Glu85 90 95Gln Gln Tyr
Asn Lys Pro Leu Cys Asp Leu Leu Ile Arg Cys Ile Asn100
105 110Cys Gln Lys Pro Leu Cys Pro Glu Glu Lys Gln Arg
His Leu Asp Lys115 120 125Lys Gln Arg Phe
His Asn Ile Arg Gly Arg Trp Thr Gly Arg Cys Met130 135
140Ser Cys Cys Arg Ser Ser Arg Thr Arg Arg Glu Thr Gln
Leu145 150 1553298PRTHuman papillomavirus
type 16 32Met His Gly Asp Thr Pro Thr Leu His Glu Tyr Met Leu Asp Leu
Gln1 5 10 15Pro Glu Thr
Thr Asp Leu Tyr Cys Tyr Glu Gln Leu Asn Asp Ser Ser20 25
30Glu Glu Glu Asp Glu Ile Asp Gly Pro Ala Gly Gln Ala
Glu Pro Asp35 40 45Arg Ala His Tyr Asn
Ile Val Thr Phe Cys Cys Lys Cys Asp Ser Thr50 55
60Leu Arg Leu Cys Val Gln Ser Thr His Val Asp Ile Arg Thr Leu
Glu65 70 75 80Asp Leu
Leu Met Gly Thr Leu Gly Ile Val Cys Pro Ile Cys Ser Gln85
90 95Lys Pro33531PRTHuman papillomavirus type 16 33Met
Gln Val Thr Phe Ile Tyr Ile Leu Val Ile Thr Cys Tyr Glu Asn1
5 10 15Asp Val Asn Val Tyr His Ile Phe
Phe Gln Met Ser Leu Trp Leu Pro20 25
30Ser Glu Ala Thr Val Tyr Leu Pro Pro Val Pro Val Ser Lys Val Val35
40 45Ser Thr Asp Glu Tyr Val Ala Arg Thr Asn
Ile Tyr Tyr His Ala Gly50 55 60Thr Ser
Arg Leu Leu Ala Val Gly His Pro Tyr Phe Pro Ile Lys Lys65
70 75 80Pro Asn Asn Asn Lys Ile Leu
Val Pro Lys Val Ser Gly Leu Gln Tyr85 90
95Arg Val Phe Arg Ile His Leu Pro Asp Pro Asn Lys Phe Gly Phe Pro100
105 110Asp Thr Ser Phe Tyr Asn Pro Asp Thr
Gln Arg Leu Val Trp Ala Cys115 120 125Val
Gly Val Glu Val Gly Arg Gly Gln Pro Leu Gly Val Gly Ile Ser130
135 140Gly His Pro Leu Leu Asn Lys Leu Asp Asp Thr
Glu Asn Ala Ser Ala145 150 155
160Tyr Ala Ala Asn Ala Gly Val Asp Asn Arg Glu Cys Ile Ser Met
Asp165 170 175Tyr Lys Gln Thr Gln Leu Cys
Leu Ile Gly Cys Lys Pro Pro Ile Gly180 185
190Glu His Trp Gly Lys Gly Ser Pro Cys Thr Asn Val Ala Val Asn Pro195
200 205Gly Asp Cys Pro Pro Leu Glu Leu Ile
Asn Thr Val Ile Gln Asp Gly210 215 220Asp
Met Val Asp Thr Gly Phe Gly Ala Met Asp Phe Thr Thr Leu Gln225
230 235 240Ala Asn Lys Ser Glu Val
Pro Leu Asp Ile Cys Thr Ser Ile Cys Lys245 250
255Tyr Pro Asp Tyr Ile Lys Met Val Ser Glu Pro Tyr Gly Asp Ser
Leu260 265 270Phe Phe Tyr Leu Arg Arg Glu
Gln Met Phe Val Arg His Leu Phe Asn275 280
285Arg Ala Gly Ala Val Gly Glu Asn Val Pro Asp Asp Leu Tyr Ile Lys290
295 300Gly Ser Gly Ser Thr Ala Asn Leu Ala
Ser Ser Asn Tyr Phe Pro Thr305 310 315
320Pro Ser Gly Ser Met Val Thr Ser Asp Ala Gln Ile Phe Asn
Lys Pro325 330 335Tyr Trp Leu Gln Arg Ala
Gln Gly His Asn Asn Gly Ile Cys Trp Gly340 345
350Asn Gln Leu Phe Val Thr Val Val Asp Thr Thr Arg Ser Thr Asn
Met355 360 365Ser Leu Cys Ala Ala Ile Ser
Thr Ser Glu Thr Thr Tyr Lys Asn Thr370 375
380Asn Phe Lys Glu Tyr Leu Arg His Gly Glu Glu Tyr Asp Leu Gln Phe385
390 395 400Ile Phe Gln Leu
Cys Lys Ile Thr Leu Thr Ala Asp Val Met Thr Tyr405 410
415Ile His Ser Met Asn Ser Thr Ile Leu Glu Asp Trp Asn Phe
Gly Leu420 425 430Gln Pro Pro Pro Gly Gly
Thr Leu Glu Asp Thr Tyr Arg Phe Val Thr435 440
445Ser Gln Ala Ile Ala Cys Gln Lys His Thr Pro Pro Ala Pro Lys
Glu450 455 460Asp Pro Leu Lys Lys Tyr Thr
Phe Trp Glu Val Asn Leu Lys Glu Lys465 470
475 480Phe Ser Ala Asp Leu Asp Gln Phe Pro Leu Gly Arg
Lys Phe Leu Leu485 490 495Gln Ala Gly Leu
Lys Ala Lys Pro Lys Phe Thr Leu Gly Lys Arg Lys500 505
510Ala Thr Pro Thr Thr Ser Ser Thr Ser Thr Thr Ala Lys Arg
Lys Lys515 520 525Arg Lys
Leu53034473PRTHuman papillomavirus type 16 34Met Arg His Lys Arg Ser Ala
Lys Arg Thr Lys Arg Ala Ser Ala Thr1 5 10
15Gln Leu Tyr Lys Thr Cys Lys Gln Ala Gly Thr Cys Pro Pro
Asp Ile20 25 30Ile Pro Lys Val Glu Gly
Lys Thr Ile Ala Asp Gln Ile Leu Gln Tyr35 40
45Gly Ser Met Gly Val Phe Phe Gly Gly Leu Gly Ile Gly Thr Gly Ser50
55 60Gly Thr Gly Gly Arg Thr Gly Tyr Ile
Pro Leu Gly Thr Arg Pro Pro65 70 75
80Thr Ala Thr Asp Thr Leu Ala Pro Val Arg Pro Pro Leu Thr
Val Asp85 90 95Pro Val Gly Pro Ser Asp
Pro Ser Ile Val Ser Leu Val Glu Glu Thr100 105
110Ser Phe Ile Asp Ala Gly Ala Pro Thr Ser Val Pro Ser Ile Pro
Pro115 120 125Asp Val Ser Gly Phe Ser Ile
Thr Thr Ser Thr Asp Thr Thr Pro Ala130 135
140Ile Leu Asp Ile Asn Asn Thr Val Thr Thr Val Thr Thr His Asn Asn145
150 155 160Pro Thr Phe Thr
Asp Pro Ser Val Leu Gln Pro Pro Thr Pro Ala Glu165 170
175Thr Gly Gly His Phe Thr Leu Ser Ser Ser Thr Ile Ser Thr
His Asn180 185 190Tyr Glu Glu Ile Pro Met
Asp Thr Phe Ile Val Ser Thr Asn Pro Asn195 200
205Thr Val Thr Ser Ser Thr Pro Ile Pro Gly Ser Arg Pro Val Ala
Arg210 215 220Leu Gly Leu Tyr Ser Arg Thr
Thr Gln Gln Val Lys Val Val Asp Pro225 230
235 240Ala Phe Ile Thr Thr Pro Thr Lys Leu Ile Thr Tyr
Asp Asn Pro Ala245 250 255Tyr Glu Gly Ile
Asp Val Asp Asn Thr Leu Tyr Phe Ser Ser Asn Asp260 265
270Asn Ser Ile Asn Ile Ala Pro Asp Pro Asp Phe Leu Asp Ile
Val Ala275 280 285Leu His Arg Pro Ala Leu
Thr Ser Arg Arg Thr Gly Ile Arg Tyr Ser290 295
300Arg Ile Gly Asn Lys Gln Thr Leu Arg Thr Arg Ser Gly Lys Ser
Ile305 310 315 320Gly Ala
Lys Val His Tyr Tyr Tyr Asp Phe Ser Thr Ile Asp Ser Ala325
330 335Glu Glu Ile Glu Leu Gln Thr Ile Thr Pro Ser Thr
Tyr Thr Thr Thr340 345 350Ser His Ala Ala
Leu Pro Thr Ser Ile Asn Asn Gly Leu Tyr Asp Ile355 360
365Tyr Ala Asp Asp Phe Ile Thr Asp Thr Ser Thr Thr Pro Val
Pro Ser370 375 380Val Pro Ser Thr Ser Leu
Ser Gly Tyr Ile Pro Ala Asn Thr Thr Ile385 390
395 400Pro Phe Gly Gly Ala Tyr Asn Ile Pro Leu Val
Ser Gly Pro Asp Ile405 410 415Pro Ile Asn
Ile Thr Asp Gln Ala Pro Ser Leu Ile Pro Ile Val Pro420
425 430Gly Ser Pro Gln Tyr Thr Ile Ile Ala Asp Ala Gly
Asp Phe Tyr Leu435 440 445His Pro Ser Tyr
Tyr Met Leu Arg Lys Arg Arg Lys Arg Leu Pro Tyr450 455
460Phe Phe Ser Asp Val Ser Leu Ala Ala465
47035657PRTHuman papillomavirus type 18 35Met Ala Asp Pro Glu Gly Thr Asp
Gly Glu Gly Thr Gly Cys Asn Gly1 5 10
15Trp Phe Tyr Val Gln Ala Ile Val Asp Lys Lys Thr Gly Asp Val
Ile20 25 30Ser Asp Asp Glu Asp Glu Asn
Ala Thr Asp Thr Gly Ser Asp Met Val35 40
45Asp Phe Ile Asp Thr Gln Gly Thr Phe Cys Glu Gln Ala Glu Leu Glu50
55 60Thr Ala Gln Ala Leu Phe His Ala Gln Glu
Val His Asn Asp Ala Gln65 70 75
80Val Leu His Val Leu Lys Arg Lys Phe Ala Gly Gly Ser Thr Glu
Asn85 90 95Ser Pro Leu Gly Glu Arg Leu
Glu Val Asp Thr Glu Leu Ser Pro Arg100 105
110Leu Gln Glu Ile Ser Leu Asn Ser Gly Gln Lys Lys Ala Lys Arg Arg115
120 125Leu Phe Thr Ile Ser Asp Ser Gly Tyr
Gly Cys Ser Glu Val Glu Ala130 135 140Thr
Gln Ile Gln Val Thr Thr Asn Gly Glu His Gly Gly Asn Val Cys145
150 155 160Ser Gly Gly Ser Thr Glu
Ala Ile Asp Asn Gly Gly Thr Glu Gly Asn165 170
175Asn Ser Ser Val Asp Gly Thr Ser Asp Asn Ser Asn Ile Glu Asn
Val180 185 190Asn Pro Gln Cys Thr Ile Ala
Gln Leu Lys Asp Leu Leu Lys Val Asn195 200
205Asn Lys Gln Gly Ala Met Leu Ala Val Phe Lys Asp Thr Tyr Gly Leu210
215 220Ser Phe Thr Asp Leu Val Arg Asn Phe
Lys Ser Asp Lys Thr Thr Cys225 230 235
240Thr Asp Trp Val Thr Ala Ile Phe Gly Val Asn Pro Thr Ile
Ala Glu245 250 255Gly Phe Lys Thr Leu Ile
Gln Pro Phe Ile Leu Tyr Ala His Ile Gln260 265
270Cys Leu Asp Cys Lys Trp Gly Val Leu Ile Leu Ala Leu Leu Arg
Tyr275 280 285Lys Cys Gly Lys Ser Arg Leu
Thr Val Ala Lys Gly Leu Ser Thr Leu290 295
300Leu His Val Pro Glu Thr Cys Met Leu Ile Gln Pro Pro Lys Leu Arg305
310 315 320Ser Ser Val Ala
Ala Leu Tyr Trp Tyr Arg Thr Gly Ile Ser Asn Ile325 330
335Ser Glu Val Met Gly Asp Thr Pro Glu Trp Ile Gln Arg Leu
Thr Ile340 345 350Ile Gln His Gly Ile Asp
Asp Ser Asn Phe Asp Leu Ser Glu Met Val355 360
365Gln Trp Ala Phe Asp Asn Glu Leu Thr Asp Glu Ser Asp Met Ala
Phe370 375 380Glu Tyr Ala Leu Leu Ala Asp
Ser Asn Ser Asn Ala Ala Ala Phe Leu385 390
395 400Lys Ser Asn Cys Gln Ala Lys Tyr Leu Lys Asp Cys
Ala Thr Met Cys405 410 415Lys His Tyr Arg
