Brunner
Christoph Brunner, Villach AT
Patent application number | Description | Published |
---|---|---|
20140117511 | Passivation Layer and Method of Making a Passivation Layer - A passivation layer and a method of making a passivation layer are disclosed. In one embodiment the method for manufacturing a passivation layer includes depositing a first silicon based dielectric layer on a workpiece, the first silicon based dielectric layer comprising nitrogen, and depositing in-situ a second silicon based dielectric layer on the first silicon based dielectric layer, the second dielectric layer comprising oxygen. | 05-01-2014 |
20150235917 | Passivation Layer and Method of Making a Passivation Layer - A passivation layer and a method of making a passivation layer are disclosed. In one embodiment the method for manufacturing a passivation layer includes depositing a first silicon based dielectric layer on a workpiece, the first silicon based dielectric layer comprising nitrogen, and depositing in-situ a second silicon based dielectric layer on the first silicon based dielectric layer, the second dielectric layer comprising oxygen. | 08-20-2015 |
Christopher Brunner, Sydney AU
Patent application number | Description | Published |
---|---|---|
20130211659 | SENSOR DATA PROCESSING - Apparatus for and method of processing sensor data for the purpose of navigating a vehicle (for example an autonomous or semi-autonomous vehicle), the sensor data being from a sensor (for example a camera) mounted on the vehicle. The method can include can include: for a number of time-steps, measuring a value of a parameter of a scene using the sensor to produce a sequence of images of the scene; determining a value of one or more image quality metrics (for example, spatial entropy and spatial information) in each image in the sequence; and identifying as either valid or invalid, a sub-sequence of images in the sequence based on the determined metric values. | 08-15-2013 |
Christopher Joseph Brunner, New South Wales AU
Patent application number | Description | Published |
---|---|---|
20090260629 | CONNECTOR - A connector includes a main conduit and a gas conduit. The main conduit includes an inlet portion and an outlet portion that form a passage for supply of a first gas in a forward direction. The inlet portion is adapted to receive a supply of the first gas and deliver the first gas to the outlet portion. The gas conduit has a first end and a second end that form a second passage for supply of a second gas. The first end of the gas conduit is adapted to connect to a second gas supply, and the second end is adjacent the outlet portion of the main conduit and delivers the second gas into the main conduit such that the second gas is directed to flow in a forward direction. | 10-22-2009 |
Daniel Brunner, Soisy-Sous-Montmorency FR
Patent application number | Description | Published |
---|---|---|
20120241434 | ELECTRICAL POWER SUPPLY DEVICE FOR A RESISTOR ELEMENT, AND AN ELECTRICAL SYSTEM PROVIDED WITH SAID DEVICE AND SAID RESISTOR ELEMENT - An electrical power supply device ( | 09-27-2012 |
David Brunner, Milton CA
Patent application number | Description | Published |
---|---|---|
20150240720 | INLET AIR FILTER ARRANGEMENT, INLET AIR FILTER CARTRIDGE, AND EQUIPMENT FOR SUPPORTING INLET AIR FILTER CARTRIDGES FOR A GAS TURBINE OR A COMBUSTION TURBINE - An inlet air filter arrangement for a gas turbine or a combustion turbine includes a housing with an inlet side and an outlet side separated by a planar tubesheet including multiple tubesheet openings. Each multiple cylindrical filter cartridge includes a symmetry axis, an open end, and a closed end. A connection assembly for each of the multiple cylindrical filter cartridges seals the open end of the cylindrical filter cartridge to the tubesheet around one of the tubesheet openings. The connection assembly includes a mainly cylindrical guide sleeve including a symmetry axis, a shell with a cylindrical external surface, an inner end attached around the tubesheet opening and an outer end at the inlet side of the housing. The shell is provided with at least two slots extending mainly helically from the outer end towards the inner end. A collar attaches to the open end of the cylindrical filter cartridge. | 08-27-2015 |
David J.m. Brunner, Vanves FR
Patent application number | Description | Published |
---|---|---|
20100250486 | SYSTEMS AND METHODS TO PROVIDE REPORT PART VIA A WEB SERVICE - Some aspects include reception of a selection of a part of a report, the selected report part associated with queries of a semantic layer, and creation of a description of a Web Service call to return contents of the selected report part. In some aspects, a Web Service call associated with a part of a report is received, the report part associated with queries of a semantic layer, and a query is determined based on the Web Service call to return contents of the report part. | 09-30-2010 |
Frederic Brunner, Illkirch FR
