Inventors list |
Assignees list |
Classification tree browser |
Top 100 Inventors |
Top 100 Assignees |
Hermann, CH
Gabriel Hermann, Etagnières CH
| Patent application number | Description | Published |
|---|---|---|
| 20100170408 | Cylinder Body for Orienting Magnetic Flakes Contained in an Ink or Varnish Vehicle Applied on a Sheet-Like or Web-Like Substrate - There is described a cylinder body ( | 07-08-2010 |
Gabriel Hermann, Etagnières CH
| Patent application number | Description | Published |
|---|---|---|
| 20100170408 | Cylinder Body for Orienting Magnetic Flakes Contained in an Ink or Varnish Vehicle Applied on a Sheet-Like or Web-Like Substrate - There is described a cylinder body ( | 07-08-2010 |
Holger Hermann, Visp CH
| Patent application number | Description | Published |
|---|---|---|
| 20100249370 | PROCESS FOR THE PRODUCTION OF PRAMLINTIDE - Pramlintide, a peptide having the 37 amino acid sequence KCNTATCATQRLANFLVHSSNNFGPILPPT-NVGSNTY-NH2 is prepared via a convergent three-fragment synthesis strategy from the fragments comprising the amino acid residues 1-12, 13-24 and 25-37, respectively. | 09-30-2010 |
Lars Hermann, Schindellegi CH
| Patent application number | Description | Published |
|---|---|---|
| 20110144211 | USE OF MICROCRYSTALLINE CELLULOSE FOR INTERFERING WITH THE EXTRACTION OF EPHEDRINE - Use of microcrystalline cellulose and, optionally, a surfactant in an aqueous pharmaceutical composition in order to inhibit the extraction of ephedrine for the purpose of drug abuse. | 06-16-2011 |
Lars Holger Hermann, Schindellegi CH
| Patent application number | Description | Published |
|---|---|---|
| 20090181999 | USE OF COMPOSITIONS CONTAINING KAPPA-OPIOID RECEPTOR ANTAGONISTS FOR THE TREATMENT OF DISSOCIATIVE DISORDERS - The invention relates to the use of a composition comprising kappa opioid receptor antagonists for producing a drug for the treatment of dissociative disorders in humans. | 07-16-2009 |
Lars Von Hermann, Schindellegi CH
| Patent application number | Description | Published |
|---|---|---|
| 20100221339 | Use of a combination of morphine and at least one opiate antagonist to treat opiate dependency and prevent non-oral opiate abuse among opiate addicts - The present invention relates to the use of an inseparable combination of morphine and at least one opiate antagonist with a bioavailability of less than 5% on oral administration for producing a medicament to be administered orally for treatment of opiate dependency in humans and to the use of an inseparable combination of an opiate and at least one opiate antagonists with a bioavailability of less than 5% on oral administration for producing a medicament to be administered orally for prevention of non-oral opiate abuse in opiate addicts. | 09-02-2010 |
Rene Hermann, Luzern CH
| Patent application number | Description | Published |
|---|---|---|
| 20080308360 | METHOD AND ELEVATOR DRIVE WITH A BRAKE DEVICE - An elevator drive with a brake device has compression springs that act on brake levers, whereby brake linings generate a brake force on a brake drum. The more the brake linings wear due to abrasion, the smaller the distance of the plunger from the brake magnet housing becomes. Should the plunger come into contact with the brake magnet housing, the braking capacity of the brake linings is completely eliminated creating an operating condition that is dangerous for elevator users. A switch is provided that detects a minimum distance. The switch can be arranged on the plunger of the brake magnet and detect the minimum distance to the brake magnet housing or, in the case of a retrofit, the switch can be arranged on the brake magnet rod and, for example, detect the distance of the second joint from the brake magnet housing, and at the minimum distance the switch switches. | 12-18-2008 |
Reto J. Hermann, Rueschlikon CH
| Patent application number | Description | Published |
|---|---|---|
| 20110173448 | AUTHORIZATION OF SERVER OPERATIONS - An authorization device for authorizing operations of a remote server requested from user computers via a data communications network includes a computer interface configured to connect to a local user computer for facilitating communication with the remote server via a data communications network, a user interface configured to present information to a user, and control logic. The control logic is adapted to use security data accessible to the control logic to establish, via the local user computer, a mutually-authenticated connection for encrypted end-to-end communications with the server; collect from the server, via the connection, information indicative of any operation requested via a different connection to the server and requiring authorization by the user; and present the information to the user via the user interface to prompt for authorization of the operation. | 07-14-2011 |
Ulrich Hermann, Uster CH
| Patent application number | Description | Published |
|---|---|---|
| 20080227911 | Cathodic electrodeposition coating compositions - CED coating compositions comprising water, at least one monobasic acid, a resin solids content comprising a thermally crosslinkable binder system comprising (i1) at least one self-crosslinkable CED binder with isocyanate-reactive functional groups and oxime- and/or N,N-dialkyl hydroxylamine-blocked aromatic isocyanate groups and/or (i2) at least one externally crosslinkable CED binder with isocyanate-reactive functional groups and, as a crosslinking agent A, at least one polyisocyanate with oxime- and/or N,N-dialkyl hydroxylamine-blocked aromatic isocyanate groups, and at least one polybasic acid in a proportion of 1 to 50 meq acid per 100 g of resin solids. | 09-18-2008 |
Ulrich G. Hermann, Uster CH
| Patent application number | Description | Published |
|---|---|---|
| 20100293725 | PRE-TREATMENT LIQUID FOR LIQUID ABSORBING PRINTING SUBSTRATES - Liquids for the pre-treatment of liquid absorbing substrates, in particular textiles or garments, in printing processes are disclosed, said liquids being based on water and/or a low molecular alcohol and including small amounts of an organic acid and/or other reagents to increase dye fixation as well as at least one corrosion inhibiting agent selected from a group containing quaternary ammonium salts, derivates thereof and their corresponding organically substituted amines, hydroxy substituted acetylenic components and derivates thereof, carboxylic, dicarboxylic and polycarboxylic acids, long-chain carboxylic, dicarboxylic and polycarboxylic acids and separated fractions and derivates thereof, sulfur containing heterocyclic compounds and derivates thereof, nitrogen containing heterocyclic compounds and derivates thereof, nitrite and nitrate salts of metal ions, organic nitrites and nitrates, organic nitrogen compounds and reductive nitrogen containing compounds. Preferably the concentration of the corrosion inhibiting agent is between 0.01 wt. % and 10 wt. % and the surface tension of the liquid between 15 mN/m and 70 mN/m. | 11-25-2010 |
Vincent Hermann, Prilly CH
| Patent application number | Description | Published |
|---|---|---|
| 20100119699 | Particle based electrodes and methods of making same - A coated electrode is provided for use in energy storage devices. The coated electrode comprises a dry fibrillized polymer that is fibrillized with no processing additives. | 05-13-2010 |