Arg Ala Gln Lys Arg Gln Met Asn Met Ser Gln Trp420 425
430Ile Arg Phe Arg Cys Ser Lys Ile Asp Glu Gly Gly Asp Trp
Arg Pro435 440 445Ile Val Gln Phe Leu Arg
Tyr Gln Gln Ile Glu Phe Ile Thr Phe Leu450 455
460Gly Ala Leu Lys Ser Phe Leu Lys Gly Thr Pro Lys Lys Asn Cys
Leu465 470 475 480Val Phe
Cys Gly Pro Ala Asn Thr Gly Lys Ser Tyr Phe Gly Met Ser485
490 495Phe Ile His Phe Ile Gln Gly Ala Val Ile Ser Phe
Val Asn Ser Thr500 505 510Ser His Phe Trp
Leu Glu Pro Leu Thr Asp Thr Lys Val Ala Met Leu515 520
525Asp Asp Ala Thr Thr Thr Cys Trp Thr Tyr Phe Asp Thr Tyr
Met Arg530 535 540Asn Ala Leu Asp Gly Asn
Pro Ile Ser Ile Asp Arg Lys His Lys Pro545 550
555 560Leu Ile Gln Leu Lys Cys Pro Pro Ile Leu Leu
Thr Thr Asn Ile His565 570 575Pro Ala Lys
Asp Asn Arg Trp Pro Tyr Leu Glu Ser Arg Ile Thr Val580
585 590Phe Glu Phe Pro Asn Ala Phe Pro Phe Asp Lys Asn
Gly Asn Pro Val595 600 605Tyr Glu Ile Asn
Asp Lys Asn Trp Lys Cys Phe Phe Glu Arg Thr Trp610 615
620Ser Arg Leu Asp Leu His Glu Glu Glu Glu Asp Ala Asp Thr
Glu Gly625 630 635 640Asn
Pro Phe Gly Thr Phe Lys Leu Arg Ala Gly Gln Asn His Arg Pro645
650 655Leu36365PRTHuman papillomavirus type 18 36Met
Gln Thr Pro Lys Glu Thr Leu Ser Glu Arg Leu Ser Cys Val Gln1
5 10 15Asp Lys Ile Ile Asp His Tyr Glu
Asn Asp Ser Lys Asp Ile Asp Ser20 25
30Gln Ile Gln Tyr Trp Gln Leu Ile Arg Trp Glu Asn Ala Ile Phe Phe35
40 45Ala Ala Arg Glu His Gly Ile Gln Thr Leu
Asn His Gln Val Val Pro50 55 60Ala Tyr
Asn Ile Ser Lys Ser Lys Ala His Lys Ala Ile Glu Leu Gln65
70 75 80Met Ala Leu Gln Gly Leu Ala
Gln Ser Arg Tyr Lys Thr Glu Asp Trp85 90
95Thr Leu Gln Asp Thr Cys Glu Glu Leu Trp Asn Thr Glu Pro Thr His100
105 110Cys Phe Lys Lys Gly Gly Gln Thr Val
Gln Val Tyr Phe Asp Gly Asn115 120 125Lys
Asp Asn Cys Met Thr Tyr Val Ala Trp Asp Ser Val Tyr Tyr Met130
135 140Thr Asp Ala Gly Thr Trp Asp Lys Thr Ala Thr
Cys Val Ser His Arg145 150 155
160Gly Leu Tyr Tyr Val Lys Glu Gly Tyr Asn Thr Phe Tyr Ile Glu
Phe165 170 175Lys Ser Glu Cys Glu Lys Tyr
Gly Asn Thr Gly Thr Trp Glu Val His180 185
190Phe Gly Asn Asn Val Ile Asp Cys Asn Asp Ser Met Cys Ser Thr Ser195
200 205Asp Asp Thr Val Ser Ala Thr Gln Leu
Val Lys Gln Leu Gln His Thr210 215 220Pro
Ser Pro Tyr Ser Ser Thr Val Ser Val Gly Thr Ala Lys Thr Tyr225
230 235 240Gly Gln Thr Ser Ala Ala
Thr Arg Pro Gly His Cys Gly Leu Ala Glu245 250
255Lys Gln His Cys Gly Pro Val Asn Pro Leu Leu Gly Ala Ala Thr
Pro260 265 270Thr Gly Asn Asn Lys Arg Arg
Lys Leu Cys Ser Gly Asn Thr Thr Pro275 280
285Ile Ile His Leu Lys Gly Asp Arg Asn Ser Leu Lys Cys Leu Arg Tyr290
295 300Arg Leu Arg Lys His Ser Asp His Tyr
Arg Asp Ile Ser Ser Thr Trp305 310 315
320His Trp Thr Gly Ala Gly Asn Glu Lys Thr Gly Ile Leu Thr
Val Thr325 330 335Tyr His Ser Glu Thr Gln
Arg Thr Lys Phe Leu Asn Thr Val Ala Ile340 345
350Pro Asp Ser Val Gln Ile Leu Val Gly Tyr Met Thr Met355
360 3653773PRTHuman papillomavirus type 18 37Met Leu
Ser Leu Ile Phe Leu Phe Cys Phe Cys Val Cys Met Tyr Val1 5
10 15Cys Cys His Val Pro Leu Leu Pro Ser
Val Cys Met Cys Ala Tyr Ala20 25 30Trp
Val Leu Val Phe Val Tyr Ile Val Val Ile Thr Ser Pro Ala Thr35
40 45Ala Phe Thr Val Tyr Val Phe Cys Phe Leu Leu
Pro Met Leu Leu Leu50 55 60His Ile His
Ala Ile Leu Ser Leu Gln65 7038158PRTHuman papillomavirus
type 18 38Met Ala Arg Phe Glu Asp Pro Thr Arg Arg Pro Tyr Lys Leu Pro
Asp1 5 10 15Leu Cys Thr
Glu Leu Asn Thr Ser Leu Gln Asp Ile Glu Ile Thr Cys20 25
30Val Tyr Cys Lys Thr Val Leu Glu Leu Thr Glu Val Phe
Glu Phe Ala35 40 45Phe Lys Asp Leu Phe
Val Val Tyr Arg Asp Ser Ile Pro His Ala Ala50 55
60Cys His Lys Cys Ile Asp Phe Tyr Ser Arg Ile Arg Glu Leu Arg
His65 70 75 80Tyr Ser
Asp Ser Val Tyr Gly Asp Thr Leu Glu Lys Leu Thr Asn Thr85
90 95Gly Leu Tyr Asn Leu Leu Ile Arg Cys Leu Arg Cys
Gln Lys Pro Leu100 105 110Asn Pro Ala Glu
Lys Leu Arg His Leu Asn Glu Lys Arg Arg Phe His115 120
125Asn Ile Ala Gly His Tyr Arg Gly Gln Cys His Ser Cys Cys
Asn Arg130 135 140Ala Arg Gln Glu Arg Leu
Gln Arg Arg Arg Glu Thr Gln Val145 150
15539105PRTHuman papillomavirus type 18 39Met His Gly Pro Lys Ala Thr Leu
Gln Asp Ile Val Leu His Leu Glu1 5 10
15Pro Gln Asn Glu Ile Pro Val Asp Leu Leu Cys His Glu Gln Leu
Ser20 25 30Asp Ser Glu Glu Glu Asn Asp
Glu Ile Asp Gly Val Asn His Gln His35 40
45Leu Pro Ala Arg Arg Ala Glu Pro Gln Arg His Thr Met Leu Cys Met50
55 60Cys Cys Lys Cys Glu Ala Arg Ile Lys Leu
Val Val Glu Ser Ser Ala65 70 75
80Asp Asp Leu Arg Ala Phe Gln Gln Leu Phe Leu Asn Thr Leu Ser
Phe85 90 95Val Cys Pro Trp Cys Ala Ser
Gln Gln100 10540568PRTHuman papillomavirus type 18 40Met
Cys Leu Tyr Thr Arg Val Leu Ile Leu His Tyr His Leu Leu Pro1
5 10 15Leu Tyr Gly Pro Leu Tyr His Pro
Arg Pro Leu Pro Leu His Ser Ile20 25
30Leu Val Tyr Met Val His Ile Ile Ile Cys Gly His Tyr Ile Ile Leu35
40 45Phe Leu Arg Asn Val Asn Val Phe Pro Ile
Phe Leu Gln Met Ala Leu50 55 60Trp Arg
Pro Ser Asp Asn Thr Val Tyr Leu Pro Pro Pro Ser Val Ala65
70 75 80Arg Val Val Asn Thr Asp Asp
Tyr Val Thr Pro Thr Ser Ile Phe Tyr85 90
95His Ala Gly Ser Ser Arg Leu Leu Thr Val Gly Asn Pro Tyr Phe Arg100
105 110Val Pro Ala Gly Gly Gly Asn Lys Gln
Asp Ile Pro Lys Val Ser Ala115 120 125Tyr
Gln Tyr Arg Val Phe Arg Val Gln Leu Pro Asp Pro Asn Lys Phe130
135 140Gly Leu Pro Asp Thr Ser Ile Tyr Asn Pro Glu
Thr Gln Arg Leu Val145 150 155
160Trp Ala Cys Ala Gly Val Glu Ile Gly Arg Gly Gln Pro Leu Gly
Val165 170 175Gly Leu Ser Gly His Pro Phe
Tyr Asn Lys Leu Asp Asp Thr Glu Ser180 185
190Ser His Ala Ala Thr Ser Asn Val Ser Glu Asp Val Arg Asp Asn Val195
200 205Ser Val Asp Tyr Lys Gln Thr Gln Leu
Cys Ile Leu Gly Cys Ala Pro210 215 220Ala
Ile Gly Glu His Trp Ala Lys Gly Thr Ala Cys Lys Ser Arg Pro225
230 235 240Leu Ser Gln Gly Asp Cys
Pro Pro Leu Glu Leu Lys Asn Thr Val Leu245 250
255Glu Asp Gly Asp Met Val Asp Thr Gly Tyr Gly Ala Met Asp Phe
Ser260 265 270Thr Leu Gln Asp Thr Lys Cys
Glu Val Pro Leu Asp Ile Cys Gln Ser275 280
285Ile Cys Lys Tyr Pro Asp Tyr Leu Gln Met Ser Ala Asp Pro Tyr Gly290
295 300Asp Ser Met Phe Phe Cys Leu Arg Arg
Glu Gln Leu Phe Ala Arg His305 310 315
320Phe Trp Asn Arg Ala Gly Thr Met Gly Asp Thr Val Pro Gln
Ser Leu325 330 335Tyr Ile Lys Gly Thr Gly
Met Pro Ala Ser Pro Gly Ser Cys Val Tyr340 345
350Ser Pro Ser Pro Ser Gly Ser Ile Val Thr Ser Asp Ser Gln Leu
Phe355 360 365Asn Lys Pro Tyr Trp Leu His
Lys Ala Gln Gly His Asn Asn Gly Val370 375
380Cys Trp His Asn Gln Leu Phe Val Thr Val Val Asp Thr Thr Pro Ser385
390 395 400Thr Asn Leu Thr
Ile Cys Ala Ser Thr Gln Ser Pro Val Pro Gly Gln405 410
415Tyr Asp Ala Thr Lys Phe Lys Gln Tyr Ser Arg His Val Glu
Glu Tyr420 425 430Asp Leu Gln Phe Ile Phe
Gln Leu Cys Thr Ile Thr Leu Thr Ala Asp435 440
445Val Met Ser Tyr Ile His Ser Met Asn Ser Ser Ile Leu Glu Asp
Trp450 455 460Asn Phe Gly Val Pro Pro Pro
Pro Thr Thr Ser Leu Val Asp Thr Tyr465 470
475 480Arg Phe Val Gln Ser Val Ala Ile Thr Cys Gln Lys
Asp Ala Ala Pro485 490 495Ala Glu Asn Lys
Asp Pro Tyr Asp Lys Leu Lys Phe Trp Asn Val Asp500 505
510Leu Lys Glu Lys Phe Ser Leu Asp Leu Asp Gln Tyr Pro Leu
Gly Arg515 520 525Lys Phe Leu Val Gln Ala
Gly Leu Arg Arg Lys Pro Thr Ile Gly Pro530 535
540Arg Lys Arg Ser Ala Pro Ser Ala Thr Thr Ser Ser Lys Pro Ala
Lys545 550 555 560Arg Val
Arg Val Arg Ala Arg Lys56541462PRTHuman papillomavirus type 18 41Met Val
Ser His Arg Ala Ala Arg Arg Lys Arg Ala Ser Val Thr Asp1 5
10 15Leu Tyr Lys Thr Cys Lys Gln Ser Gly
Thr Cys Pro Pro Asp Val Val20 25 30Pro
Lys Val Glu Gly Thr Thr Leu Ala Asp Lys Ile Leu Gln Trp Ser35
40 45Ser Leu Gly Ile Phe Leu Gly Gly Leu Gly Ile
Gly Thr Gly Ser Gly50 55 60Thr Gly Gly
Arg Thr Gly Tyr Ile Pro Leu Gly Gly Arg Ser Asn Thr65 70