Patent application number | Description | Published |
---|---|---|
20140321431 | METHOD FOR CHANGING THE WIRELESS ACCESS POINT ASSOCIATED WITH A TERMINAL IN A WIFI-DECT WIRELESS TELECOMMUNICATIONS NETWORK - This method for changing the radio access point associated with a terminal, within a Wi-Fi-DECT wireless telecommunication network comprising dual-mode Wi-Fi-DECT radio terminals (PP) and Wi-Fi-DECT radio access points (AP | 10-30-2014 |
Helmut Brunner, Feistritz/drau AT
Patent application number | Description | Published |
---|---|---|
20130115736 | METHOD FOR SEPARATING A PLURALITY OF DIES AND A PROCESSING DEVICE FOR SEPARATING A PLURALITY OF DIES - A method for separating a plurality of dies is provided. The method may include: selectively removing one or more portions from a carrier including a plurality of dies, for separating the plurality of dies along the selectively removed one or more portions, wherein the one or more portions are located between the dies; and subsequently forming over a back side of the dies, at least one metallization layer for packaging the dies | 05-09-2013 |
20140145345 | METHOD OF FORMING A SEMICONDUCTOR STRUCTURE, AND A SEMICONDUCTOR STRUCTURE - A method of forming a semiconductor structure in accordance with various embodiments may include: forming at least one opening in a workpiece; forming a first conductive layer within the at least one opening, the first conductive layer not completely filling the at least one opening; forming a fill layer over the first conductive layer within the at least one opening; and forming a second conductive layer over the fill layer. | 05-29-2014 |
Helmut Brunner, Feistritz-Drau AT
Patent application number | Description | Published |
---|---|---|
20140265098 | Lift Pin for Substrate Processing - Lift pins and devices having lift pins are provided. According to an aspect, a lift pin may have a tapered distal portion. According to another aspect, a lift pin may have two portions threadedly engaged with each other. According to yet another aspect, a lift pin may be mounted to a lifting plate with slackness. | 09-18-2014 |
Hendrik Amos Brunner, Durbanville ZA
Patent application number | Description | Published |
---|---|---|
20090067670 | METHODS AND PROCESSES FOR DETECTING A MARK ON A PLAYING SURFACE AND FOR TRACKING AN OBJECT - Systems and methods for detecting a mark left by an object on a playing surface are provided. A system for detecting a mark left by an impact of an object on a playing surface, the system including at least one processor coupled to a memory arrangement. The system may further include at least one camera for collecting a sequence of images of the playing surface before and after impact of an object. Additionally, the system may include an image processing system adapted to process at least a portion of the sequence of images to identify the mark left by the object on the playing surface. The system may also include a judgment processing system operative to determine the position of the mark relative to the feature of the playing surface. | 03-12-2009 |
Jean-Sebastien Brunner, Issy-Les-Moulineaux FR
Patent application number | Description | Published |
---|---|---|
20080306928 | METHOD AND APPARATUS FOR THE SEARCHING OF INFORMATION RESOURCES - The present invention discloses a method and apparatus for the searching of information resources. A method includes steps of: according to a current query for a first type of information resource, obtaining a result of query on said first type of information resource, one or more facets of said first type of information resource and metadata under each facet, and relationships between said first type of information resource and other types of information resource that at least include a second type of information resource; and returning to a user the obtained result of query on said first type of information resource, the one or more facets of said first type of information resource and the metadata under each facet, and the relationships between said first type of information resource and other types of information resource that at least include a second type of information resource. | 12-11-2008 |
John Brunner, Sheung Wan HK
Patent application number | Description | Published |
---|---|---|
20150319874 | FOLDABLE COVER - A foldable cover includes a hinge suitable for detachable attachment to a host unit and a flap portion. The flap portion is pivotally connected to the hinge and includes a plurality of segments which are substantially the same size and substantially rigid, with a foldable region between each of them. The flap portion is capable of being folded into a rectangular structure in which each segment of the flap portion is folded substantially flush one atop the other. The size and positioning of the resultant rectangular structure is such that the back face of the host unit can be further augmented to improve its utility or ergonomics, for example by the addition of a handle. | 11-05-2015 |
