Patent application number | Description | Published |
20080318849 | Kahalalide F and Related Compounds - A process is provided for preparing kahalalide F and which leads to other kahalalide mimic compounds having useful biological activity. | 12-25-2008 |
20090171068 | Method of peptide synthesis - A method for solid phase synthesis of Thymosin α | 07-02-2009 |
20090181424 | Mammalian Expression Vector Comprising the MCMV Promoter and First Intron of HCMV Major Immediate Early Gene - A mammalian expression vector that is a murine CMV promoter and the first intron of the major immediate early gene of the human cytomegalovirus. There are mammalian host cells containing the expression vector. There is also a process for the production of recombinant protein by using the expression vector. | 07-16-2009 |
20100144588 | PROTON ACCEPTOR IMINIUM/CARBOCATION-TYPE COUPLING AGENTS - Novel iminium-type coupling agents containing proton acceptors in their iminium moiety, which can be used beneficially as coupling agents in various chemical polypeptide and/or polynucleotide syntheses, and are particularly useful as yield enhancing and racemization suppressing coupling agents for use in peptide syntheses, are disclosed. Further disclosed are a process of preparing such iminium-type coupling agents and their use in the preparation of polypeptides and/or polynucleotides. | 06-10-2010 |
20100197891 | METHOD FOR PEPTIDE SYNTHESIS - A new method of anchoring a growing peptide chain during chemical synthesis to a solid-phase support is devised. Novel amino acid derivatives and peptide derivatives, both unbonded and bonded to a solid-phase support, are also provided. | 08-05-2010 |
20100249370 | PROCESS FOR THE PRODUCTION OF PRAMLINTIDE - Pramlintide, a peptide having the 37 amino acid sequence KCNTATCATQRLANFLVHSSNNFGPILPPT-NVGSNTY-NH2 is prepared via a convergent three-fragment synthesis strategy from the fragments comprising the amino acid residues 1-12, 13-24 and 25-37, respectively. | 09-30-2010 |
20100292163 | Antitumoral Compounds - Antitumoral compounds of Formula I, and pharmaceutically acceptable salts, derivatives, tautomers, prodrugs or stereoisomers thereof | 11-18-2010 |
20100323021 | ANTITUMORAL TREATMENTS - The present invention relates to colloidal metal nanoparticles conjugated with Kahalalide F, or an analogue thereof, and their use in the treatment of cancer. The invention also relates to a method for increasing the antitumoral activity of Kahalalide F, or an analogue thereof, which comprises conjugating the Kahalalide F, on an analogue thereof, with a colloidal metal nanoparticle. | 12-23-2010 |
20110046349 | PROCESS FOR THE PRODUCTION OF EXENATIDE AND OF AN EXENATIDE ANALOGUE - Exenatide, a polypeptide having the 39 amino acid sequence | 02-24-2011 |
20110060125 | INDOLESULFONYL PROTECTING GROUPS FOR PROTECTION OF GUANIDINO AND AMINO GROUPS - The invention relates to indolesulfonyl halogenides which are useful for the protection of organic compounds comprising at least one guanidino moiety and/or at least one amino group. The invention further relates to a process for their preparation and their use as protecting reagents. The invention also relates to the process for the protecting reaction and to the protected compounds thereof. | 03-10-2011 |
20110207674 | ANTITUMORAL COMPOUNDS -
Antitumoral compounds of Formula I, and pharmaceutically acceptable salts, derivatives, tautomers, prodrugs or stereoisomers thereof
| 08-25-2011 |
20140094567 | Diketopiperazine Forming Dipeptidyl Linker - The invention relates to a method for homogeneous solution phase peptide synthesis (HSPPS) of a N-terminal peptide fragment PEP-N and a C-terminal peptide fragment C-PEP, with C-PEP carrying a specific diketopiperazine (DKP) comprising C-terminal protecting group, which contains a handle group HG, with HG being connected to the C-terminus of the peptide fragment; thereby this specific DKP comprising C-terminal protecting group can be selectively cleaved from the peptide as a conventionally used C-terminal protecting group. By the use of this DKP and HG comprising C-terminal protecting group, certain process steps in convergent peptide synthesis based on a combination of HSPPS and solid phase peptide synthesis (SPPS) can be avoided. The invention relates further to a method for the preparation of such specifically protected fragment C-PEP by SPPS by using a linker comprising a specific dipeptide and HG for connecting the growing peptide chain to the resin, which linker forms said DKP group, when the peptide fragment C-PEP is cleaved from the supporting resin; and further to the intermediates of the preparation method. | 04-03-2014 |
20140343227 | Diketopiperazine Forming Dipeptidyl Linker - The invention relates to a method for homogeneous solution phase peptide synthesis (HSPPS) of a N-terminal peptide fragment PEP-N and a C-terminal peptide fragment C-PEP, with C-PEP carrying a specific diketopiperazine (DKP) comprising C-terminal protecting group, which contains a handle group HG, with HG being connected to the C-terminus of the peptide fragmcnt; thereby this specific DKP comprising C-terminal protecting group can be selectively cleaved from the peptide as a conventionally used C-terminal protecting group. By the use of this DKP and HG comprising C-terminal protecting group, certain process steps in convergent peptide synthesis based on a combination of HSPPS and solid phase peptide synthesis (SPPS) can be avoided. The invention relates further to a method for the preparation of such specifically protected fragment C-PEP by SPPS by using a linker comprising a specific dipeptide and HG for connecting the growing peptide chain to the resin, which linker forms said DKP group, when the peptide fragment C-PEP is cleaved from the supporting resin; and further to the intermediates of the preparation method. | 11-20-2014 |