75 80Val Val Asp Val Gly Pro Thr Arg
Pro Pro Val Val Ile Glu Pro Val85 90
95Gly Pro Thr Asp Pro Ser Ile Val Thr Leu Ile Glu Asp Ser Ser Val100
105 110Val Thr Ser Gly Ala Pro Arg Pro Thr Phe
Thr Gly Thr Ser Gly Phe115 120 125Asp Ile
Thr Ser Ala Gly Thr Thr Thr Pro Ala Val Leu Asp Ile Thr130
135 140Pro Ser Ser Thr Ser Val Ser Ile Ser Thr Thr Asn
Phe Thr Asn Pro145 150 155
160Ala Phe Ser Asp Pro Ser Ile Ile Glu Val Pro Gln Thr Gly Glu Val165
170 175Ala Gly Asn Val Phe Val Gly Thr Pro
Thr Ser Gly Thr His Gly Tyr180 185 190Glu
Glu Ile Pro Leu Gln Thr Phe Ala Ser Ser Gly Thr Gly Glu Glu195
200 205Pro Ile Ser Ser Thr Pro Leu Pro Thr Val Arg
Arg Val Ala Gly Pro210 215 220Arg Leu Tyr
Ser Arg Ala Tyr Gln Gln Val Ser Val Ala Asn Pro Glu225
230 235 240Phe Leu Thr Arg Pro Ser Ser
Leu Ile Thr Tyr Asp Asn Pro Ala Phe245 250
255Glu Pro Val Asp Thr Thr Leu Thr Phe Asp Pro Arg Ser Asp Val Pro260
265 270Asp Ser Asp Phe Met Asp Ile Ile Arg
Leu His Arg Pro Ala Leu Thr275 280 285Ser
Arg Arg Gly Thr Val Arg Phe Ser Arg Leu Gly Gln Arg Ala Thr290
295 300Met Phe Thr Arg Ser Gly Thr Gln Ile Gly Ala
Arg Val His Phe Tyr305 310 315
320His Asp Ile Ser Pro Ile Ala Pro Ser Pro Glu Tyr Ile Glu Leu
Gln325 330 335Pro Leu Val Ser Ala Thr Glu
Asp Asn Asp Leu Phe Asp Ile Tyr Ala340 345
350Asp Asp Met Asp Pro Ala Val Pro Val Pro Ser Arg Ser Thr Thr Ser355
360 365Phe Ala Phe Phe Lys Tyr Ser Pro Thr
Ile Ser Ser Ala Ser Ser Tyr370 375 380Ser
Asn Val Thr Val Pro Leu Thr Ser Ser Trp Asp Val Pro Val Tyr385
390 395 400Thr Gly Pro Asp Ile Thr
Leu Pro Ser Thr Thr Ser Val Trp Pro Ile405 410
415Val Ser Pro Thr Ala Pro Ala Ser Thr Gln Tyr Ile Gly Ile His
Gly420 425 430Thr His Tyr Tyr Leu Trp Pro
Leu Tyr Tyr Phe Ile Pro Lys Lys Arg435 440
445Lys Arg Val Pro Tyr Phe Phe Ala Asp Gly Phe Val Ala Ala450
455 46042629PRTHuman papillomavirus type 31 42Met
Ala Asp Pro Ala Gly Thr Asp Gly Glu Gly Thr Gly Cys Asn Gly1
5 10 15Trp Phe Tyr Val Glu Ala Val Ile
Asp Arg Gln Thr Gly Asp Asn Ile20 25
30Ser Glu Asp Glu Asn Glu Asp Ser Ser Asp Thr Gly Glu Asp Met Val35
40 45Asp Phe Ile Asp Asn Cys Asn Val Tyr Asn
Asn Gln Ala Glu Ala Glu50 55 60Thr Ala
Gln Ala Leu Phe His Ala Gln Glu Ala Glu Glu His Ala Glu65
70 75 80Ala Val Gln Val Leu Lys Arg
Lys Tyr Val Gly Ser Pro Leu Ser Asp85 90
95Ile Ser Ser Cys Val Asp Tyr Asn Ile Ser Pro Arg Leu Lys Ala Ile100
105 110Cys Ile Glu Asn Asn Ser Lys Thr Ala
Lys Arg Arg Leu Phe Glu Leu115 120 125Pro
Asp Ser Gly Tyr Gly Asn Thr Glu Val Glu Thr Gln Gln Met Val130
135 140Gln Val Glu Glu Gln Gln Thr Thr Leu Ser Cys
Asn Gly Ser Asp Gly145 150 155
160Thr His Ser Glu Arg Glu Asn Glu Thr Pro Thr Arg Asn Ile Leu
Gln165 170 175Val Leu Lys Thr Ser Asn Gly
Lys Ala Ala Met Leu Gly Lys Phe Lys180 185
190Glu Leu Tyr Gly Val Ser Phe Met Glu Leu Ile Arg Pro Phe Gln Ser195
200 205Asn Lys Ser Thr Cys Thr Asp Trp Cys
Val Ala Ala Phe Gly Val Thr210 215 220Gly
Thr Val Ala Glu Gly Phe Lys Thr Leu Leu Gln Pro Tyr Cys Leu225
230 235 240Tyr Cys His Leu Gln Ser
Leu Ala Cys Ser Trp Gly Met Val Met Leu245 250
255Met Leu Val Arg Phe Lys Cys Ala Lys Asn Arg Ile Thr Ile Glu
Lys260 265 270Leu Leu Glu Lys Leu Leu Cys
Ile Ser Thr Asn Cys Met Leu Ile Gln275 280
285Pro Pro Lys Leu Arg Ser Thr Ala Ala Ala Leu Tyr Trp Tyr Arg Thr290
295 300Gly Met Ser Asn Ile Ser Asp Val Tyr
Gly Glu Thr Pro Glu Trp Ile305 310 315
320Glu Arg Gln Thr Val Leu Gln His Ser Phe Asn Asp Thr Thr
Phe Asp325 330 335Leu Ser Gln Met Val Gln
Trp Ala Tyr Asp Asn Asp Val Met Asp Asp340 345
350Ser Glu Ile Ala Tyr Lys Tyr Ala Gln Leu Ala Asp Ser Asp Ser
Asn355 360 365Ala Cys Ala Phe Leu Lys Ser
Asn Ser Gln Ala Lys Ile Val Lys Asp370 375
380Cys Gly Thr Met Cys Arg His Tyr Lys Arg Ala Glu Lys Arg Gln Met385
390 395 400Ser Met Gly Gln
Trp Ile Lys Ser Arg Cys Asp Lys Val Ser Asp Glu405 410
415Gly Asp Trp Arg Asp Ile Val Lys Phe Leu Arg Tyr Gln Gln
Ile Glu420 425 430Phe Val Ser Phe Leu Ser
Ala Leu Lys Leu Phe Leu Lys Gly Val Pro435 440
445Lys Lys Asn Cys Ile Leu Ile His Gly Ala Pro Asn Thr Gly Lys
Ser450 455 460Tyr Phe Gly Met Ser Leu Ile
Ser Phe Leu Gln Gly Cys Ile Ile Ser465 470
475 480Tyr Ala Asn Ser Lys Ser His Phe Trp Leu Gln Pro
Leu Ala Asp Ala485 490 495Lys Ile Gly Met
Leu Asp Asp Ala Thr Thr Pro Cys Trp His Tyr Ile500 505
510Asp Asn Tyr Leu Arg Asn Ala Leu Asp Gly Asn Pro Val Ser
Ile Asp515 520 525Val Lys His Lys Ala Leu
Met Gln Leu Lys Cys Pro Pro Leu Leu Ile530 535
540Thr Ser Asn Ile Asn Ala Gly Lys Asp Asp Arg Trp Pro Tyr Leu
His545 550 555 560Ser Arg
Leu Val Val Phe Thr Phe Pro Asn Pro Phe Pro Phe Asp Lys565
570 575Asn Gly Asn Pro Val Tyr Glu Leu Ser Asp Lys Asn
Trp Lys Ser Phe580 585 590Phe Ser Arg Thr
Trp Cys Arg Leu Asn Leu His Glu Glu Glu Asp Lys595 600
605Glu Asn Asp Gly Asp Ser Phe Ser Thr Phe Lys Cys Val Ser
Gly Gln610 615 620Asn Ile Arg Thr
Leu62543372PRTHuman papillomavirus type 31 43Met Glu Thr Leu Ser Gln Arg
Leu Asn Val Cys Gln Asp Lys Ile Leu1 5 10
15Glu His Tyr Glu Asn Asp Ser Lys Arg Leu Cys Asp His Ile
Asp Tyr20 25 30Trp Lys His Ile Arg Leu
Glu Cys Val Leu Met Tyr Lys Ala Arg Glu35 40
45Met Gly Ile His Ser Ile Asn His Gln Val Val Pro Ala Leu Ser Val50
55 60Ser Lys Ala Lys Ala Leu Gln Ala Ile
Glu Leu Gln Met Met Leu Glu65 70 75
80Thr Leu Asn Asn Thr Glu Tyr Lys Asn Glu Asp Trp Thr Met
Gln Gln85 90 95Thr Ser Leu Glu Leu Tyr
Leu Thr Ala Pro Thr Gly Cys Leu Lys Lys100 105
110His Gly Tyr Thr Val Glu Val Gln Phe Asp Gly Asp Val His Asn
Thr115 120 125Met His Tyr Thr Asn Trp Lys
Phe Ile Tyr Leu Cys Ile Asp Gly Gln130 135
140Cys Thr Val Val Glu Gly Gln Val Asn Cys Lys Gly Ile Tyr Tyr Val145
150 155 160His Glu Gly His
Ile Thr Tyr Phe Val Asn Phe Thr Glu Glu Ala Lys165 170
175Lys Tyr Gly Thr Gly Lys Lys Trp Glu Val His Ala Gly Gly
Gln Val180 185 190Ile Val Phe Pro Glu Ser
Val Phe Ser Ser Asp Glu Ile Ser Phe Ala195 200
205Gly Ile Val Thr Lys Leu Pro Thr Ala Asn Asn Thr Thr Thr Ser
Asn210 215 220Ser Lys Thr Cys Ala Leu Gly
Thr Ser Glu Gly Val Arg Arg Ala Thr225 230
235 240Thr Ser Thr Lys Arg Pro Arg Thr Glu Pro Glu His
Arg Asn Thr His245 250 255His Pro Asn Lys
Leu Leu Arg Gly Asp Ser Val Asp Ser Val Asn Cys260 265
270Gly Val Ile Ser Ala Ala Ala Cys Thr Asn Gln Thr Arg Ala
Val Ser275 280 285Cys Pro Ala Thr Thr Pro
Ile Ile His Leu Lys Gly Asp Ala Asn Ile290 295
300Leu Lys Cys Leu Arg Tyr Arg Leu Ser Lys Tyr Lys Gln Leu Tyr
Glu305 310 315 320Gln Val
Ser Ser Thr Trp His Trp Thr Cys Thr Asp Gly Lys His Lys325
330 335Asn Ala Ile Val Thr Leu Thr Tyr Ile Ser Thr Ser
Gln Arg Asp Asp340 345 350Phe Leu Asn Thr
Val Lys Ile Pro Asn Thr Val Ser Val Ser Thr Gly355 360
365Tyr Met Thr Ile3704484PRTHuman papillomavirus type 31
44Met Ile Glu Leu Asn Ile Ser Thr Val Ser Ile Val Leu Cys Phe Leu1
5 10 15Leu Cys Phe Cys Val Leu
Leu Phe Val Cys Leu Val Ile Arg Pro Leu20 25
30Val Leu Ser Val Ser Val Tyr Ala Thr Leu Leu Leu Leu Ile Val Ile35
40 45Leu Trp Val Ile Ala Thr Ser Pro Leu
Arg Cys Phe Cys Ile Tyr Val50 55 60Val
Phe Ile Tyr Ile Pro Leu Phe Val Ile His Thr His Ala Ser Phe65
70 75 80Leu Ser Gln
Gln45149PRTHuman papillomavirus type 31 45Met Phe Lys Asn Pro Ala Glu Arg
Pro Arg Lys Leu His Glu Leu Ser1 5 10
15Ser Ala Leu Glu Ile Pro Tyr Asp Glu Leu Arg Leu Asn Cys Val
Tyr20 25 30Cys Lys Gly Gln Leu Thr Glu
Thr Glu Val Leu Asp Phe Ala Phe Thr35 40
45Asp Leu Thr Ile Val Tyr Arg Asp Asp Thr Pro His Gly Val Cys Thr50
55 60Lys Cys Leu Arg Phe Tyr Ser Lys Val Ser
Glu Phe Arg Trp Tyr Arg65 70 75
80Tyr Ser Val Tyr Gly Thr Thr Leu Glu Lys Leu Thr Asn Lys Gly
Ile85 90 95Cys Asp Leu Leu Ile Arg Cys
Ile Thr Cys Gln Arg Pro Leu Cys Pro100 105
110Glu Glu Lys Gln Arg His Leu Asp Lys Lys Lys Arg Phe His Asn Ile115