Josef Brunner, Elizabethtown CA
Patent application number | Description | Published |
---|---|---|
20150125637 | Visually Identifiable Electrical Structural Wiring System - The present invention provides an identifiable armored cable sheath. In accordance with an aspect of the present invention, there is provided an identifiable armored cable sheath comprising: an armored cable sheath having an outer surface, and a visual indicia applied on the outer surface of the cable sheath in a patterned arrangement, wherein the visual indicia possesses visibility features in low light. Another aspect of the present invention provides a method of making an identifiable armored cable sheath comprising: providing an armored cable sheath, and applying a visually distinctive tape to the outer surface of the sheath in a patterned arrangement. | 05-07-2015 |
Jos G. A. Brunner, Eksel BE
Patent application number | Description | Published |
---|---|---|
20110187258 | SYSTEM FOR HEAT CONDUCTION BETWEEN TWO CONNECTABLE MEMBERS - A system for detachably connecting a first member ( | 08-04-2011 |
Jos George Antony Brunner, Eindhoven NL
Patent application number | Description | Published |
---|---|---|
20110111536 | Method of mounting a LED module to a heat sink - A method of mounting a light emitting diode (LED) module ( | 05-12-2011 |
Jurgen Brunner, Polfing-Brunn AT
Patent application number | Description | Published |
---|---|---|
20080283488 | Method For Producing a Ceramic Printed-Circuit Board - A ceramic substrate (S) has on its top side weldable connection surfaces (LA) and on its underside weldable contacts (LK). In the disclosed substrate (S), the weldable connection surfaces, which were until now produced using printing pastes, is replaced by weld surface contacts precipitated from a solution and directly applied to the ceramic material. These weld contact surfaces are characterised by a more even surface, improved bondability and structurability. | 11-20-2008 |
Karin Brunner, Tulln AT
Patent application number | Description | Published |
---|---|---|
20150368370 | THERMALLY INHIBITED STARCH AND STARCHY FLOURS - The present invention relates to thermally inhibited starch and starchy flours produced by heat treatment of native starch that is pre-dried where necessary to a dry matter content of more than or equal to 95% by weight, preferably 98% by weight, particularly preferably 99% by weight, wherein said starch, pre-dried where necessary, is heat treated in the presence of at least 0.1 percent by volume of oxygen at a product temperature in excess of 100° C. in a vibrating spiral conveyor. | 12-24-2015 |
Klemens Brunner, Eindhoven NL
Patent application number | Description | Published |
---|---|---|
20080232420 | Light Emitting Diodes and Lasers Diodes with Color Converters - The present invention relates to a light emitting diode (LED) or a laser diode ( | 09-25-2008 |
20080269461 | Polymeric Carbazole Compounds - A polymeric carbazole compound comprising a monomer unit of formula (I): is disclosed, wherein x and y are equal to zero or 1, and n is an integer equal to or larger than zero. P represents a phenyl group, and C | 10-30-2008 |
20080303407 | Display Device with Solid State Fluorescent Material - A display device ( | 12-11-2008 |
20090080197 | LIGHT EMITTING DIODE MODULE AND METHOD FOR THE MANUFACTURING OF SUCH AN LED MODULE - The present invention relates to a light emitting diode (LED) module ( | 03-26-2009 |
20090206301 | INORGANIC PHOSPHOR BODIES FOR LIGHT EMITTING DIODES - An inorganic phosphor body ( | 08-20-2009 |
20090242876 | CARBAZOLE COMPOUNDS - The present invention relates to carbazole compounds of formula (I) and a semiconducting material comprising such carbazole compounds. It also relates to a process for the preparation of such carbazole compounds, as well as to the use thereof as a semiconducting material, in particular as a host matrix for phosphorescent emitters. | 10-01-2009 |
Phillippe Brunner, Monaco MC
Patent application number | Description | Published |
---|---|---|
20150238170 | Medical Device Comprising A Curved Needle - The invention relates to a biopsy device comprising a needle extending longitudinally from a proximal end to a distal end and including a channel extending there through. At least one section ( | 08-27-2015 |
Phillippe Brunner, Freres MC
Patent application number | Description | Published |
---|---|---|
20150238170 | Medical Device Comprising A Curved Needle - The invention relates to a biopsy device comprising a needle extending longitudinally from a proximal end to a distal end and including a channel extending there through. At least one section ( | 08-27-2015 |
Ralph William Brunner, Bangkok TH
Patent application number | Description | Published |
---|---|---|
