Inventors list |
Assignees list |
Classification tree browser |
Top 100 Inventors |
Top 100 Assignees |
Nancy A.
Nancy A. Hadenfeldt, Lincoln, NE US
| Patent application number | Description | Published |
|---|---|---|
| 20080255975 | SYSTEMS AND METHODS FOR DETERMINING THIN-FILE RECORDS AND DETERMINING THIN-FILE RISK LEVELS - In some embodiments, systems and methods are disclosed for generating filters to determine whether a consumer is likely to have a scoreable credit record based on non-credit data, and to determine a potential risk level associated with an unscoreable credit record based on non-credit data. Existing scoreable and unscoreable records are compared to determine factors correlated with having an unscoreable record, and a multi-level filter is developed. Unscoreable records having at least one entry are compared to determine whether they are “good” or “bad” risks, factors correlated with either condition are determined, and a filter is developed. The filters can be applied to records comprising demographic data to determine consumers that are likely to have unscoreable records but represent good risks. | 10-16-2008 |
Nancy A. Hadenfeldt, Lincoln NE
| Patent application number | Description | Published |
|---|---|---|
| 20100299246 | SYSTEMS AND METHODS FOR DETERMINING THIN-FILE RECORDS AND DETERMINING THIN-FILE RISK LEVELS - In some embodiments, systems and methods are disclosed for generating filters to determine whether a consumer is likely to have a scoreable credit record based on non-credit data, and to determine a potential risk level associated with an unscoreable credit record based on non-credit data. Existing scoreable and unscoreable records are compared to determine factors correlated with having an unscoreable record, and a multi-level filter is developed. Unscoreable records having at least one entry are compared to determine whether they are “good” or “bad” risks, factors correlated with either condition are determined, and a filter is developed. The filters can be applied to records comprising demographic data to determine consumers that are likely to have unscoreable records but represent good risks. | 11-25-2010 |
Nancy A. Lee, East Amherst, NY US
| Patent application number | Description | Published |
|---|---|---|
| 20080239366 | Systems and methods for managing print jobs - A system for managing a job in accordance with a job specification and job content includes a database that stores device information and a configuration engine. The configuration engine is responsive to the job specification and the database and identifies one or more device configurations that are capable of producing the job. The system also includes a controller that is responsive to a selection from the one or more device configurations to produce a command stream in a format compatible with the selection. | 10-02-2008 |
| 20100110467 | System and Method of Rasterizing PDF Files using Multiple Processors - A plurality of pages represented by a page description language file are rasterized using a plurality of raster image processors. A server provides instructions for each raster image processor which of the plurality of pages to generate a raster image. The plurality of raster image processors generates raster images for the plurality of pages. A print controller sends press commands to a press controller, wherein the press controller operates a press in accordance with the press commands to print the raster images. | 05-06-2010 |
Nancy A. Muma, Lawrence, KS US
| Patent application number | Description | Published |
|---|---|---|
| 20100069304 | PROTECTIVE EFFECTS OF INHIBITING THE INTERACTION OF CALMODULIN AND MUTANT HUNTINGTIN PROTEIN - An artificial polypeptide can be used in a treatment for Huntington's disease. The inventive polypeptide sequence is capable of interacting with mutant huntingtin so as to inhibit interactions between mutant huntingtin or a fragment of mutant huntingtin and calmodulin. The inventive polypeptide sequence can be a portion of calmodulin described herein or an analog or derivative thereof that binds with the polyglutamate portion of a mutant huntingtin protein. For example, polypeptide sequence can include a sequence of KDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEV (SEQ ID NO: 1) or a portion thereof analog thereof or derivative thereof. | 03-18-2010 |
Nancy A. Schipon, Apex, NC US
| Patent application number | Description | Published |
|---|---|---|
| 20110066871 | Multiple Power Supplies Providing Enhanced Power Efficiency - Method and computer program product for supplying power in a computing system, and computer program product implementing the method. The method comprises monitoring power consumption of the computing system, supplying power to the computing system using only a first power supply over a first range of power consumption, and supplying power to the computing system using a combination of the first power supply and a second power supply over a second range of power consumption. The first power supply provides greater efficiency than the combination of the first and second power supplies over the first lower range of power consumption, the combination of the first and second power supplies provides greater efficiency than the first power supply over the second higher range of power consumption. | 03-17-2011 |
Nancy A. Staffend, Minneapolis, MN US
| Patent application number | Description | Published |
|---|---|---|
| 20100050628 | HIGH EFFICIENCY POSITIVE DISPLACEMENT THERMODYNAMIC SYSTEM - Devices and methods for moving a working fluid through a controlled thermodynamic cycle in a positive displacement fluid-handling device ( | 03-04-2010 |
Nancy A. Zabe, Waltham, MA US
| Patent application number | Description | Published |
|---|---|---|
| 20090035786 | MULTI-ANALYTE AFFINITY COLUMN - A multi-analyte column is disclosed. The column may contain at least one unit of resin having ochratoxin specific affinity and, for each unit of resin having ochratoxin specific affinity, the column further contains about 0.95 to 1.05 units of resin containing antibody having specificity for zearalenone, about 1.9 to 2.1 units of resin containing antibody having specificity for aflatoxin, about 2.35 to 2.65 units of resin containing antibody having specificity for fumonisin, about 2.8 to 3.2 units of resin containing antibody having specificity for T-2 (and/or HT-2) and about 4.7 to 5.3 units of resin containing antibody having specificity for deoxynivalenol. One unit of resin is the quantity of resin containing antibody that will bind 50 ng of aflatoxin, 500 ng of deoxynivalenol, 3300 ng of fumonisin, 50 ng of ochratoxin, 830 ng T-2 (and/or HT-2) or 1140 ng of zearalenone, respectively. | 02-05-2009 |
Nancy A. Zorger, North Manchester, IN US
| Patent application number | Description | Published |
|---|---|---|
| 20090144901 | METHOD AND APPARATUS FOR INSERTING A PILLOW INTO A PILLOWCASE - An apparatus and method for aiding the insertion of a pillow into a pillowcase. The apparatus or device is flexible and lays flat in a neutral condition. After the pillow is placed onto the device, the device is wrapped around the pillow to compress the pillow, and edges of the device are engaged with one another to maintain the pillow in a compressed condition. The device and compressed pillow are slid into a pillowcase, or the pillowcase is slid over the device and compressed pillow, and the device is then slid outwardly from the pillowcase, allowing the pillow to expand and fill the pillowcase. Optionally, the edges of the device may first be disengaged to allow expansion of the pillow to fill the pillowcase prior to sliding the device outwardly from the pillowcase. | 06-11-2009 |