120 125Gly Gly Arg Trp Thr Gly Arg Cys Ile
Ala Cys Trp Arg Arg Pro Arg130 135 140Thr
Glu Thr Gln Val1454698PRTHuman papillomavirus type 31 46Met Arg Gly Glu
Thr Pro Thr Leu Gln Asp Tyr Val Leu Asp Leu Gln1 5
10 15Pro Glu Ala Thr Asp Leu His Cys Tyr Glu Gln
Leu Pro Asp Ser Ser20 25 30Asp Glu Glu
Asp Val Ile Asp Ser Pro Ala Gly Gln Ala Glu Pro Asp35 40
45Thr Ser Asn Tyr Asn Ile Val Thr Phe Cys Cys Gln Cys
Lys Ser Thr50 55 60Leu Arg Leu Cys Val
Gln Ser Thr Gln Val Asp Ile Arg Ile Leu Gln65 70
75 80Glu Leu Leu Met Gly Ser Phe Gly Ile Val
Cys Pro Asn Cys Ser Thr85 90 95Arg
Leu47504PRTHuman papillomavirus type 31 47Met Ser Leu Trp Arg Pro Ser Glu
Ala Thr Val Tyr Leu Pro Pro Val1 5 10
15Pro Val Ser Lys Val Val Ser Thr Asp Glu Tyr Val Thr Arg Thr
Asn20 25 30Ile Tyr Tyr His Ala Gly Ser
Ala Arg Leu Leu Thr Val Gly His Pro35 40
45Tyr Tyr Ser Ile Pro Lys Ser Asp Asn Pro Lys Lys Ile Val Val Pro50
55 60Lys Val Ser Gly Leu Gln Tyr Arg Val Phe
Arg Val Arg Leu Pro Asp65 70 75
80Pro Asn Lys Phe Gly Phe Pro Asp Thr Ser Phe Tyr Asn Pro Glu
Thr85 90 95Gln Arg Leu Val Trp Ala Cys
Val Gly Leu Glu Val Gly Arg Gly Gln100 105
110Pro Leu Gly Val Gly Ile Ser Gly His Pro Leu Leu Asn Lys Phe Asp115
120 125Asp Thr Glu Asn Ser Asn Arg Tyr Ala
Gly Gly Pro Gly Thr Asp Asn130 135 140Arg
Glu Cys Ile Ser Met Asp Tyr Lys Gln Thr Gln Leu Cys Leu Leu145
150 155 160Gly Cys Lys Pro Pro Ile
Gly Glu His Trp Gly Lys Gly Ser Pro Cys165 170
175Ser Asn Asn Ala Ile Thr Pro Gly Asp Cys Pro Pro Leu Glu Leu
Lys180 185 190Asn Ser Val Ile Gln Asp Gly
Asp Met Val Asp Thr Gly Phe Gly Ala195 200
205Met Asp Phe Thr Ala Leu Gln Asp Thr Lys Ser Asn Val Pro Leu Asp210
215 220Ile Cys Asn Ser Ile Cys Lys Tyr Pro
Asp Tyr Leu Lys Met Val Ala225 230 235
240Glu Pro Tyr Gly Asp Thr Leu Phe Phe Tyr Leu Arg Arg Glu
Gln Met245 250 255Phe Val Arg His Phe Phe
Asn Arg Ser Gly Thr Val Gly Glu Ser Val260 265
270Pro Thr Asp Leu Tyr Ile Lys Gly Ser Gly Ser Thr Ala Thr Leu
Ala275 280 285Asn Ser Thr Tyr Phe Pro Thr
Pro Ser Gly Ser Met Val Thr Ser Asp290 295
300Ala Gln Ile Phe Asn Lys Pro Tyr Trp Met Gln Arg Ala Gln Gly His305
310 315 320Asn Asn Gly Ile
Cys Trp Gly Asn Gln Leu Phe Val Thr Val Val Asp325 330
335Thr Thr Arg Ser Thr Asn Met Ser Val Cys Ala Ala Ile Ala
Asn Ser340 345 350Asp Thr Thr Phe Lys Ser
Ser Asn Phe Lys Glu Tyr Leu Arg His Gly355 360
365Glu Glu Phe Asp Leu Gln Phe Ile Phe Gln Leu Cys Lys Ile Thr
Leu370 375 380Ser Ala Asp Ile Met Thr Tyr
Ile His Ser Met Asn Pro Ala Ile Leu385 390
395 400Glu Asp Trp Asn Phe Gly Leu Thr Thr Pro Pro Ser
Gly Ser Leu Glu405 410 415Asp Thr Tyr Arg
Phe Val Thr Ser Gln Ala Ile Thr Cys Gln Lys Thr420 425
430Ala Pro Gln Lys Pro Lys Glu Asp Pro Phe Lys Asp Tyr Val
Phe Trp435 440 445Glu Val Asn Leu Lys Glu
Lys Phe Ser Ala Asp Leu Asp Gln Phe Pro450 455
460Leu Gly Arg Lys Phe Leu Leu Gln Ala Gly Tyr Arg Ala Arg Pro
Lys465 470 475 480Phe Lys
Ala Gly Lys Arg Ser Ala Pro Ser Ala Ser Thr Thr Thr Pro485
490 495Ala Lys Arg Lys Lys Thr Lys Lys50048466PRTHuman
papillomavirus type 31 48Met Arg Ser Lys Arg Ser Thr Lys Arg Thr Lys Arg
Ala Ser Ala Thr1 5 10
15Gln Leu Tyr Gln Thr Cys Lys Ala Ala Gly Thr Cys Pro Ser Asp Val20
25 30Ile Pro Lys Ile Glu His Thr Thr Ile Ala
Asp Gln Ile Leu Arg Tyr35 40 45Gly Ser
Met Gly Val Phe Phe Gly Gly Leu Gly Ile Gly Ser Gly Ser50
55 60Gly Thr Gly Gly Arg Thr Gly Tyr Val Pro Leu Ser
Thr Arg Pro Ser65 70 75
80Thr Val Ser Glu Ala Ser Ile Pro Ile Arg Pro Pro Val Ser Ile Asp85
90 95Pro Val Gly Pro Leu Asp Pro Ser Ile Val
Ser Leu Val Glu Glu Ser100 105 110Gly Ile
Val Asp Val Gly Ala Pro Ala Pro Ile Pro His Pro Pro Thr115
120 125Thr Ser Gly Phe Asp Ile Ala Thr Thr Ala Asp Thr
Thr Pro Ala Ile130 135 140Leu Asp Val Thr
Ser Val Ser Thr His Glu Asn Pro Thr Phe Thr Asp145 150
155 160Pro Ser Val Leu Gln Pro Pro Thr Pro
Ala Glu Thr Ser Gly His Leu165 170 175Leu
Leu Ser Ser Ser Ser Ile Ser Thr His Asn Tyr Glu Glu Ile Pro180
185 190Met Asp Thr Phe Ile Val Ser Thr Asn Asn Glu
Asn Ile Thr Ser Ser195 200 205Thr Pro Ile
Pro Gly Val Arg Arg Pro Ala Arg Leu Gly Leu Tyr Ser210
215 220Lys Ala Thr Gln Gln Val Lys Val Ile Asp Pro Thr
Phe Leu Ser Ala225 230 235
240Pro Lys Gln Leu Ile Thr Tyr Glu Asn Pro Ala Tyr Glu Thr Val Asn245
250 255Ala Glu Glu Ser Leu Tyr Phe Ser Asn
Thr Ser His Asn Ile Ala Pro260 265 270Asp
Pro Asp Phe Leu Asp Ile Ile Ala Leu His Arg Pro Ala Leu Thr275
280 285Ser Arg Arg Asn Thr Val Arg Tyr Ser Arg Leu
Gly Asn Lys Gln Thr290 295 300Leu Arg Thr
Arg Ser Gly Ala Thr Ile Gly Ala Arg Val His Tyr Tyr305
310 315 320Tyr Asp Ile Ser Ser Ile Asn
Pro Ala Gly Glu Ser Ile Glu Met Gln325 330
335Pro Leu Gly Ala Ser Ala Thr Thr Thr Ser Thr Leu Asn Asp Gly Leu340
345 350Tyr Asp Ile Tyr Ala Asp Thr Asp Phe
Thr Val Asp Thr Pro Ala Thr355 360 365His
Asn Val Ser Pro Ser Thr Ala Val Gln Ser Thr Ser Ala Val Ser370
375 380Ala Tyr Val Pro Thr Asn Thr Thr Val Pro Leu
Ser Thr Gly Phe Asp385 390 395
400Ile Pro Ile Phe Ser Gly Pro Asp Val Pro Ile Glu His Ala Pro
Thr405 410 415Gln Val Phe Pro Phe Pro Leu
Ala Pro Thr Thr Pro Gln Val Ser Ile420 425
430Phe Val Asp Gly Gly Asp Phe Tyr Leu His Pro Ser Tyr Tyr Met Leu435
440 445Lys Arg Arg Arg Lys Arg Val Ser Tyr
Phe Phe Thr Asp Val Ser Val450 455 460Ala
Ala46549643PRTHuman papillomavirus type 45 49Met Ala Asp Pro Glu Gly Thr
Asp Gly Glu Gly Thr Gly Cys Asn Gly1 5 10
15Trp Phe Phe Val Glu Thr Ile Val Glu Lys Lys Thr Gly Asp
Val Ile20 25 30Ser Asp Asp Glu Asp Glu
Thr Ala Thr Asp Thr Gly Ser Asp Met Val35 40
45Asp Phe Ile Asp Thr Gln Leu Ser Ile Cys Glu Gln Ala Glu Gln Glu50
55 60Thr Ala Gln Ala Leu Phe His Ala Gln
Glu Val Gln Asn Asp Ala Gln65 70 75
80Val Leu His Leu Leu Lys Arg Lys Phe Ala Gly Gly Ser Lys
Glu Asn85 90 95Ser Pro Leu Gly Glu Gln
Leu Ser Val Asp Thr Asp Leu Ser Pro Arg100 105
110Leu Gln Glu Ile Ser Leu Asn Ser Gly His Lys Lys Ala Lys Arg
Arg115 120 125Leu Phe Thr Ile Ser Asp Ser
Gly Tyr Gly Cys Ser Glu Val Glu Ala130 135
140Ala Glu Thr Gln Val Thr Val Asn Thr Asn Ala Glu Asn Gly Gly Ser145
150 155 160Val His Ser Thr
Gln Ser Ser Gly Gly Asp Ser Ser Asp Asn Ala Glu165 170
175Asn Val Asp Pro His Cys Ser Ile Thr Glu Leu Lys Glu Leu
Leu Gln180 185 190Ala Ser Asn Lys Lys Ala
Ala Met Leu Ala Val Phe Lys Asp Ile Tyr195 200
205Gly Leu Ser Phe Thr Asp Leu Val Arg Asn Phe Lys Ser Asp Lys
Thr210 215 220Thr Cys Thr Asp Trp Val Met
Ala Ile Phe Gly Val Asn Pro Thr Val225 230
235 240Ala Glu Gly Phe Lys Thr Leu Ile Lys Pro Ala Thr
Leu Tyr Ala His245 250 255Ile Gln Cys Leu
Asp Cys Lys Trp Gly Val Leu Ile Leu Ala Leu Leu260 265
270Arg Tyr Lys Cys Gly Lys Asn Arg Leu Thr Val Ala Lys Gly
Leu Ser275 280 285Thr Leu Leu His Val Pro
Glu Thr Cys Met Leu Ile Glu Pro Pro Lys290 295
300Leu Arg Ser Ser Val Ala Ala Leu Tyr Trp Tyr Arg Thr Gly Ile
Ser305 310 315 320Asn Ile
Ser Glu Val Ser Gly Asp Thr Pro Glu Trp Ile Gln Arg Leu325
330 335Thr Ile Ile Gln His Gly Ile Asp Asp Ser Asn Phe
Asp Leu Ser Asp340 345 350Met Val Gln Trp
Ala Phe Asp Asn Asp Leu Thr Asp Glu Ser Asp Met355 360
365Ala Phe Gln Tyr Ala Gln Leu Ala Asp Cys Asn Ser Asn Ala
Ala Ala370 375 380Phe Leu Lys Ser Asn Cys
Gln Ala Lys Tyr Leu Lys Asp Cys Ala Val385 390
395 400Met Cys Arg His Tyr Lys Arg Ala Gln Lys Arg
Gln Met Asn Met Ser405 410 415Gln Trp Ile
Lys Tyr Arg Cys Ser Lys Ile Asp Glu Gly Gly Asp Trp420
425 430Arg Pro Ile Val Gln Phe Leu Arg Tyr Gln Gly Val
Glu Phe Ile Ser435 440 445Phe Leu Arg Ala
Leu Lys Glu Phe Leu Lys Gly Thr Pro Lys Lys Asn450 455
460Cys Ile Leu Leu Tyr Gly Pro Ala Asn Thr Gly Lys Ser Tyr
Phe Gly465 470 475 480Met
Ser Phe Ile His Phe Leu Gln Gly Ala Ile Ile Ser Phe Val Asn485