20090150218 | MOBILE CONCIERGE SYSTEM AND METHOD - The system enables a consumer to receive promotional offers using a mobile communications device. The mobile communications device includes a client application that enables the consumer to assign preference levels associated with promotional offer categories. The mobile communications device transmits a consumer identifier, a location identifier, and preference levels to an application server. The application server uses the preference levels and other information included in a consumer profile associated with the consumer identifier to select promotional offers that are likely to be of interest to the consumer. The application server transmits map data including indicators of locations of local merchants to the mobile communications device. The client application causes the mobile communications device to display the map data, and enables the consumer to request promotional offers from selected merchants. The application server analyzes consumer request patterns and updates consumer profiles accordingly to improve subsequent selection of promotional offers. | 06-11-2009 |
Robert Herman Brunner, Melbourne AU
Patent application number | Description | Published |
---|---|---|
20120131502 | On-screen reminder program - A computer program for instructing a processor to display to a user of a computing device a reminder for the user to perform an action, the computer program comprising a series of instructions for: | 05-24-2012 |
Sebastian Brunner, Graz AT
Patent application number | Description | Published |
---|---|---|
20090174054 | Module with Flat Construction and Method for Placing Components - A module for electrical components is proposed in which connection surfaces that can be bonded are provided on a multi-layer substrate with integrated wiring; a component chip is bonded on the top that has bond pads on its surface pointing upward and that contacts the substrate by means of bonding wires. Here, the wire guide of the bonding wires is so that they are each bonded with a ball on a connection surface and with the wedge directly on one of the bond pads. | 07-09-2009 |
20100224394 | Module Substrate and Production Method - A module substrate includes a multilayer substrate that includes a plurality of layers, a bottommost of the layers being a ceramic layer. Solderable contacts, which include fired pads composed of a conductive paste, are applied to the bottommost ceramic layer. A covering layer overlies the pads. The covering layer covers all outer edges of the pads. A window is cut out of the covering layer. A metallic coating is applied to each pad exclusively within the window. | 09-09-2010 |
20110146069 | ELECTRIC COMPONENT AND COMPONENT AND METHOD FOR THE PRODUCTION THEREOF - A method for producing an electrical component ( | 06-23-2011 |
20110148546 | Multilayer Component - A multilayer component includes at least one inductive region and at least one capacitive region. The inductive region includes a ferrite ceramic. Electrode structures are arranged on the outwardly facing top side of the inductive region. The electrode structures form at least one coil structure having an inductance. | 06-23-2011 |
20120218728 | Carrier Device, Arrangement Comprising such a Carrier Device, and Method for Patterning a Layer Stack Comprising at Least One Ceramic Layer - A method for patterning a layer stack with at least one ceramic layer includes providing the ceramic layer, which has at least one plated-through hole. An electrically conductive layer is applied above the ceramic layer, such that the electrically conductive layer is electrically coupled to the at least one plated-through hole. A further layer is deposited onto the electrically conductive layer in the region of the at least one plated-through hole, wherein the further layer includes nickel. The electrically conductive layer is removed outside the region of the at least one plated-through hole. A carrier device patterned in this way can be electrically and mechanically coupled to an electronic component. | 08-30-2012 |
20150022055 | Method for Producing an Electric Contact Connection of a Multilayer Component and Multilayer Component with an Electric Contact Connection - A method for producing an electric contact-connection of a multilayer component is specified. A main body has internal electrode layers, a insulating material, an electrically conductive material and a photosensitive material are provided. The insulating material and the electrically conductive material are arranged in a structured manner on an outer side of the multilayer component for the alternate contact-connection of the internal electrode layers. The structured arrangement is produced by the photosensitive material. A multilayer component comprising such a contact-connection is furthermore specified. | 01-22-2015 |
