Patent application number | Description | Published |
20080234187 | Human circulating cytokine CC-1 - Cytokine CC-1 having the amino acid sequence according to SEQ ID No. 6 and its biologically active fragments and/or derivatives, in particular amidized, acetylized, phosphorylized and/or glycosylized derivatives. | 09-25-2008 |
20080242609 | Composition for the therapy of diabetes mellitus and adiposity - A composition containing at least two of the following active substances A, B, C, wherein: | 10-02-2008 |
20080312144 | Peptides for the Treatment of Herpes Virus Infections - The present invention relates to the use of a peptide having the amino acid sequence | 12-18-2008 |
20090124541 | Method for the recovery and application of novel human defensins as biologically active proteins for the treatment of infections and other diseases - The invention relates to the novel peptides, derived from human blood, hBD-5 (human beta-defensin-5), hBD-6, hBD-7, hBD-8, hBD-10, hBD-11, hBD-12, hBD-13, hBD-14, hBD-15, hBD-16, hBD-17, hBD-18, hBD-19, hBD-20, hBD-22, hBD-23, hBD-24, hBD-25, hBD-26, hBD-27, hBD-28, hBD-29, hBD-30, hBD-31 and hBD-32 and their derivatives whose structure was elucidated for the purpose of therapeutic, diagnostic and commercial use as medicaments. The peptides can be prepared by biotechnological, recombinant methods, by chemical synthesis as well as by proteolysis from corresponding precursor proteins. | 05-14-2009 |
20090240031 | Process and intermediate products for preparing cardiodilatin fragments, and highly purified cardiodilatin fragments - The invention relates to a process for the preparation of cardiodilatin fragments, to highly purified cardiodilatin fragments, and to appropriate intermediates for the preparation of said fragments. Furthermore, the invention relates to highly purified cardiodilatin fragments which are free of peptide impurities and exhibit a single migration peak in capillary electrophoresis, as well as to appropriate processes for the preparation of same. | 09-24-2009 |
20100317600 | Process for Preparing Cardiodilatin Fragments; Highly Purified Cardiodilatin Fragments and Intermediate Products for the Preparation of Same - The invention relates to a process for the preparation of cardiodilatin fragments, to highly purified cardiodilatin fragments, and to appropriate intermediates for the preparation of said fragments. Furthermore, the invention relates to highly purified cardiodilatin fragments which are free of peptide impurities and exhibit a single migration peak in capillary electrophoresis, as well as to appropriate processes for the preparation of same. | 12-16-2010 |
20110257099 | Use of Natriuretic Peptide for Treating Heart Failure - The present invention relates to the use of a natriurectic peptide, such as urodilatin, for treating a patient suffering from heart failure, such as acute decompensated heart failure. Preferably, a composition comprising an effective amount of urodilatin is intravenously administered to the patient continuously through a time period of at least 24 hours and up to 120 hours, preferably at least 48 hours. | 10-20-2011 |
20120172365 | USE OF PHOSPHORDIESTERASE INHIBITORS IN THE TREATMENT OF PROSTATIC DISEASES - The present invention pertains to the use of inhibitors of phosphodiesterase I, IV and V for the prophylaxis and treatment of prostatic diseases, in particular the use of
| 07-05-2012 |
20140024585 | Composition for the therapy of diabetes mellitus and adiposity - A composition containing at least two of the following active substances A, B, C, wherein:
| 01-23-2014 |
20140287999 | Use of Natriuretic Peptide for Treating Heart Failure - The present invention relates to the use of a natriurectic peptide, such as urodilatin, for treating a patient suffering from heart failure, such as acute decompensated heart failure. Preferably, a composition comprising an effective amount of urodilatin is intravenously administered to the patient continuously through a time period of at least 24 hours and up to 120 hours, preferably at least 48 hours. | 09-25-2014 |
20140328900 | PROCESS FOR PREPARING HUMAN RELAXIN-2 - A process for preparing human relaxin-2 having the following amino acid sequence: | 11-06-2014 |
Patent application number | Description | Published |
20110263509 | PREPARATION AND USE OF HIGH-PURITY HEMOPARATIDE (HPTH-1-37) FOR THE TREATMENT OF INFLAMMATORY SCALING DISEASES OF THE SKIN - Use of hPTH-1-37 having the amino acid sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL (SEQ ID No. 1) or one of its natural and pharmacologically compatible derivatives, especially amidated, acylated, phosphorylated and glycosylated derivatives, for preparing a medicament for the treatment of inflammatory scaling (erythematosquamous) diseases, especially psoriasis, wherein hPTH-1-37 (SEQ ID No. 1) is present in an amount of from 300 μg to 30 mg per gram of medicament. | 10-27-2011 |
20130197188 | USE OF URODILATIN FOR PREPARING A MEDICAMENT FOR THE TREATMENT OF CARDIOVASCULAR, RENAL, PULMONARY AND NEURONAL SYNDROMES WHILE AVOIDING A REBOUND - Use of urodilatin for preparing a medicament for the treatment of cardiovascular, renal, pulmonary and neuronal syndromes while avoiding a rebound, wherein said medicament for the delivery of urodilatin is suitable in a first quantity for a first period of at least 48 hours, followed by delivery over a second period of at least 12 hours with successive reduction of said first quantity continuously or gradually to 0 ng/kg/min. | 08-01-2013 |
20150051382 | USE OF URODILATIN FOR PREPARING A MEDICAMENT FOR THE TREATMENT OF CARDIOVASCULAR, RENAL, PULMONARY AND NEURONAL SYNDROME WHILE AVOIDING A REBOUND - Use of urodilatin for preparing a medicament for the treatment of cardiovascular, renal, pulmonary and neuronal syndromes while avoiding a rebound, wherein said medicament for the delivery of urodilatin is suitable in a first quantity for a first period of at least 48 hours, followed by delivery over a second period of at least 12 hours with successive reduction of said first quantity continuously or gradually to 0 ng/kg/min. | 02-19-2015 |