490 495Ser Asn Ser His Phe Trp Leu Glu Pro Leu Ala
Asp Thr Lys Val Ala500 505 510Met Leu Asp
Asp Ala Thr His Thr Cys Trp Thr Tyr Phe Asp Asn Tyr515
520 525Met Arg Asn Ala Leu Asp Gly Asn Pro Ile Ser Ile
Asp Arg Lys His530 535 540Lys Pro Leu Leu
Gln Leu Lys Cys Pro Pro Ile Leu Leu Thr Ser Asn545 550
555 560Ile Asp Pro Ala Lys Asp Asn Lys Trp
Pro Tyr Leu Glu Ser Arg Val565 570 575Thr
Val Phe Thr Phe Pro His Ala Phe Pro Phe Asp Lys Asn Gly Asn580
585 590Pro Val Tyr Glu Ile Asn Asp Lys Asn Trp Lys
Cys Phe Phe Glu Arg595 600 605Thr Trp Ser
Arg Leu Asp Leu His Glu Asp Asp Glu Asp Ala Asp Thr610
615 620Glu Gly Ile Pro Phe Gly Thr Phe Lys Cys Val Thr
Gly Gln Asn Thr625 630 635
640Arg Pro Leu50368PRTHuman papillomavirus type 45 50Met Lys Met Gln Thr
Pro Lys Glu Ser Leu Ser Glu Arg Leu Ser Ala1 5
10 15Leu Gln Asp Lys Ile Leu Asp His Tyr Glu Asn Asp
Ser Lys Asp Ile20 25 30Asn Ser Gln Ile
Ser Tyr Trp Gln Leu Ile Arg Leu Glu Asn Ala Ile35 40
45Leu Phe Thr Ala Arg Glu His Gly Ile Thr Lys Leu Asn His
Gln Val50 55 60Val Pro Pro Ile Asn Ile
Ser Lys Ser Lys Ala His Lys Ala Ile Glu65 70
75 80Leu Gln Met Ala Leu Lys Gly Leu Ala Gln Ser
Lys Tyr Asn Asn Glu85 90 95Glu Trp Thr
Leu Gln Asp Thr Cys Glu Glu Leu Trp Asn Thr Glu Pro100
105 110Ser Gln Cys Phe Lys Lys Gly Gly Lys Thr Val His
Val Tyr Phe Asp115 120 125Gly Asn Lys Asp
Asn Cys Met Asn Tyr Val Val Trp Asp Ser Ile Tyr130 135
140Tyr Ile Thr Glu Thr Gly Ile Trp Asp Lys Thr Ala Ala Cys
Val Ser145 150 155 160Tyr
Trp Gly Val Tyr Tyr Ile Lys Asp Gly Asp Thr Thr Tyr Tyr Val165
170 175Gln Phe Lys Ser Glu Cys Glu Lys Tyr Gly Asn
Ser Asn Thr Trp Glu180 185 190Val Gln Tyr
Gly Gly Asn Val Ile Asp Cys Asn Asp Ser Met Cys Ser195
200 205Thr Ser Asp Asp Thr Val Ser Ala Thr Gln Ile Val
Arg Gln Leu Gln210 215 220His Ala Ser Thr
Ser Thr Pro Lys Thr Ala Ser Val Gly Thr Pro Lys225 230
235 240Pro His Ile Gln Thr Pro Ala Thr Lys
Arg Pro Arg Gln Cys Gly Leu245 250 255Thr
Glu Gln His His Gly Arg Val Asn Thr His Val His Asn Pro Leu260
265 270Leu Cys Ser Ser Thr Ser Asn Asn Lys Arg Arg
Lys Val Cys Ser Gly275 280 285Asn Thr Thr
Pro Ile Ile His Leu Lys Gly Asp Lys Asn Ser Leu Lys290
295 300Cys Leu Arg Tyr Arg Leu Arg Lys Tyr Ala Asp His
Tyr Ser Glu Ile305 310 315
320Ser Ser Thr Trp His Trp Thr Gly Cys Asn Lys Asn Thr Gly Ile Leu325
330 335Thr Val Thr Tyr Asn Ser Glu Val Gln
Arg Asn Thr Phe Leu Asp Val340 345 350Val
Thr Ile Pro Asn Ser Val Gln Ile Ser Val Gly Tyr Met Thr Ile355
360 36551158PRTHuman papillomavirus type 45 51Met
Ala Arg Phe Asp Asp Pro Thr Gln Arg Pro Tyr Lys Leu Pro Asp1
5 10 15Leu Cys Thr Glu Leu Asn Thr Ser
Leu Gln Asp Val Ser Ile Ala Cys20 25
30Val Tyr Cys Lys Ala Thr Leu Glu Arg Thr Glu Val Tyr Gln Phe Ala35
40 45Phe Lys Asp Leu Phe Ile Val Tyr Arg Asp
Cys Ile Ala Tyr Ala Ala50 55 60Cys His
Lys Cys Ile Asp Phe Tyr Ser Arg Ile Arg Glu Leu Arg Tyr65
70 75 80Tyr Ser Asn Ser Val Tyr Gly
Glu Thr Leu Glu Lys Ile Thr Asn Thr85 90
95Glu Leu Tyr Asn Leu Leu Ile Arg Cys Leu Arg Cys Gln Lys Pro Leu100
105 110Asn Pro Ala Glu Lys Arg Arg His Leu
Lys Asp Lys Arg Arg Phe His115 120 125Ser
Ile Ala Gly Gln Tyr Arg Gly Gln Cys Asn Thr Cys Cys Asp Gln130
135 140Ala Arg Gln Glu Arg Leu Arg Arg Arg Arg Glu
Thr Gln Val145 150 15552106PRTHuman
papillomavirus type 45 52Met His Gly Pro Arg Ala Thr Leu Gln Glu Ile Val
Leu His Leu Glu1 5 10
15Pro Gln Asn Glu Leu Asp Pro Val Asp Leu Leu Cys Tyr Glu Gln Leu20
25 30Ser Glu Ser Glu Glu Glu Asn Asp Glu Ala
Asp Gly Val Ser His Ala35 40 45Gln Leu
Pro Ala Arg Arg Ala Glu Pro Gln Arg His Lys Ile Leu Cys50
55 60Val Cys Cys Lys Cys Asp Gly Arg Ile Glu Leu Thr
Val Glu Ser Ser65 70 75
80Ala Asp Asp Leu Arg Thr Leu Gln Gln Leu Phe Leu Ser Thr Leu Ser85
90 95Phe Val Cys Pro Trp Cys Ala Thr Asn
Gln100 10553536PRTHuman papillomavirus type 45 53Met Ala
His Asn Ile Ile Tyr Gly His Gly Ile Ile Ile Phe Leu Lys1 5
10 15Asn Val Asn Val Phe Pro Ile Phe Leu
Gln Met Ala Leu Trp Arg Pro20 25 30Ser
Asp Ser Thr Val Tyr Leu Pro Pro Pro Ser Val Ala Arg Val Val35
40 45Asn Thr Asp Asp Tyr Val Ser Arg Thr Ser Ile
Phe Tyr His Ala Gly50 55 60Ser Ser Arg
Leu Leu Thr Val Gly Asn Pro Tyr Phe Arg Val Val Pro65 70
75 80Ser Gly Ala Gly Asn Lys Gln Ala
Val Pro Lys Val Ser Ala Tyr Gln85 90
95Tyr Arg Val Phe Arg Val Ala Leu Pro Asp Pro Asn Lys Phe Gly Leu100
105 110Pro Asp Ser Thr Ile Tyr Asn Pro Glu Thr
Gln Arg Leu Val Trp Ala115 120 125Cys Val
Gly Met Glu Ile Gly Arg Gly Gln Pro Leu Gly Ile Gly Leu130
135 140Ser Gly His Pro Phe Tyr Asn Lys Leu Asp Asp Thr
Glu Ser Ala His145 150 155
160Ala Ala Thr Ala Val Ile Thr Gln Asp Val Arg Asp Asn Val Ser Val165
170 175Asp Tyr Lys Gln Thr Gln Leu Cys Ile
Leu Gly Cys Val Pro Ala Ile180 185 190Gly
Glu His Trp Ala Lys Gly Thr Leu Cys Lys Pro Ala Gln Leu Gln195
200 205Pro Gly Asp Cys Pro Pro Leu Glu Leu Lys Asn
Thr Ile Ile Glu Asp210 215 220Gly Asp Met
Val Asp Thr Gly Tyr Gly Ala Met Asp Phe Ser Thr Leu225
230 235 240Gln Asp Thr Lys Cys Glu Val
Pro Leu Asp Ile Cys Gln Ser Ile Cys245 250
255Lys Tyr Pro Asp Tyr Leu Gln Met Ser Ala Asp Pro Tyr Gly Asp Ser260
265 270Met Phe Phe Cys Leu Arg Arg Glu Gln
Leu Phe Ala Arg His Phe Trp275 280 285Asn
Arg Ala Gly Val Met Gly Asp Thr Val Pro Thr Asp Leu Tyr Ile290
295 300Lys Gly Thr Ser Ala Asn Met Arg Glu Thr Pro
Gly Ser Cys Val Tyr305 310 315
320Ser Pro Ser Pro Ser Gly Ser Ile Thr Thr Ser Asp Ser Gln Leu
Phe325 330 335Asn Lys Pro Tyr Trp Leu His
Lys Ala Gln Gly His Asn Asn Gly Ile340 345
350Cys Trp His Asn Gln Leu Phe Val Thr Val Val Asp Thr Thr Arg Ser355
360 365Thr Asn Leu Thr Leu Cys Ala Ser Thr
Gln Asn Pro Val Pro Asn Thr370 375 380Tyr
Asp Pro Thr Lys Phe Lys His Tyr Ser Arg His Val Glu Glu Tyr385
390 395 400Asp Leu Gln Phe Ile Phe
Gln Leu Cys Thr Ile Thr Leu Thr Ala Glu405 410
415Val Met Ser Tyr Ile His Ser Met Asn Ser Ser Ile Leu Glu Asn
Trp420 425 430Asn Phe Gly Val Pro Pro Pro
Pro Thr Thr Ser Leu Val Asp Thr Tyr435 440
445Arg Phe Val Gln Ser Val Ala Val Thr Cys Gln Lys Asp Thr Thr Pro450
455 460Pro Glu Lys Gln Asp Pro Tyr Asp Lys
Leu Lys Phe Trp Thr Val Asp465 470 475
480Leu Lys Glu Lys Phe Ser Ser Asp Leu Asp Gln Tyr Pro Leu
Gly Arg485 490 495Lys Phe Leu Val Gln Ala
Gly Leu Arg Arg Arg Pro Thr Ile Gly Pro500 505
510Arg Lys Arg Pro Ala Ala Ser Thr Ser Thr Ala Ser Arg Pro Ala
Lys515 520 525Arg Val Arg Ile Arg Ser Lys
Lys530 53554463PRTHuman papillomavirus type 45 54Met Val
Ser His Arg Ala Ala Arg Arg Lys Arg Ala Ser Ala Thr Asp1 5
10 15Leu Tyr Arg Thr Cys Lys Gln Ser Gly
Thr Cys Pro Pro Asp Val Ile20 25 30Asn
Lys Val Glu Gly Thr Thr Leu Ala Asp Lys Ile Leu Gln Trp Ser35
40 45Ser Leu Gly Ile Phe Leu Gly Gly Leu Gly Ile
Gly Thr Gly Ser Gly50 55 60Ser Gly Gly
Arg Thr Gly Tyr Val Pro Leu Gly Gly Arg Ser Asn Thr65 70
75 80Val Val Asp Val Gly Pro Thr Arg
Pro Pro Val Val Ile Glu Pro Val85 90
95Gly Pro Thr Asp Pro Ser Ile Val Thr Leu Val Glu Asp Ser Ser Val100
105 110Val Ala Ser Gly Ala Pro Val Pro Thr Phe
Thr Gly Thr Ser Gly Phe115 120 125Glu Ile
Thr Ser Ser Gly Thr Thr Thr Pro Ala Val Leu Asp Ile Thr130
135 140Pro Thr Val Asp Ser Val Ser Ile Ser Ser Thr Ser
Phe Thr Asn Pro145 150 155
160Ala Phe Ser Asp Pro Ser Ile Ile Glu Val Pro Gln Thr Gly Glu Val165
170 175Ser Gly Asn Ile Phe Val Gly Thr Pro
Thr Ser Gly Ser His Gly Tyr180 185 190Glu
Glu Ile Pro Leu Gln Thr Phe Ala Ser Ser Gly Ser Gly Thr Glu195
200 205Pro Ile Ser Ser Thr Pro Leu Pro Thr Val Arg
Arg Val Arg Gly Pro210 215 220Arg Leu Tyr
Ser Arg Ala Asn Gln Gln Val Arg Val Ser Thr Ser Gln225
230 235 240Phe Leu Thr His Pro Ser Ser
Leu Val Thr Phe Asp Asn Pro Ala Tyr245 250
255Glu Pro Leu Asp Thr Thr Leu Ser Phe Glu Pro Thr Ser Asn Val Pro260