20150144983 | Light-Emitting Diode Device - A light-emitting diode device includes a carrier having at least one cavity, a light-emitting diode chip is arranged in a manner at least partly recessed in the at least one cavity, and an ESD protection element, which is formed by a partial region of the carrier. Furthermore, a light-emitting diode device includes a carrier having at least one cavity, a light-emitting diode chip, arranged on the carrier, and an electrical component arranged at least partly recessed in the at least one cavity. Furthermore, the light-emitting diode device includes an ESD protection element, which is formed by a partial region of the carrier. | 05-28-2015 |
20150223329 | Carrier Plate, Device Having the Carrier Plate and Method for Producing a Carrier Plate - A carrier plate includes a substrate and at least one conductor track. The conductor track includes a first layer, which is applied directly on the substrate, and a second layer, which is arranged on the first layer. The second layer includes a supply line region and a soldering region. Furthermore, the second layer is completely interrupted between the supply line region and the soldering region. A device can be produced with a carrier plate and an electrical component arranged on the carrier plate. | 08-06-2015 |
20150243865 | Light-emitting Diode Device - A light-emitting diode device has a first carrier and at least one light-emitting diode chip, which is arranged on the first carrier. The first carrier has at least one first and one second carrier part, wherein the light-emitting diode chip rests only on the first carrier part. Furthermore, the first and second carrier parts each have a thermal conductivity. The thermal conductivity of the first carrier part is at least 1.5 times the thermal conductivity of the second carrier part. The first carrier part is surrounded laterally by the second carrier part. | 08-27-2015 |
20150245481 | Electric Component Assembly - A component assembly and a method for manufacturing a component assembly are disclosed. In some embodiments a component assembly includes a carrier, a metallic structure arranged on the carrier, wherein the metallic structure comprises at least one cavity and an electrical component arranged at least in part in the cavity. | 08-27-2015 |
20150287703 | Light-Emitting Diode Arrangement, Module, and Method for Producing a Light-Emitting Diode Arrangement - A light-emitting diode arrangement includes a light-emitting diode and a coding resistor for coding the light-emitting diode. The coding resistor is embodied as a star connection of a number of resistors. Furthermore, a module includes a plurality of light-emitting diode arrangements. Furthermore, a method for producing a light-emitting diode arrangement is specified, wherein the coding of a coding resistor is carried out depending on a determined characteristic of the light-emitting diode. | 10-08-2015 |
Stefanie Brunner, Kundl AT
Patent application number | Description | Published |
---|---|---|
20150038677 | PROCESS FOR THE SYNTHESIS OF TELAPREVIR, OR PHARMACEUTICALLY ACCEPTABLE SALTS OR SOLVATES AS WELL AS INTERMEDIATE PRODUCTS THEREOF - The invention relates to a process for the preparation of telaprevir, or a pharmaceutically acceptable salt or solvate thereof, wherein the process requires a smaller number of process steps and/or does not require the use of toxic and instable compounds compared to the known processes. Another embodiment refers to telaprevir, or a pharmaceutically acceptable salt or solvate thereof as well as to intermediate products for preparation of the same, wherein the afore-mentioned products are obtained by the process described herein. | 02-05-2015 |
Stéphane Brunner, Athis Mons FR
Patent application number | Description | Published |
---|---|---|
20110064824 | METHOD FOR ENRICHING WATER WITH OXYGEN BY AN ELECTROLYTIC PROCESS, OXYGEN ENRICHED WATER OR BEVERAGE AND USES THEREOF - The invention relates to a method for enriching water with oxygen by an electrolytic process, that comprises the following series of steps: the electrolysis of Cl | 03-17-2011 |
Stéphane Brunner, Athis Mons FR
Patent application number | Description | Published |
---|---|---|
20110064824 | METHOD FOR ENRICHING WATER WITH OXYGEN BY AN ELECTROLYTIC PROCESS, OXYGEN ENRICHED WATER OR BEVERAGE AND USES THEREOF - The invention relates to a method for enriching water with oxygen by an electrolytic process, that comprises the following series of steps: the electrolysis of Cl | 03-17-2011 |
Sylvia Brunner, Vienna AT
Patent application number | Description | Published |
---|---|---|
20110275556 | TREATMENT OF ATHEROSCLEROSIS - The present invention relates to the use of compounds for producing a medicament for preventing and/or treating atherosclerosis, atherosclerosis risk diseases and atherosclerosis sequelae. | 11-10-2011 |
20140147456 | CETP FRAGMENTS - The present invention relates to a peptide consisting of 6 to 20 amino acid residues and being derived from amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23), wherein said peptide comprises amino acid sequence WWLGID (SEQ ID No. 24) and antibodies binding to these peptides. | 05-29-2014 |
20140179900 | TREATMENT OF ATHEROSCLEROSIS WITH CHOLESTEROL ESTER TRANSPORT PROTEIN MIMOTOPES - The present invention relates to the use of compounds for producing a medicament for preventing and/or treating atherosclerosis, atherosclerosis risk diseases and atherosclerosis sequelae. | 06-26-2014 |
20150071951 | VACCINE - The present invention relates to a vaccine comprising at least two fragments of Proprotein convertase subtilisin/kexin type 9 (PCSK9), wherein said at least two fragments comprise at least 8 consecutive amino acid residues of amino acid residues 150 to 170 and/or 205 to 225 of PCSK9 (SEQ ID No. 9). | 03-12-2015 |
20150306191 | VACCINE - The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo. | 10-29-2015 |
Yaron Brunner, Timrat IL
Patent application number | Description | Published |
---|---|---|
20100012538 | TOOL BOX - A toolbox including a basin portion and a lid pivotally articulated thereto between an open position and a closed position, is provided. The lid includes two or more latches, each positionable between a locked position and an unlocked position, two or more biasing members, each associated with one of the latches and adapted to bias its associated latch toward its locked position, and an activation mechanism operationally connected to the latches such that operation of the activation mechanism brings all of the latches to their unlocked positions. The basin includes two or more latch-receiving arrangements, each configured to receive one of the latches when in the locked position with the lid in its closed position, thereby preventing articulation of the lid to its open position. The latches and latch-receiving arrangements are mutually configured such that upon articulation of the lid toward its closed position, the latch-receiving arrangements are configured to urge the latches from their locked positions so as to allow the lid to be brought fully to its closed position. | 01-21-2010 |
20100052276 | ROLLING TOOL CART - A portable containers assembly comprising a base cabinet in the form of a bucket having an upper end and a top case assembly comprising at least one top cabinet. The top cabinet is slidably secured to the base cabinet. The top cabinet is slidable between a closed position in which it substantially covers the upper end of the base cabinet, and an open position in which it exposes the base cabinet. The portable containers assembly further comprising a locomotive assembly having a wheeling assembly and a handle assembly for locomoting the portable containers assembly. | 03-04-2010 |
20120292213 | MOBILE TOOL BOX - A transportable tool box comprising a large compartment configured with upright extending side walls defining a top opening of the large compartment configured with a locomotive arrangement, and two compartmented covers slidingly displaceable over the top opening of the large compartment between a closed position wherein the covers coextend and cover the top opening, and an open position wherein the two covers are displaced away from one another and expose the large compartment to allow access thereto. A locking arrangement is provided for arresting the compartmented covers at the closed position. | 11-22-2012 |
20150352711 | TOOLBOX - Provided is a toolbox including a base member, made of a substantially rigid material, having base side walls extending from a base bottom to a perimetric base rim, and defining together a base interior storage space, said base bottom and base side walls configured with a base interior surface and a base exterior surface; a cover member, made of a substantially rigid material, having a perimetric cover rim, a cover interior surface and a cover exterior surface, said cover rim corresponding in shape and size to fit said base rim; and a liner member having a liner interior surface and a liner exterior surface, said liner member being made of a rigid though pliable material. The liner member is configured to be received within and supported by the base member in a spaced apart relationship therebetween to allow the liner member to be deformed towards the base interior surface. | 12-10-2015 |
20150353231 | CANTILEVER BOX - Provided is a cantilever box including at least two trays, including a lowermost tray and an uppermost tray, interconnected therebetween by cantilever links pivotally secured to the trays, the trays are convertible at least between a stacked position, and an extended position; a first gripping portion, disposed at the uppermost tray, configured for being gripped by a user for converting the trays between their extended position and their stacked position; and a securing mechanism switchable between a locked state in which when the trays are at their extended position, the securing mechanism is configured for arresting a locking member, thereby locking the trays at their extended position; and an unlocked state in which the securing mechanism is disengaged from said locking member, thereby facilitating displacement of the trays from their extended position into their stacked position. | 12-10-2015 |