265 270Asp Ser Asp Phe Met Asp Ile Ile Arg
Leu His Arg Pro Ala Leu Ser275 280 285Ser
Arg Arg Gly Thr Val Arg Phe Ser Arg Leu Gly Gln Arg Ala Thr290
295 300Met Phe Thr Arg Ser Gly Lys Gln Ile Gly Gly
Arg Val His Phe Tyr305 310 315
320His Asp Ile Ser Pro Ile Ala Ala Thr Glu Glu Ile Glu Leu Gln
Pro325 330 335Leu Ile Ser Ala Thr Asn Asp
Ser Asp Leu Phe Asp Val Tyr Ala Asp340 345
350Phe Pro Pro Pro Ala Ser Thr Thr Pro Ser Thr Ile His Lys Ser Phe355
360 365Thr Tyr Pro Lys Tyr Ser Leu Thr Met
Pro Ser Thr Ala Ala Ser Ser370 375 380Tyr
Ser Asn Val Thr Val Pro Leu Thr Ser Ala Trp Asp Val Pro Ile385
390 395 400Tyr Thr Gly Pro Asp Ile
Ile Leu Pro Ser His Thr Pro Met Trp Pro405 410
415Ser Thr Ser Pro Thr Asn Ala Ser Thr Thr Thr Tyr Ile Gly Ile
His420 425 430Gly Thr Gln Tyr Tyr Leu Trp
Pro Trp Tyr Tyr Tyr Phe Pro Lys Lys435 440
445Arg Lys Arg Ile Pro Tyr Phe Phe Ala Asp Gly Phe Val Ala Ala450
455 46055644PRTHuman papillomavirus type 33
55Met Ala Asp Pro Glu Gly Thr Asn Gly Ala Gly Met Gly Cys Thr Gly1
5 10 15Trp Phe Glu Val Glu Ala
Val Ile Glu Arg Arg Thr Gly Asp Asn Ile20 25
30Ser Glu Asp Glu Asp Glu Thr Ala Asp Asp Ser Gly Thr Asp Leu Leu35
40 45Glu Phe Ile Asp Asp Ser Met Glu Asn
Ser Ile Gln Ala Asp Thr Glu50 55 60Ala
Ala Arg Ala Leu Phe Asn Ile Gln Glu Gly Glu Asp Asp Leu Asn65
70 75 80Ala Val Cys Ala Leu Lys
Arg Lys Phe Ala Ala Cys Ser Gln Ser Ala85 90
95Ala Glu Asp Val Val Asp Arg Ala Ala Asn Pro Cys Arg Thr Ser Ile100
105 110Asn Lys Asn Lys Glu Cys Thr Tyr
Arg Lys Arg Lys Ile Asp Glu Leu115 120
125Glu Asp Ser Gly Tyr Gly Asn Thr Glu Val Glu Thr Gln Gln Met Val130
135 140Gln Gln Val Glu Ser Gln Asn Gly Asp
Thr Asn Leu Asn Asp Leu Glu145 150 155
160Ser Ser Gly Val Gly Asp Asp Ser Glu Val Ser Cys Glu Thr
Asn Val165 170 175Asp Ser Cys Glu Asn Val
Thr Leu Gln Glu Ile Ser Asn Val Leu His180 185
190Ser Ser Asn Thr Lys Ala Asn Ile Leu Tyr Lys Phe Lys Glu Ala
Tyr195 200 205Gly Ile Ser Phe Met Glu Leu
Val Arg Pro Phe Lys Ser Asp Lys Thr210 215
220Ser Cys Thr Asp Trp Cys Ile Thr Gly Tyr Gly Ile Ser Pro Ser Val225
230 235 240Ala Glu Ser Leu
Lys Val Leu Ile Lys Gln His Ser Leu Tyr Thr His245 250
255Leu Gln Cys Leu Thr Cys Asp Arg Gly Ile Ile Ile Leu Leu
Leu Ile260 265 270Arg Phe Arg Cys Ser Lys
Asn Arg Leu Thr Val Ala Lys Leu Met Ser275 280
285Asn Leu Leu Ser Ile Pro Glu Thr Cys Met Val Ile Glu Pro Pro
Lys290 295 300Leu Arg Ser Gln Thr Cys Ala
Leu Tyr Trp Phe Arg Thr Ala Met Ser305 310
315 320Asn Ile Ser Asp Val Gln Gly Thr Thr Pro Glu Trp
Ile Asp Arg Leu325 330 335Thr Val Leu Gln
His Ser Phe Asn Asp Asn Ile Phe Asp Leu Ser Glu340 345
350Met Val Gln Trp Ala Tyr Asp Asn Glu Leu Thr Asp Asp Ser
Asp Ile355 360 365Ala Tyr Tyr Tyr Ala Gln
Leu Ala Asp Ser Asn Ser Asn Ala Ala Ala370 375
380Phe Leu Lys Ser Asn Ser Gln Ala Lys Ile Val Lys Asp Cys Gly
Ile385 390 395 400Met Cys
Arg His Tyr Lys Lys Ala Glu Lys Arg Lys Met Ser Ile Gly405
410 415Gln Trp Ile Gln Ser Arg Cys Glu Lys Thr Asn Asp
Gly Gly Asn Trp420 425 430Arg Pro Ile Val
Gln Leu Leu Arg Tyr Gln Asn Ile Glu Phe Thr Ala435 440
445Phe Leu Gly Ala Phe Lys Lys Phe Leu Lys Gly Ile Pro Lys
Lys Ser450 455 460Cys Met Leu Ile Cys Gly
Pro Ala Asn Thr Gly Lys Ser Tyr Phe Gly465 470
475 480Met Ser Leu Ile Gln Phe Leu Lys Gly Cys Val
Ile Ser Cys Val Asn485 490 495Ser Lys Ser
His Phe Trp Leu Gln Pro Leu Ser Asp Ala Lys Ile Gly500
505 510Met Ile Asp Asp Val Thr Pro Ile Ser Trp Thr Tyr
Ile Asp Asp Tyr515 520 525Met Arg Asn Ala
Leu Asp Gly Asn Glu Ile Ser Ile Asp Val Lys His530 535
540Arg Ala Leu Val Gln Leu Lys Cys Pro Pro Leu Leu Leu Thr
Ser Asn545 550 555 560Thr
Asn Ala Gly Thr Asp Ser Arg Trp Pro Tyr Leu His Ser Arg Leu565
570 575Thr Val Phe Glu Phe Lys Asn Pro Phe Pro Phe
Asp Glu Asn Gly Asn580 585 590Pro Val Tyr
Ala Ile Asn Asp Glu Asn Trp Lys Ser Phe Phe Ser Arg595
600 605Thr Trp Cys Lys Leu Asp Leu Ile Glu Glu Glu Asp
Lys Glu Asn His610 615 620Gly Gly Asn Ile
Ser Thr Phe Lys Cys Ser Ala Gly Glu Asn Thr Arg625 630
635 640Ser Leu Arg Ser56353PRTHuman
papillomavirus type 33 56Met Glu Glu Ile Ser Ala Arg Leu Asn Ala Val Gln
Glu Lys Ile Leu1 5 10
15Asp Leu Tyr Glu Ala Asp Lys Thr Asp Leu Pro Ser Gln Ile Glu His20
25 30Trp Lys Leu Ile Arg Met Glu Cys Ala Leu
Leu Tyr Thr Ala Lys Gln35 40 45Met Gly
Phe Ser His Leu Cys His Gln Val Val Pro Ser Leu Leu Ala50
55 60Ser Lys Thr Lys Ala Phe Gln Val Ile Glu Leu Gln
Met Ala Leu Glu65 70 75
80Thr Leu Ser Lys Ser Gln Tyr Ser Thr Ser Gln Trp Thr Leu Gln Gln85
90 95Thr Ser Leu Glu Val Trp Leu Cys Glu Pro
Pro Lys Cys Phe Lys Lys100 105 110Gln Gly
Glu Thr Val Thr Val Gln Tyr Asp Asn Asp Lys Lys Asn Thr115
120 125Met Asp Tyr Thr Asn Trp Gly Glu Ile Tyr Ile Ile
Glu Glu Asp Thr130 135 140Cys Thr Met Val
Thr Gly Lys Val Asp Tyr Ile Gly Met Tyr Tyr Ile145 150
155 160His Asn Cys Glu Lys Val Tyr Phe Lys
Tyr Phe Lys Glu Asp Ala Ala165 170 175Lys
Tyr Ser Lys Thr Gln Met Trp Glu Val His Val Gly Gly Gln Val180
185 190Ile Val Cys Pro Thr Ser Ile Ser Ser Asn Gln
Ile Ser Thr Thr Glu195 200 205Thr Ala Asp
Ile Gln Thr Asp Asn Asp Asn Arg Pro Pro Gln Ala Ala210
215 220Ala Lys Arg Arg Arg Pro Ala Asp Thr Thr Asp Thr
Ala Gln Pro Leu225 230 235
240Thr Lys Leu Phe Cys Ala Asp Pro Ala Leu Asp Asn Arg Thr Ala Arg245
250 255Thr Ala Thr Asn Cys Thr Asn Lys Gln
Arg Thr Val Cys Ser Ser Asn260 265 270Val
Ala Pro Ile Val His Leu Lys Gly Glu Ser Asn Ser Leu Lys Cys275
280 285Leu Arg Tyr Arg Leu Lys Pro Tyr Lys Glu Leu
Tyr Ser Ser Met Ser290 295 300Ser Thr Trp
His Trp Thr Ser Asp Asn Lys Asn Ser Lys Asn Gly Ile305
310 315 320Val Thr Val Thr Phe Val Thr
Glu Gln Gln Gln Gln Met Phe Leu Gly325 330
335Thr Val Lys Ile Pro Pro Thr Val Gln Ile Ser Thr Gly Phe Met Thr340
345 350Leu5775PRTHuman papillomavirus type
33 57Met Ile Phe Val Phe Val Leu Cys Phe Ile Leu Phe Leu Cys Leu Ser1
5 10 15Leu Leu Leu Arg Pro
Leu Ile Leu Ser Ile Ser Thr Tyr Ala Trp Leu20 25
30Leu Val Leu Val Leu Leu Leu Trp Val Phe Val Gly Ser Pro Leu
Lys35 40 45Ile Phe Phe Cys Tyr Leu Leu
Phe Leu Tyr Leu Pro Met Met Cys Ile50 55
60Asn Phe His Ala Gln His Met Thr Gln Gln Glu65 70
7558149PRTHuman papillomavirus type 33 58Met Phe Gln Asp Thr
Glu Glu Lys Pro Arg Thr Leu His Asp Leu Cys1 5
10 15Gln Ala Leu Glu Thr Thr Ile His Asn Ile Glu Leu
Gln Cys Val Glu20 25 30Cys Lys Lys Pro
Leu Gln Arg Ser Glu Val Tyr Asp Phe Ala Phe Ala35 40
45Asp Leu Thr Val Val Tyr Arg Glu Gly Asn Pro Phe Gly Ile
Cys Lys50 55 60Leu Cys Leu Arg Phe Leu
Ser Lys Ile Ser Glu Tyr Arg His Tyr Asn65 70
75 80Tyr Ser Val Tyr Gly Asn Thr Leu Glu Gln Thr
Val Lys Lys Pro Leu85 90 95Asn Glu Ile
Leu Ile Arg Cys Ile Ile Cys Gln Arg Pro Leu Cys Pro100
105 110Gln Glu Lys Lys Arg His Val Asp Leu Asn Lys Arg
Phe His Asn Ile115 120 125Ser Gly Arg Trp
Ala Gly Arg Cys Ala Ala Cys Trp Arg Ser Arg Arg130 135
140Arg Glu Thr Ala Leu1455997PRTHuman papillomavirus type 33
59Met Arg Gly His Lys Pro Thr Leu Lys Glu Tyr Val Leu Asp Leu Tyr1
5 10 15Pro Glu Pro Thr Asp Leu
Tyr Cys Tyr Glu Gln Leu Ser Asp Ser Ser20 25
30Asp Glu Asp Glu Gly Leu Asp Arg Pro Asp Gly Gln Ala Gln Pro Ala35
40 45Thr Ala Asp Tyr Tyr Ile Val Thr Cys
Cys His Thr Cys Asn Thr Thr50 55 60Val
Arg Leu Cys Val Asn Ser Thr Ala Ser Asp Leu Arg Thr Ile Gln65
70 75 80Gln Leu Leu Met Gly Thr
Val Asn Ile Val Cys Pro Thr Cys Ala Gln85 90
95Gln60499PRTHuman papillomavirus type 33 60Met Ser Val Trp Arg Pro
Ser Glu Ala Thr Val Tyr Leu Pro Pro Val1 5
10 15Pro Val Ser Lys Val Val Ser Thr Asp Glu Tyr Val Ser
Arg Thr Ser20 25 30Ile Tyr Tyr Tyr Ala
Gly Ser Ser Arg Leu Leu Ala Val Gly His Pro35 40
45Tyr Phe Ser Ile Lys Asn Pro Thr Asn Ala Lys Lys Leu Leu Val
Pro50 55 60Lys Val Ser Gly Leu Gln Tyr
Arg Val Phe Arg Val Arg Leu Pro Asp65 70
75 80Pro Asn Lys Phe Gly Phe Pro Asp Thr Ser Phe Tyr
Asn Pro Asp Thr85 90 95Gln Arg Leu Val
Trp Ala Cys Val Gly Leu Glu Ile Gly Arg Gly Gln100 105
110Pro Leu Gly Val Gly Ile Ser Gly His Pro Leu Leu Asn Lys
Phe Asp115 120 125Asp Thr Glu Thr Gly Asn
Lys Tyr Pro Gly Gln Pro Gly Ala Asp Asn130 135
140Arg Glu Cys Leu Ser Met Asp Tyr Lys Gln Thr Gln Leu Cys Leu
Leu145 150 155 160Gly Cys
Lys Pro Pro Thr Gly Glu His Trp Gly Lys Gly Val Ala Cys165
170 175Thr Asn Ala Ala Pro Ala Asn Asp Cys Pro Pro Leu
Glu Leu Ile Asn180 185 190Thr Ile Ile Glu
Asp Gly Asp Met Val Asp Thr Gly Phe Gly Cys Met195 200
205Asp Phe Lys Thr Leu Gln Ala Asn Lys Ser Asp Val Pro Ile
Asp Ile210 215 220Cys Gly Ser Thr Cys Lys
Tyr Pro Asp Tyr Leu Lys Met Thr Ser Glu225 230
235 240Pro Tyr Gly Asp Ser Leu Phe Phe Phe Leu Arg
Arg Glu Gln Met Phe245 250 255Val Arg His
Phe Phe Asn Arg Ala Gly Thr Leu Gly Glu Ala Val Pro260
265 270Asp Asp Leu Tyr Ile Lys Gly Ser Gly Thr Thr Ala
Ser Ile Gln Ser275 280 285Ser Ala Phe Phe
Pro Thr Pro Ser Gly Ser Met Val Thr Ser Glu Ser290 295
300Gln Leu Phe Asn Lys Pro Tyr Trp Leu Gln Arg Ala Gln Gly
His Asn305 310 315 320Asn
Gly Ile Cys Trp Gly Asn Gln Val Phe Val Thr Val Val Asp Thr325
330 335Thr Arg Ser Thr Asn Met Thr Leu Cys Thr Gln
Val Thr Ser Asp Ser340 345 350Thr Tyr Lys
Asn Glu Asn Phe Lys Glu Tyr Ile Arg His Val Glu Glu355
360 365Tyr Asp Leu Gln Phe Val Phe Gln Leu Cys Lys Val
Thr Leu Thr Ala370 375 380Glu Val Met Thr
Tyr Ile His Ala Met Asn Pro Asp Ile Leu Glu Asp385 390
395 400Trp Gln Phe Gly Leu Thr Pro Pro Pro
Ser Ala Ser Leu Gln Asp Thr405 410 415Tyr
Arg Phe Val Thr Ser Gln Ala Ile Thr Cys Gln Lys Thr Val Pro420
425 430Pro Lys Glu Lys Glu Asp Pro Leu Gly Lys Tyr
Thr Phe Trp Glu Val435 440 445Asp Leu Lys
Glu Lys Phe Ser Ala Asp Leu Asp Gln Phe Pro Leu Gly450
455 460Arg Lys Phe Leu Leu Gln Ala Gly Leu Lys Ala Lys
Pro Lys Leu Lys465 470 475
480Arg Ala Ala Pro Thr Ser Thr Arg Thr Ser Ser Ala Lys Arg Lys Lys485
490 495Val Lys Lys61467PRTHuman
papillomavirus type 33 61Met Arg His Lys Arg Ser Thr Arg Arg Lys Arg Ala
Ser Ala Thr Gln1 5 10
15Leu Tyr Gln Thr Cys Lys Ala Thr Gly Thr Cys Pro Pro Asp Val Ile20
25 30Pro Lys Val Glu Gly Ser Thr Ile Ala Asp
Gln Ile Leu Lys Tyr Gly35 40 45Ser Leu
Gly Val Phe Phe Gly Gly Leu Gly Ile Gly Thr Gly Ser Gly50
55 60Ser Gly Gly Arg Thr Gly Tyr Val Pro Ile Gly Thr
Asp Pro Pro Thr65 70 75
80Ala Ala Ile Pro Leu Gln Pro Ile Arg Pro Pro Val Thr Val Asp Thr85
90 95Val Gly Pro Leu Asp Ser Ser Ile Val Ser
Leu Ile Glu Glu Thr Ser100 105 110Phe Ile
Glu Ala Gly Ala Pro Ala Pro Ser Ile Pro Thr Pro Ser Gly115
120 125Phe Asp Val Thr Thr Ser Ala Asp Thr Thr Pro Ala
Ile Ile Asn Val130 135 140Ser Ser Val Gly
Glu Ser Ser Ile Gln Thr Ile Ser Thr His Leu Asn145 150
155 160Pro Thr Phe Thr Glu Pro Ser Val Leu
His Pro Pro Ala Pro Ala Glu165 170 175Ala
Ser Gly His Phe Ile Phe Ser Ser Pro Thr Val Ser Thr Gln Ser180
185 190Tyr Glu Asn Ile Pro Met Asp Thr Phe Val Val
Ser Thr Asp Ser Ser195 200 205Asn Val Thr
Ser Ser Thr Pro Ile Pro Gly Ser Arg Pro Val Ala Arg210
215 220Leu Gly Leu Tyr Ser Arg Asn Thr Gln Gln Val Lys
Val Val Asp Pro225 230 235
240Ala Phe Leu Thr Ser Pro His Lys Leu Ile Thr Tyr Asp Asn Pro Ala245
250 255Phe Glu Ser Phe Asp Pro Glu Asp Thr
Leu Gln Phe Gln His Ser Asp260 265 270Ile
Ser Pro Ala Pro Asp Pro Asp Phe Leu Asp Ile Ile Ala Leu His275
280 285Arg Pro Ala Ile Thr Ser Arg Arg His Thr Val
Arg Phe Ser Arg Val290 295 300Gly Gln Lys
Ala Thr Leu Lys Thr Arg Ser Gly Lys Gln Ile Gly Ala305
310 315 320Arg Ile His Tyr Tyr Gln Asp
Leu Ser Pro Ile Val Pro Leu Asp His325 330
335Thr Val Pro Asn Glu Gln Tyr Glu Leu Gln Pro Leu His Asp Thr Ser340
345 350Thr Ser Ser Tyr Ser Ile Asn Asp Gly
Leu Tyr Asp Val Tyr Ala Asp355 360 365Asp
Val Asp Asn Val His Thr Pro Met Gln His Ser Tyr Ser Thr Phe370
375 380Ala Thr Thr Arg Thr Ser Asn Val Ser Ile Pro
Leu Asn Thr Gly Phe385 390 395
400Asp Thr Pro Val Met Ser Gly Pro Asp Ile Pro Ser Pro Leu Phe
Pro405 410 415Thr Ser Ser Pro Phe Val Pro
Ile Ser Pro Phe Phe Pro Phe Asp Thr420 425
430Ile Val Val Asp Gly Ala Asp Phe Val Leu His Pro Ser Tyr Phe Ile435
440 445Leu Arg Arg Arg Arg Lys Arg Phe Pro
Tyr Phe Phe Thr Asp Val Arg450 455 460Val
Ala Ala46562310PRTHuman papillomavirus type 56 62Met Val Pro Cys Leu Gln
Val Cys Lys Ala Lys Ala Cys Ser Ala Ile1 5
10 15Glu Val Gln Ile Ala Leu Glu Ser Leu Ser Thr Thr Ile
Tyr Asn Asn20 25 30Glu Glu Trp Thr Leu
Arg Asp Thr Cys Glu Glu Leu Trp Leu Thr Glu35 40
45Pro Lys Lys Cys Phe Lys Lys Glu Gly Gln His Ile Glu Val Trp
Phe50 55 60Asp Gly Ser Lys Asn Asn Cys
Met Gln Tyr Val Ala Trp Lys Tyr Ile65 70
75 80Tyr Tyr Asn Gly Asp Cys Gly Trp Gln Lys Val Cys
Ser Gly Val Asp85 90 95Tyr Arg Gly Ile
Tyr Tyr Val His Asp Gly His Lys Thr Tyr Tyr Thr100 105
110Asp Phe Glu Gln Glu Ala Lys Lys Phe Gly Cys Lys Asn Ile
Trp Glu115 120 125Val His Met Glu Asn Glu
Ser Ile Tyr Cys Pro Asp Ser Val Ser Ser130 135
140Thr Cys Arg Tyr Asn Val Ser Pro Val Glu Thr Val Asn Glu Tyr
Asn145 150 155 160Thr His
Lys Thr Thr Thr Thr Thr Ser Thr Ser Val Gly Asn Gln Asp165
170 175Ala Ala Val Ser His Arg Pro Gly Lys Arg Pro Arg
Leu Arg Glu Ser180 185 190Glu Phe Asp Ser
Ser Arg Glu Ser His Ala Lys Cys Val Thr Thr His195 200
205Thr His Ile Ser Asp Thr Asp Asn Thr Asp Ser Arg Ser Arg
Ser Ile210 215 220Asn Asn Asn Asn His Pro
Gly Asp Lys Thr Thr Pro Val Val His Leu225 230
235 240Lys Gly Glu Pro Asn Arg Leu Lys Cys Cys Arg
Tyr Arg Phe Gln Lys245 250 255Tyr Lys Thr
Leu Phe Val Asp Val Thr Ser Thr Tyr His Trp Thr Ser260
265 270Thr Asp Asn Lys Asn Tyr Ser Ile Ile Thr Ile Ile
Tyr Lys Asp Glu275 280 285Thr Gln Arg Asn
Ser Phe Leu Ser His Val Lys Ile Pro Val Val Tyr290 295
300Arg Leu Val Trp Asp Lys305
31063155PRTHuman papillomavirus type 56 63Met Glu Pro Gln Phe Asn Asn Pro
Gln Glu Arg Pro Arg Ser Leu His1 5 10
15His Leu Ser Glu Val Leu Glu Ile Pro Leu Ile Asp Leu Arg Leu
Ser20 25 30Cys Val Tyr Cys Lys Lys Glu
Leu Thr Arg Ala Glu Val Tyr Asn Phe35 40
45Ala Cys Thr Glu Leu Lys Leu Val Tyr Arg Asp Asp Phe Pro Tyr Ala50
55 60Val Cys Arg Val Cys Leu Leu Phe Tyr Ser
Lys Val Arg Lys Tyr Arg65 70 75
80Tyr Tyr Asp Tyr Ser Val Tyr Gly Ala Thr Leu Glu Ser Ile Thr
Lys85 90 95Lys Gln Leu Cys Asp Leu Leu
Ile Arg Cys Tyr Arg Cys Gln Ser Pro100 105
110Leu Thr Pro Glu Glu Lys Gln Leu His Cys Asp Arg Lys Arg Arg Phe115
120 125His Leu Ile Ala His Gly Trp Thr Gly
Ser Cys Leu Gly Cys Trp Arg130 135 140Gln
Thr Ser Arg Glu Pro Arg Glu Ser Thr Val145 150
15564105PRTHuman papillomavirus type 56 64Met His Gly Lys Val Pro
Thr Leu Gln Asp Val Val Leu Glu Leu Thr1 5
10 15Pro Gln Thr Glu Ile Asp Leu Gln Cys Asn Glu Gln Leu
Asp Ser Ser20 25 30Glu Asp Glu Asp Glu
Asp Glu Val Asp His Leu Gln Glu Arg Pro Gln35 40
45Gln Ala Arg Gln Ala Lys Gln His Thr Cys Tyr Leu Ile His Val
Pro50 55 60Cys Cys Glu Cys Lys Phe Val
Val Gln Leu Asp Ile Gln Ser Thr Lys65 70
75 80Glu Asp Leu Arg Val Val Gln Gln Leu Leu Met Gly
Ala Leu Thr Val85 90 95Thr Cys Pro Leu
Cys Ala Ser Ser Asn100 10565534PRTHuman papillomavirus
type 56 65Met Met Leu Pro Met Met Tyr Ile Tyr Arg Asp Pro Pro Leu His
Tyr1 5 10 15Gly Leu Cys
Ile Phe Leu Asp Val Gly Ala Val Asn Val Phe Pro Ile20 25
30Phe Leu Gln Met Ala Thr Trp Arg Pro Ser Glu Asn Lys
Val Tyr Leu35 40 45Pro Pro Thr Pro Val
Ser Lys Val Val Ala Thr Asp Ser Tyr Val Lys50 55
60Arg Thr Ser Ile Phe Tyr His Ala Gly Ser Ser Arg Leu Leu Ala
Val65 70 75 80Gly His
Pro Tyr Tyr Ser Val Thr Lys Asp Asn Thr Lys Thr Asn Ile85
90 95Pro Lys Val Ser Ala Tyr Gln Tyr Arg Val Phe Arg
Val Arg Leu Pro100 105 110Asp Pro Asn Lys
Phe Gly Leu Pro Asp Thr Asn Ile Tyr Asn Pro Asp115 120
125Gln Glu Arg Leu Val Trp Ala Cys Val Gly Leu Glu Val Gly
Arg Gly130 135 140Gln Pro Leu Gly Ala Gly
Leu Ser Gly His Pro Leu Phe Asn Arg Leu145 150
155 160Asp Asp Thr Glu Ser Ser Asn Leu Ala Asn Asn
Asn Val Ile Glu Asp165 170 175Ser Arg Asp
Asn Ile Ser Val Asp Gly Lys Gln Thr Gln Leu Cys Ile180
185 190Val Gly Cys Thr Pro Ala Met Gly Glu His Trp Thr
Lys Gly Ala Val195 200 205Cys Lys Ser Thr
Gln Val Thr Thr Gly Asp Cys Pro Pro Leu Ala Leu210 215
220Ile Asn Thr Pro Ile Glu Asp Gly Asp Met Ile Asp Thr Gly
Phe Gly225 230 235 240Ala
Met Asp Phe Lys Val Leu Gln Glu Ser Lys Ala Glu Val Pro Leu245
250 255Asp Ile Val Gln Ser Thr Cys Lys Tyr Pro Asp
Tyr Leu Lys Met Ser260 265 270Ala Asp Ala
Tyr Gly Asp Ser Met Trp Phe Tyr Leu Arg Arg Glu Gln275
280 285Leu Phe Ala Arg His Tyr Phe Asn Arg Ala Gly Lys
Val Gly Glu Thr290 295 300Ile Pro Ala Glu
Leu Tyr Leu Lys Gly Ser Asn Gly Arg Glu Pro Pro305 310
315 320Pro Ser Ser Val Tyr Val Ala Thr Pro
Ser Gly Ser Met Ile Thr Ser325 330 335Glu
Ala Gln Leu Phe Asn Lys Pro Tyr Trp Leu Gln Arg Ala Gln Gly340
345 350His Asn Asn Gly Ile Cys Trp Gly Asn Gln Leu
Phe Val Thr Val Val355 360 365Asp Thr Thr
Arg Ser Thr Asn Met Thr Ile Ser Thr Ala Thr Glu Gln370
375 380Leu Ser Lys Tyr Asp Ala Arg Lys Ile Asn Gln Tyr
Leu Arg His Val385 390 395
400Glu Glu Tyr Glu Leu Gln Phe Val Phe Gln Leu Cys Lys Ile Thr Leu405
410 415Ser Ala Glu Val Met Ala Tyr Leu His
Asn Met Asn Ala Asn Leu Leu420 425 430Glu
Asp Trp Asn Ile Gly Leu Ser Pro Pro Val Ala Thr Ser Leu Glu435
440 445Asp Lys Tyr Arg Tyr Val Arg Ser Thr Ala Ile
Thr Cys Gln Arg Glu450 455 460Gln Pro Pro
Thr Glu Lys Gln Asp Pro Leu Ala Lys Tyr Lys Phe Trp465
470 475 480Asp Val Asn Leu Gln Asp Ser
Phe Ser Thr Asp Leu Asp Gln Phe Pro485 490
495Leu Gly Arg Lys Phe Leu Met Gln Leu Gly Thr Arg Ser Lys Pro Ala500
505 510Val Ala Thr Ser Lys Lys Arg Ser Ala
Pro Thr Ser Thr Ser Thr Pro515 520 525Ala
Lys Arg Lys Arg Arg53066464PRTHuman papillomavirus type 56 66Met Val Ala
His Arg Ala Thr Arg Arg Lys Arg Ala Ser Ala Thr Gln1 5
10 15Leu Tyr Lys Thr Cys Lys Leu Ser Gly Thr
Cys Pro Glu Asp Val Val20 25 30Asn Lys
Ile Glu Gln Lys Thr Trp Ala Asp Lys Ile Leu Gln Trp Gly35
40 45Ser Leu Phe Thr Tyr Phe Gly Gly Leu Gly Ile Gly
Thr Gly Thr Gly50 55 60Ser Gly Gly Arg
Ala Gly Tyr Val Pro Leu Gly Ser Arg Pro Ser Thr65 70
75 80Ile Val Asp Val Thr Pro Ala Arg Pro
Pro Ile Val Val Glu Ser Val85 90 95Gly
Pro Thr Asp Pro Ser Ile Val Thr Leu Val Glu Glu Ser Ser Val100
105 110Ile Glu Ser Gly Ala Gly Ile Pro Asn Phe Thr
Gly Ser Gly Gly Phe115 120 125Glu Ile Thr
Ser Ser Ser Thr Thr Thr Pro Ala Val Leu Asp Ile Thr130
135 140Pro Thr Ser Ser Thr Val His Val Ser Ser Thr His
Ile Thr Asn Pro145 150 155
160Leu Phe Ile Asp Pro Pro Val Ile Glu Ala Pro Gln Thr Gly Glu Val165
170 175Ser Gly Asn Ile Leu Ile Ser Thr Pro
Thr Ser Gly Ile His Ser Tyr180 185 190Glu
Glu Ile Pro Met Gln Thr Phe Ala Val His Gly Ser Gly Thr Glu195
200 205Pro Ile Ser Ser Thr Pro Ile Pro Gly Phe Arg
Arg Ile Ala Ala Pro210 215 220Arg Leu Tyr
Arg Lys Ala Phe Gln Gln Val Lys Val Thr Asp Pro Ala225
230 235 240Phe Leu Asp Arg Pro Ala Thr
Leu Val Ser Ala Asp Asn Pro Leu Phe245 250
255Glu Gly Thr Asp Thr Ser Leu Ala Phe Ser Pro Ser Gly Val Ala Pro260
265 270Asp Pro Asp Phe Met Asn Ile Val Ala
Leu His Arg Pro Ala Phe Thr275 280 285Thr
Arg Arg Gly Gly Val Arg Phe Ser Arg Leu Gly Arg Lys Ala Thr290
295 300Ile Gln Thr Arg Arg Gly Thr Gln Ile Gly Ala
Arg Val His Tyr Tyr305 310 315
320Tyr Asp Ile Ser Pro Ile Ala Gln Ala Glu Glu Ile Glu Met Gln
Pro325 330 335Leu Leu Ser Ala Asn Asn Ser
Phe Asp Gly Leu Tyr Asp Ile Tyr Ala340 345
350Asn Ile Asp Asp Glu Ala Pro Gly Leu Ser Ser Gln Ser Val Ala Thr355
360 365Pro Ser Ala His Leu Pro Ile Lys Pro
Ser Thr Leu Ser Phe Ala Ser370 375 380Asn
Thr Thr Asn Val Thr Ala Pro Leu Gly Asn Val Trp Glu Thr Pro385
390 395 400Phe Tyr Ser Gly Pro Asp
Ile Val Leu Pro Thr Gly Pro Ser Thr Trp405 410
415Pro Phe Val Pro Gln Ser Pro Tyr Asp Val Thr His Asp Val Tyr
Ile420 425 430Gln Gly Ser Ser Phe Ala Leu
Trp Pro Val Tyr Phe Phe Arg Arg Arg435 440
445Arg Arg Lys Arg Ile Pro Tyr Phe Phe Ala Asp Gly Asp Val Ala Ala450
455 4606714PRTArtificial SequenceDescription
of Artificial Sequencetetanus toxoid positions 830-843 67Gln
Tyr Ile Lys Ala Asn Ser Lys Phe Ile Gly Ile Thr Glu1 5
106821PRTArtificial SequenceDescription of Artificial
SequencePlasmodium falciparum circumsporozoite (CS) protein
positions 378-398 68Asp Ile Glu Lys Lys Ile Ala Lys Met Glu Lys Ala
Ser Ser Val Phe1 5 10
15Asn Val Val Asn Ser206916PRTArtificial SequenceDescription of
Artificial Sequence Streptococcus18kD protein position 116 69Gly Ala
Val Asp Ser Ile Leu Gly Gly Val Ala Thr Tyr Gly Ala Ala1 5
10 157013PRTArtificial
SequenceDescription of Artificial Sequencepan-DR binding epitope
peptide 70Ala Lys Xaa Val Ala Ala Trp Thr Leu Lys Ala Ala Ala1
5 10719PRTArtificial SequenceDescription of
Artificial Sequencestandard peptide 944.02 71Tyr Leu Glu Pro Ala Ile
Ala Lys Tyr1 57210PRTArtificial SequenceDescription of
Artificial Sequencestandard peptide 941.01 72Phe Leu Pro Ser Asp Tyr
Phe Pro Ser Val1 5 10739PRTArtificial
SequenceDescription of Artificial Sequencestandard peptide 1072.34
73Tyr Val Ile Lys Val Ser Ala Arg Val1 57410PRTArtificial
SequenceDescription of Artificial Sequencestandard peptide 941.12
74Lys Val Phe Pro Tyr Ala Leu Ile Asn Lys1 5
10759PRTArtificial SequenceDescription of Artificial Sequencestandard
peptide 940.06 75Ala Val Asp Leu Tyr His Phe Leu Lys1
57611PRTArtificial SequenceDescription of Artificial Sequencestandard
peptide 1083.02 76Ser Thr Leu Pro Glu Thr Tyr Val Val Arg Arg1
5 10779PRTArtificial SequenceDescription of
Artificial Sequencestandard peptide 979.02 77Ala Tyr Ile Asp Asn Tyr
Asn Lys Phe1 5789PRTArtificial SequenceDescription of
Artificial Sequencestandard peptide 1075.23 78Ala Pro Arg Thr Leu
Val Tyr Leu Leu1 5799PRTArtificial SequenceDescription of
Artificial Sequencestandard peptide 1021.05 79Phe Pro Phe Lys Tyr
Ala Ala Ala Phe1 58013PRTArtificial SequenceDescription of
Artificial Sequencestandard peptide 515.01 80Pro Lys Tyr Val Lys Gln
Asn Thr Leu Lys Leu Ala Thr1 5
108112PRTArtificial SequenceDescription of Artificial Sequencestandard
peptide 829.02 81Tyr Lys Thr Ile Ala Phe Asp Glu Glu Ala Arg Arg1
5 108214PRTArtificial SequenceDescription of
Artificial Sequencestandard peptide 717.01 82Tyr Ala Arg Phe Gln Ser
Gln Thr Thr Leu Lys Gln Lys Thr1 5
108315PRTArtificial SequenceDescription of Artificial Sequencestandard
peptide 1200.05 83Glu Ala Leu Ile His Gln Leu Lys Ile Asn Pro Tyr Val
Leu Ser1 5 10
158414PRTArtificial SequenceDescription of Artificial Sequencestandard
peptide 650.22 84Gln Tyr Ile Lys Ala Asn Ala Lys Phe Ile Gly Ile Thr
Glu1 5 108524PRTArtificial
SequenceDescription of Artificial Sequencestandard peptide 507.02
85Gly Arg Thr Gln Asp Glu Asn Pro Val Val His Phe Phe Lys Asn Ile1
5 10 15Val Thr Pro Arg Thr Pro
Pro Pro208613PRTArtificial SequenceDescription of Artificial
Sequencestandard peptide 511 86Asn Gly Gln Ile Gly Asn Asp Pro Asn
Arg Asp Ile Leu1 5 10879PRTArtificial
SequenceDR7 preferred motif 87Xaa Met Trp Ala Xaa Xaa Met Xaa Xaa1
5889PRTArtificial SequenceDR7 deleterious motif 88Xaa Cys Xaa Gly
Xaa Xaa Xaa Asn Gly1 5
User Contributions:
comments("1"); ?> comment_form("1"); ?>Inventors list |
Agents list |
Assignees list |
List by place |
Classification tree browser |
Top 100 Inventors |
Top 100 Agents |
Top 100 Assignees |
Usenet FAQ Index |
Documents |
Other FAQs |
User Contributions:
Comment about this patent or add new information about this topic: