Erika
Erika Balzarelli, Zuerich NL
Patent application number | Description | Published |
---|---|---|
20100191252 | Device for removing a tick - The invention relates to a device for removing a parasite from the skin of a host, wherein the device comprises engaging means for engaging the parasite and removing the parasite from the skin of the host, and wherein the device comprises fixation means for fixing the device on the skin of the host, wherein the engaging means are adapted for movement. The device is preferably provided with administering means for the purpose of supplying a cooling medium to at least the parasite. The invention also relates to a method for removing a parasite from the skin, comprising of engaging the parasite, removing the parasite from the skin of the host, supplying a cooling medium to the parasite, fixing the device on the skin of the host and moving the engaging means for the purpose of engaging the parasite. | 07-29-2010 |
20120109153 | Method for Removing a Tick - The invention relates to a device for removing a parasite from the skin of a host, wherein the device comprises engaging means for engaging the parasite and removing the parasite from the skin of the host, and wherein the device comprises fixation means for fixing the device on the skin of the host, wherein the engaging means are adapted for movement. The device is preferably provided with administering means for the purpose of supplying a cooling medium to at least the parasite. The invention also relates to a method for removing a parasite from the skin, comprising of engaging the parasite, removing the parasite from the skin of the host, supplying a cooling medium to the parasite, fixing the device on the skin of the host and moving the engaging means for the purpose of engaging the parasite. | 05-03-2012 |
Erika Bauer, Juchen DE
Patent application number | Description | Published |
---|---|---|
20100022739 | Impression Compounds - The present invention relates to impression compounds based on polyether derivatives, a process for their production and their use. | 01-28-2010 |
20100280212 | POLYMER DISPERSIONS IN POLYESTER POLYOLS - The present invention relates to polymer dispersions in polyester polyols, a process for producing them and their use for the production of polyurethanes, in particular microcellular polyurethanes. These polyester polyols have sulfur atoms and are free of olefinically unsaturated groups. | 11-04-2010 |
20110236671 | METHOD FOR PRODUCING POLYESTER POLYOLS HAVING LOW AMOUNTS OF DIOXANE WASTE - Polyester polyols are produced from at least one carboxylic acid hydride and diethylene glycol by a process in which the formation of 1,4-dioxane is suppressed. These polyester polyols are useful for producing polyurethane (PUR) and polyisocyanurate (PIR) foams and metal composite elements containing these PUR or PIR foams. | 09-29-2011 |
20110237697 | PROCESS FOR THE PRODUCTION OF POLYESTER POLYOLS WITH LOW VOLUMES OF DIOXANE WASTE - The invention relates to the production and use of polyester polyols, formed from at least one carboxylic acid hydride and ethylene glycol, wherein a specialized reaction control stustantially suppresses the formation of | 09-29-2011 |
20120116114 | PROCESS FOR PRODUCING POLYESTER POLYOLS HAVING SECONDARY OH END GROUPS - The invention relates to a process for producing polyester polyols with secondary hydroxyl end groups, including the step of the reaction of a polyester including carboxyl end groups with an epoxide of the general formula (1): | 05-10-2012 |
20120123008 | PROCESS FOR THE PREPARATION OF A POLYURETHANE POLYMER WITH SECONDARY HYDROXYL END GROUPS COMPRISING POLYESTER POLYOLS - The invention relates to a process for the preparation of a polyurethane polymer, comprising the step of reaction of | 05-17-2012 |
20120123009 | POLYESTER POLYOLS MADE OF ISOPHTHALIC ACID AND/OR TEREPHTHALIC ACID AND OLIGOALKYL OXIDES - The present invention relates to a method for producing a polyester polyol having a concentration of ether groups in the range from 9.0 mol/kg of polyester polyol to 22 mol/kg polyester polyol, characterized in that (i) in a first step (A) isophthalic acid, optionally in the form of a C | 05-17-2012 |
20120129966 | PROCESS FOR PRODUCING POLYESTER POLYOLS WITH LOW QUANTITIES OF DIOXANE WASTE - The present invention relates to the production and use of polyester polyols produced from at least one aromatic dicarboxylic acid or an alkyl ester of an aromatic dicarboxylic acid or the anhydride of an aromatic dicarboxylic acid and at least one α,ω-diol, wherein the formation of 1,4-dioxane from diethylene glycol is largely suppressed by means of specific reaction management. | 05-24-2012 |
20120196999 | METHOD FOR THE PRODUCTION OF POLYETHER POLYOLS COMPRISING TERMINAL PRIMARY HYDROXYL GROUPS - The present invention relates to a process for producing polyether polyols having primary hydroxyl end groups, comprising the steps of reacting a starter compound containing active hydrogen atoms with an epoxide under double metal cyanide catalysis, reacting the resulting product with a cyclic carboxylic anhydride and reacting this resulting product with ethylene oxide in the presence of a catalyst containing at least one nitrogen atom per molecule, excluding non-cyclic, identically substituted tertiary amines. The invention further relates to polyether polyols obtainable by this process, compositions containing said polyols and polyurethane polymers based on said polyols. | 08-02-2012 |
20130261205 | PROCESS FOR THE PREPARATION OF POLYRICINOLEIC ACID ESTER POLYOLS HAVING PRIMARY HYDROXYL END GROUPS - The present invention relates to a process for the preparation of polyricinoleic acid ester polyols having primary hydroxyl end groups. It furthermore relates to polyricinoleic acid ester polyols obtainable according to the invention and polyurethane polymers prepared using these polyols. The process comprises the steps: a) polycondensation of ricinoleic acid until a hydroxyl number of >0 mg of KOH/g to <60 mg of KOH/g is reached; and b) reaction of the product obtained in step a) or of a secondary product of the product obtained in step a) comprising carboxyl groups with an epoxide of the general formula (I), wherein R1 represents hydrogen, an alkyl radical or an aryl radical, with the proviso that >80% by weight to <100% by weight, based on the total amount of the epoxide (I) employed, is ethylene oxide and the reaction is carried out in the presence of an amine as the catalyst. | 10-03-2013 |
20130345330 | METHOD FOR PRODUCING FLEXIBLE POLYURETHANE FOAMS - A process for the preparation of polyricinoleic acid esters comprising the step of reaction of ricinoleic acid with an alcohol component which comprises mono- and/or polyfunctional alcohols having a molecular weight of ≧32 g/mol to ≦40 g/mol, wherein the reaction is carried out at least partly in the presence of a catalyst. The amount of catalyst, based on the total weight of the ricinoleic acid and the alcohol component, is in a range of from ≧10 ppm to ≦100 ppm. The reaction is ended when the acid number of the reaction product obtained is ≧5 mg of KOH/g to ≦100 mg of KOH/g. The invention furthermore relates to a polyurethane polymer, in particular a flexible polyurethane foam, which is obtainable using these polyricinoleic acid esters. | 12-26-2013 |
Erika Bereczki, Szeged HU
Patent application number | Description | Published |
---|---|---|
20100087362 | USE OF BIGLYCAN OR ENHANCERS OF BIGLYCAN ACTIVITY IN THE PREPARATION OF PHARMACEUTICAL COMPOSITIONS - The present invention relates to the use of biglycan or enhancers of biglycan activity in the preparation of pharmaceutical compositions having anti-atherosclerotic and anti-ischemic effect, and to the use of them in methods for preventing and treating the atherosclerotic and ischemid (e.g. cardiac) diseases. The invention also relates to screening methods by which biglycan or enhancers of biglycan activity can be identified. | 04-08-2010 |
Erika Bilcikova, Bratislava SK
Patent application number | Description | Published |
---|---|---|
20140147456 | CETP FRAGMENTS - The present invention relates to a peptide consisting of 6 to 20 amino acid residues and being derived from amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23), wherein said peptide comprises amino acid sequence WWLGID (SEQ ID No. 24) and antibodies binding to these peptides. | 05-29-2014 |
Erika Braun, Columbus, OH US
Patent application number | Description | Published |
---|---|---|
20130195308 | EAR WARMER - An adjustable ear warmer is disclosed. The ear warmer has a band and ear members coupled to the band. The band and the ear members are slidably coupled so that the band and the ear members can move relative to each other. In one embodiment, the ear warmer has headphones that are removably coupled to the ear members. | 08-01-2013 |
20130195309 | EAR WARMER - An adjustable ear warmer is disclosed. The ear warmer has a band and ear portions coupled to the band. The band and the ear portions are slideably coupled so that the band and the ear portions can move relative to each other. | 08-01-2013 |
Erika Bruger, Apex, NC US
Patent application number | Description | Published |
---|---|---|
20140278973 | SYSTEM AND METHOD FOR AUDIENCE TARGETING - A method and system for audience targeting is disclosed. According to one embodiment, a computer-implemented method comprises logging content consumed by a first group of users. The content is categorized into a set of topics. The set of topics are mapped to a plurality of users in a trade zone. Based on profile matching and according to a topic of an advertisement campaign, a second group of users are identified from the plurality of users. | 09-18-2014 |
Erika Chiong-Claud, Chicago, IL US
Patent application number | Description | Published |
---|---|---|
20100299320 | Method and System to Facilitate Decision Point Information Flow and to Improve Compliance with a Given Standardized Vocabulary - An information search system incorporating computer algorithms that provide for (1) enforcement of compliance with a standardized vocabulary by a user or users, in a manner that is much more acceptable to users than known existing methods; 2) instant or essentially instant provision of information that is context sensitive, that is, sensitive to the sequence of characters that are entered by a user, in a manner that is highly acceptable to users. | 11-25-2010 |
Erika Chyu, New York, NY US
Patent application number | Description | Published |
---|---|---|
20130268332 | SYSTEMS AND METHODS FOR ENHANCING CUSTOMER SERVICE - A method is disclosed for determining that a consumer is within an area encompassing a merchant. A visual description of the consumer is transmitted to the merchant. Consumer status information is transmitted to the merchant. The method may include determining that the consumer satisfies offer criteria. A promotion offer may he transmitted to the consumer. The merchant may use the visual description or consumer preferences to offer the consumer a personalized product or service. | 10-10-2013 |
Erika Cretton-Scott, Birmingham, AL US
Patent application number | Description | Published |
---|---|---|
20100003217 | Compounds and Pharmaceutical Compositions for the Treatment of Viral Infections - Provided herein are compounds, compositions and methods for the treatment of liver disorder, including HCV infections. Specifically, compound and compositions of nucleoside derivatives are disclosed, which can be administered either alone or in combination with other anti-viral agents. | 01-07-2010 |
Erika Da Silva Carvalho Morani, Jaboticabal BR
Patent application number | Description | Published |
---|---|---|
20140057858 | METHOD FOR INCREASING EMBRYO IMPLANTATION RATE IN MOTHER'S UTERUS IN MAMMALS, USE OF AN EFFECTIVE AMOUNT OF BETA-GALACTOSIDE-BINDING LECTIN OR DERIVATIVES THEREOF, BETA-GALACTOSIDE-BINDING LECTIN OR DERIVATIVES AND PRODUCT - The present invention relates to a method for increasing embryo implantation rate in mother's uterus in mammals by administering to the uterus of a mammal an effective amount of beta-galactoside-binding lectin or derivatives thereof, as well as to a product comprising said lectin. | 02-27-2014 |
Erika Edme, Bordeaux FR
Patent application number | Description | Published |
---|---|---|
20090077887 | Method and apparatus for treating a syngas - Treating a synthesis gas includes generating a plasma jet from a non-transferred arc torch having a main axis, the jet having a propagation axis that is substantially collinear with the main axis of the torch. The plasma torch is mounted on a feed enclosure. The syngas is received at an inlet port of the feed enclosure, the inlet port being downstream from he plasma torch and feeding the syngas so the flow encounters the plasma jet to mix the syngas and plasma jet. The mixture is propagated in an elongate reactor placed downstream from the inlet port to convert the syngas into an outlet gas. The reactor is in communication in its upstream portion with the feed enclosure and has a longitudinal axis that is substantially collinear with the propagation axis of the plasma jet. The outlet gas is extracted via an outlet port. | 03-26-2009 |
20120193215 | METHOD AND APPARATUS FOR TREATING A SYNGAS - Treating a synthesis gas includes generating a plasma jet from a non-transferred arc torch having a main axis, the jet having a propagation axis substantially collinear with the torch main axis. The plasma torch is mounted on a feed enclosure. The syngas is received at an inlet port of the feed enclosure, downstream from the plasma torch and feeding the syngas so the flow encounters the plasma jet to mix the syngas and plasma jet in a distribution chamber. The mixture is propagated in a reactor downstream from the feed enclosure to convert the syngas into an outlet gas. The reactor is in communication in its upstream portion with the feed enclosure through a flared segment, and has a longitudinal axis that is substantially collinear with the propagation axis of the plasma jet. The outlet gas is extracted via an outlet port and particles are captured by a submerged conveyor. | 08-02-2012 |
Erika Ember, Erlangen DE
Patent application number | Description | Published |
---|---|---|
20110119837 | Washing Agent That Is Gentile on Textiles - Reduction of damage to textiles caused when bleach active catalysts are used when washing the textiles, without influencing bleaching performance. The invention relates to a method for washing textiles in the presence of a peroxygenated bleaching agent and a bleach boosting transition metal complex, wherein the method is carried out when water hardness is between 0° dH-3° dH. | 05-26-2011 |
Erika Fischer, Weilheim/teck DE
Patent application number | Description | Published |
---|---|---|
20130038116 | Ceramic Balance Weight - The wheel weight according to the invention ( | 02-14-2013 |
Erika Fuentes-Fernandez, Richardson, TX US
Patent application number | Description | Published |
---|---|---|
20130140950 | MEMS-BASED CANTILEVER ENERGY HARVESTER - The claimed invention is directed to integrated energy-harvesting piezoelectric cantilevers. The cantilevers are fabricated using sol-gel processing using a sacrificial poly-Si seeding layer. Improvements in film microstructure and electrical properties are realized by introducing a poly-Si seeding layer and by optimizing the poling process. | 06-06-2013 |
20140087509 | MEMS-BASED CANTILEVER ENERGY HARVESTER - The claimed invention is directed to integrated energy-harvesting piezoelectric cantilevers. The cantilevers are fabricated using sol-gel processing using a sacrificial poly-Si seeding layer. Improvements in film microstructure and electrical properties are realized by introducing a poly-Si seeding layer and by optimizing the poling process. | 03-27-2014 |
Erika Gasperikova, Berkeley, CA US
Patent application number | Description | Published |
---|---|---|
20090219027 | MULTI-SENSOR SYSTEM FOR THE DETECTION AND CHARACTERIZATION OF UNEXPLODED ORDNANCE - To fully characterize the inductive response of an isolated conductive object, such as buried unexploded ordinance, one needs to measure its response to stimulation by primary magnetic fields in three linearly independent (e.g., approximately orthogonal) directions. In one embodiment this is achieved by measuring the response to magnetic fields of three independent transmitters arranged to have magnetic fields that are linearly independent. According to the apparatus and methods employing the system of this invention, multiple transmitters and receivers of known relative position and orientation on a single platform are used. In a preferred embodiment, matched sets of receiver pairs connected in gradient mode are positioned adjacent to closely spaced pairs of transmitting coils, such that a minor displacement of one or both of the receiver coil pairs relative to the paired transmitting coils will not affect the detected secondary signals emitted by a buried metallic object. | 09-03-2009 |
Erika Gunadi, Los Gatos, CA US
Patent application number | Description | Published |
---|---|---|
20140282546 | METHODS, SYSTEMS AND APPARATUS FOR SUPPORTING WIDE AND EFFICIENT FRONT-END OPERATION WITH GUEST-ARCHITECTURE EMULATION - Methods for supporting wide and efficient front-end operation with guest architecture emulation are disclosed. As a part of a method for supporting wide and efficient front-end operation, upon receiving a request to fetch a first far taken branch instruction, a cache line that includes the first far taken branch instruction, a next cache line and a cache line located at the target of the first far taken branch instruction is read. Based on information that is accessed from a data table, the cache line and either the next cache line or the cache line located at the target is fetched in a single cycle. | 09-18-2014 |
Erika Hartwieg, Belmont, MA US
Patent application number | Description | Published |
---|---|---|
20100093022 | METHODS AND APPARATUS FOR PROVIDING AND PROCESSING SLICED THIN TISSUE - Methods and apparatus for providing and processing serial tissue sections. In one example, an “automatic tape collecting lathe ultramicrotome” (ATLUM) slices a block of tissue sample having various geometries into a continuous ribbon of thin tissue, or multiple thin tissue sections, and disposes the sliced thin tissue on an appropriate substrate to facilitate subsequent imaging of the sliced thin tissue. Closed-loop control of section thickness of the sliced thin tissue sections or ribbons is implemented to produce thinner sliced tissue sections or ribbons and tightly regulate thickness. Thin tissue sections or ribbons may be particularly processed/prepared to facilitate imaging with a scanning electron microscope (SEM). Collected thin tissue sections or ribbons may be used to create UltraThin Section Libraries (UTSLs) that allow for fully automated, time-efficient imaging in the SEM to facilitate expansive tissue studies. | 04-15-2010 |
Erika Hoffmann, Eschweiler DE
Patent application number | Description | Published |
---|---|---|
20080199506 | Coating of the Entire Surface of Endoprostheses - The present invention relates to methods for coating the entire surface of lattice-like or mesh-like endoprostheses, wherein the endoprostheses initially are being provided with a thin layer covering the material surface of the endoprosthesis and subsequently, the surface of the entire endoprosthesis is being coated, wherein said coating of the entire surface covers the struts as well as the interstices between the individual struts. | 08-21-2008 |
20090232866 | Oligopeptides as coating material for medical products - The present invention relates to a pharmaceutical composition comprising a caspase inhibitor and/or a compound of the general formula R-Lys-X, methods for coating medical products using said caspase inhibitors and/or said compounds of general formula R-Lys-X and medical products coated with said caspase inhibitors and/or said compounds of general formula R-Lys-X. | 09-17-2009 |
20100063585 | MANUFACTURE, METHOD AND USE OF ACTIVE SUBSTANCE-RELEASING MEDICAL PRODUCTS FOR PERMANENTLY KEEPING BLOOD VESSELS OPEN - The invention relates to stents and catheter balloons having optimized coatings for eluting rapamycin as well as methods for manufacturing these coatings. | 03-11-2010 |
20100076544 | BIODEGRADABLE VASCULAR SUPPORT - The embodiments described herein are directed to biodegradable stents comprising an inner biodegradable metal scaffold and an outer polymeric coating. The biodegradable coating consists preferentially of biodegradable polymers and may additionally include at least one pharmacologically active substance such as an anti-inflammatory, cytostatic, cytotoxic, antiproliferative, anti-microtubuli, antiangiogenic, antirestenotic (anti-restenosis), antifungicide, antineoplastic, antimigrative, athrombogenic and/or antithrombogenic agent. | 03-25-2010 |
20100179475 | MEDICAL PRODUCT FOR TREATING STENOSIS OF BODY PASSAGES AND FOR PREVENTING THREATENING RESTENOSIS - A method for coating catheter balloons with a defined amount of a pharmacologically active agent, uses a coating device having a volume measuring device for releasing a measurable amount of a coating solution by means of a dispensing device specifically onto the surface of the catheter balloon. | 07-15-2010 |
20110160698 | Balloon Catheter for Treating Stenosis of Body Passages and for Preventing Threatening Restenosis - The present invention is directed to a method for coating catheter balloons with a defined amount of a pharmacologically active agent, wherein the coating method uses a coating device having a volume measuring device for releasing a measurable amount of a coating solution by means of a dispensing device specifically onto the surface of the catheter balloon. | 06-30-2011 |
20110301697 | MANUFACTURE, METHOD AND USE OF DRUG-ELUTING MEDICAL DEVICES FOR PERMANENTLY KEEPING BLOOD VESSELS OPEN - The invention relates to stents and catheter balloons having optimized coatings for eluting rapamycin as well as methods for manufacturing these coatings. | 12-08-2011 |
20120316496 | USE OF COMPOSITIONS TO COAT CATHETER BALLOONS AND COATED CATHETER BALLOONS - The present invention is related to dilatable medical products having short-term contact with the organism, as e.g. balloon catheters coated with at least one layer of at least one antiproliferative, immunosuppressive, anti-angiogenic, anti-inflammatory, fungicidal and/or anti-thrombotic agent and a transport mediator or a mixture of transport mediators, methods for coating of these coated dilatable medical products and the use of compositions for this coating. | 12-13-2012 |
20130005758 | MANUFACTURE, METHOD AND USE OF DRUG-ELUTING MEDICAL DEVICES FOR PERMANENTLY KEEPING BLOOD VESSELS OPEN - The invention relates to stents and catheter balloons having optimized coatings for eluting rapamycin as well as methods for manufacturing these coatings. | 01-03-2013 |
20130103139 | COATING OF ENDOPROSTHESES WITH A COATING CONSISTING OF A TIGHT MESH OF POLYMER FIBERS - The present invention relates to grid-like or net-like endoprosthesis having a continuous, respectively ongoing and interstices-spanning coating with a thread-tangle, wherein this continuous, respectively ongoing and interstices-spanning coating covers the struts as well as the interstices between the single endoprosthesis struts. | 04-25-2013 |
20130123695 | BALLOON CATHETER COATED WITH AN ANTI-RESTENOTIC ACTIVE INGREDIENT AND A MOLECULAR DISPERSION AGENT THAT PROMOTES TRANSPORT - The present invention relates to balloon catheters with or without crimped stent, whose surface is coated with at least one antirestenotic agent and at least one transport promoting molecular dispersant, as well as a method for the preparation of these medical devices. | 05-16-2013 |
20130245058 | MEDICAL PRODUCT WITH A PARTICLE-FREE COATING RELEASING AN ACTIVE SUBSTANCE - Embodiments described herein concern medical products, which come into contact with the organism, such as short-term implants and long-term implants, coated with at least one layer, containing a molecular-disperse distributed or dissolved active substance in at least one carrier and optionally one or more adjuvants, wherein the at least one layer forms a stably spreadable solution, methods for making this coating of stably spreadable solution and use of the medical products coated with the stably spreadable solution. | 09-19-2013 |
20140199365 | RESORBABLE STENTS WHICH CONTAIN A MAGNESIUM ALLOY - The present invention is directed to stents made of a magnesium alloy degradable under physiological conditions and an outer polymeric coating. Herein, the stents according to the invention can be additionally coated with at least one anti-inflammatory, antiproliferative, antiangiogenic, antirestenotic and/or antithrombogenic active agent. | 07-17-2014 |
Erika Hoffmann, Eschweller DE
Patent application number | Description | Published |
---|---|---|
20110287169 | MEDICAL PRODUCT FOR TREATING STENOSIS OF BODY PASSAGES AND FOR PREVENTING THREATENING RESTENOSIS - A method for coating catheter balloons with a defined amount of a pharmacologically active agent, uses a coating device having a volume measuring device for releasing a measurable amount of a coating solution by means of a dispensing device specifically onto the surface of the catheter balloon. | 11-24-2011 |
Erika Hoffmann, Eschweiles DE
Patent application number | Description | Published |
---|---|---|
20110009955 | COMPOUNDS AND METHOD FOR COATING SURFACES IN A HEMOCOMPATIBLE MANNER - The invention concerns oligosaccharides and polysaccharides as well as the use of these oligosaccharides and/or polysaccharides, which contain the sugar unit N-acylglucosamine or N-acylgalactosamine for the production of hemocompatible surfaces as well as methods for the hemocompatible coating of surfaces with said oligosaccharides and/or polysaccharides, which imitate the common biosynthetic precursor substance of heparin, heparan sulphates and chitosan. The invention further describes methods for producing said oligosaccharides and/or polysaccharides and discloses various possibilities of using hemocompatibly coated surfaces. The invention relates particularly to the use of said oligosaccharides and/or polysaccharides on stents with at least one according to invention deposited hemocompatible coating, which contains an antiproliferative, antiinflammatory and/or antithrombotic active agent, methods for the preparation of said stents as well as the use of said stents for the prevention of restenosis. | 01-13-2011 |
Erika Isolauri, Nrumijarvi FI
Patent application number | Description | Published |
---|---|---|
20100178281 | SUPPLEMENTION OF MATERNAL DIET - The use of probiotic bacteria in the manufacture of a composition for administration to a woman in at least the third trimester of pregnancy for prevention of gestational diabetes, normalising plasma glucose concentration and/or increasing insulin sensitivity. | 07-15-2010 |
20140127166 | SUPPLEMENTION OF MATERNAL DIET - The use of probiotic bacteria in the manufacture of a composition for administration to a woman in at least the third trimester of pregnancy for prevention of gestational diabetes, normalizing plasma glucose concentration and/or increasing insulin sensitivity. | 05-08-2014 |
Erika Isolauri, Nurmijarvi FI
Patent application number | Description | Published |
---|---|---|
20100111915 | PROBIOTICS FOR REDUCTION OF RISK OF OBESITY - The use of probiotic bacteria capable of promoting the development of an early bifidogenic intestinal microbiota in the manufacture of a medicament or therapeutic nutritional composition for reducing the risk of development of overweight or obesity of an infant later in life. | 05-06-2010 |
20100189692 | PROBIOTICS FOR USE IN REDUCING EOSINOPHILIA AND RESPIRATORY ALLERGIES - The present invention provides probiotic compositions suitable for reducing the incidence and duration of nasal eosinophilia and other parameters associated with birch pollen allergy. In some embodiments, the present invention provides methods and/or compositions suitable for reducing nasal and/or respiratory allergy symptoms. | 07-29-2010 |
Erika Jakubassa, Brooklyn, NY US
Patent application number | Description | Published |
---|---|---|
20100138796 | INTERACTIVE ELECTRONICALLY PRESENTED MAP - The present invention provides computerized systems and methods for providing electronically presented interactive area representation, such as a map, and information associated therewith. A user can select text, imagery, or other information presented on the map and associated with one or more items or locations, causing presentation of information relating to the associated one or more items or locations, such as appropriate contact information or a hyperlink to an appropriate Web site. Additionally or alternatively, a user can input or select, based on a query or otherwise, information relating to one or more items or locations associated with text, imagery, or other information presented on the map, causing presentation of an indication of one or more locations of the associated text, imagery, or other information on the map. A magnifier feature allowing internal navigation within the map can be provided. Additionally, animated images can appear to move over the map. | 06-03-2010 |
20110161861 | Interactive Electronically Presented Map - The present invention provides computerized systems and methods for providing electronically presented interactive area representation, such as a map, and information associated therewith. A user can select text, imagery, or other information presented on the map and associated with one or more items or locations, causing presentation of information relating to the associated one or more items or locations, such as appropriate contact information or a hyperlink to an appropriate Web site. Additionally or alternatively, a user can input or select, based on a query or otherwise, information relating to one or more items or locations associated with text, imagery, or other information presented on the map, causing presentation of an indication of one or more locations of the associated text, imagery, or other information on the map. A magnifier feature allowing internal navigation within the map can be provided. Additionally, animated images can appear to move over the map. | 06-30-2011 |
20110161872 | Interactive Electronically Presented Map - The present invention provides computerized systems and methods for providing electronically presented interactive area representation, such as a map, and information associated therewith. A user can select text, imagery, or other information presented on the map and associated with one or more items or locations, causing presentation of information relating to the associated one or more items or locations, such as appropriate contact information or a hyperlink to an appropriate Web site. Additionally or alternatively, a user can input or select, based on a query or otherwise, information relating to one or more items or locations associated with text, imagery, or other information presented on the map, causing presentation of an indication of one or more locations of the associated text, imagery, or other information on the map. A magnifier feature allowing internal navigation within the map can be provided. Additionally, animated images can appear to move over the map. | 06-30-2011 |
20130328933 | INTERACTIVE ELECTRONICALLY PRESENTED MAP - The present invention provides computerized systems and methods for providing electronically presented interactive area representation, such as a map, and information associated therewith. A user can select text, imagery, or other information presented on the map and associated with one or more items or locations, causing presentation of information relating to the associated one or more items or locations, such as appropriate contact information or a hyperlink to an appropriate Web site. Additionally or alternatively, a user can input or select, based on a query or otherwise, information relating to one or more items or locations associated with text, imagery, or other information presented on the map, causing presentation of an indication of one or more locations of the associated text, imagery, or other information on the map. A magnifier feature allowing internal navigation within the map can be provided. Additionally, animated images can appear to move over the map. | 12-12-2013 |
Erika Jensen-Jarolim, Wien AT
Patent application number | Description | Published |
---|---|---|
20140251228 | NON-INVASIVE TEMPERATURE AND PHYSICAL ACTIVITY MEASUREMENT OF ANIMALS - A method for an observational screening method or a drug screening method, includes the steps of providing an enclosure for at least one animal with outer sidewalls, preferably 4 outer sidewalls; providing temperature sensing device for sensing a body temperature of at least one animal and/or activity measurement device for measuring at least one parameter related to physical activity of at least one animal; sensing a body temperature of at least one animal and/or measuring at least one parameter related to physical activity of at least one animal; providing data processing device; and processing data related to body temperature and/or to the parameter related to physical activity. | 09-11-2014 |
Erika Jensen-Jarolim, Vienna AT
Patent application number | Description | Published |
---|---|---|
20090304725 | Vaccine and Antigen Mimotopes Against Cancerous Diseases Associated with the Carcinoembryonic Antigen CEA - The present invention relates to a vaccine against cancerous diseases associated with the carcinoembryonic antigen CEA. | 12-10-2009 |
Erika Karplus, Silverthorne, CO US
Patent application number | Description | Published |
---|---|---|
20110009715 | INGESTIBLE EVENT MARKER DATA FRAMEWORK - The ingestible event marker data framework provides a uniform, comprehensive framework to enable various functions and utilities related to ingestible event marker data (IEM data). The functions and utilities include data and/or information having an aspect of data derived from, collected by, aggregated by, or otherwise associated with, an ingestion event. | 01-13-2011 |
20130117696 | Apparatus, System, and Method for Managing Adherence to a Regimen - A method of managing adherence to a regimen in a subscription based computer implemented healthcare information environment. The method includes receiving at a mobile device information from a receiver that a dose was ingested by a living subject. The method provides wirelessly communicating the information over a wireless network to a backend computer processing system and receiving from the computer at the backend processing system a personal information stream characterizing behavior of the living subject based on the received information over a predetermined period. An apparatus includes an adherence package including a foldable sheet, at least one of blister pack coupled to the foldable sheet, at least one ingestible device associated with a dose, and a perforation provided on the foldable sheet to enable removal of the at the least one blister pack from the foldable sheet by tearing along the perforation. | 05-09-2013 |
Erika Karplus, Silverthome, CO US
Patent application number | Description | Published |
---|---|---|
20110212782 | Method and System for Incorporating Physiologic Data in a Gaming Environment - The present invention provides a receiving device and method for use with gaming pursuits, including, in one aspect, a personal signal receiver to communicate physiologic data, a hub to receive the physiologic data, and a gaming module to receive, directly or indirectly, the physiologic data from the hub. | 09-01-2011 |
Erika Katayama, Mito JP
Patent application number | Description | Published |
---|---|---|
20100202930 | PARTICLE MANUFACTURING DEVICE - A particle manufacturing device for manufacturing a particle by mixing a plural number of fluids, thereby manufacturing a particle, being uniform in the size or particle diameter thereof, with stability comprises a mixing channel portion, which is configured to mix the plural number of fluids therein, a residence channel portion, which is connected with the mixing channel portion in series, and in which the particles manufactured in the mixing channel portion reside, a sensor mechanism, which is configured to sense at least a condition of the residence channel portion, and an agitation giving mechanism, which is configured to give an agitation to the residence channel portion, upon basis of the condition, which is detected by the sensor mechanism. | 08-12-2010 |
20100265786 | FLUID MIXER - A fluid mixer for mixing, at least, first fluid and second fluid includes an introducing component having a bore, a cylindrical component fitted into the bore of the introducing component and a mixing component having a conical recess and on which the introducing component and the cylindrical component are held. The fluid mixer further includes a first introducing flow path into which the first fluid is introduced, a first distributing flow path to distribute the first fluid, a second introducing flow path into which the second fluid is introduced, a second distributing flow path for distributing the second fluid introduced from the second introducing flow path so that the first fluid and the second fluid are alternately arranged in an circumferential direction, a joining part in which the first fluid fed from the first distributing flow path and the second fluid fed from the second distributing flow path join together, a mixing flow path formed between a conical section of the cylindrical component and the conical recess of the mixing component and for mixing the first and second fluids, and a discharge flow path to discharge mixed fluid of the first and second fluids fed from the mixing flow path. | 10-21-2010 |
Erika Kato, Atsugi JP
Patent application number | Description | Published |
---|---|---|
20100230677 | THIN FILM TRANSISTOR AND MANUFACTURING METHOD THEREOF - A thin film transistor in which deterioration at initial operation is not likely to be caused and a manufacturing method thereof. A transistor which includes a gate insulating layer at least whose uppermost surface is a silicon nitride layer, a semiconductor layer over the gate insulating layer, and a buffer layer over the semiconductor layer and in which the concentration of nitrogen in the vicinity of an interface between the semiconductor layer and the gate insulating layer, which is in the semiconductor layer is lower than that of the buffer layer and other parts of the semiconductor layer. Such a thin film transistor can be manufactured by exposing the gate insulating layer to an air atmosphere and performing plasma treatment on the gate insulating layer before the semiconductor layer is formed. | 09-16-2010 |
20100327281 | THIN FILM TRANSISTOR AND METHOD FOR MANUFACTURING THE SAME - An object is to provide a thin film transistor with small off current, large on current, and high field-effect mobility. A silicon nitride layer and a silicon oxide layer which is formed by oxidizing the silicon nitride layer are stacked as a gate insulating layer, and crystals grow from an interface of the silicon oxide layer of the gate insulating layer to form a microcrystalline semiconductor layer; thus, an inverted staggered thin film transistor is manufactured. Since crystals grow from the gate insulating layer, the thin film transistor can have a high crystallinity, large on current, and high field-effect mobility. In addition, a buffer layer is provided to reduce off current. | 12-30-2010 |
20120003787 | Manufacturing Method of Semiconductor Film, Manufacturing Method of Semiconductor Device, and Manufacturing Method of Photoelectric Conversion Device - A method for forming an amorphous semiconductor which contains an impurity element and has low resistivity and a method for manufacturing a semiconductor device with excellent electrical characteristics with high yield are provided. In the method for forming an amorphous semiconductor containing an impurity element, which utilizes a plasma CVD method, pulse-modulated discharge inception voltage is applied to electrodes under the pressure and electrode distance with which the minimum discharge inception voltage according to Paschen's Law can be obtained, whereby the amorphous semiconductor which contains an impurity element and has low resistivity is formed. | 01-05-2012 |
20120021570 | METHOD FOR FORMING MICROCRYSTALLINE SEMICONDUCTOR FILM AND METHOD FOR MANUFACTURING SEMICONDUCTOR DEVICE - A seed crystal including mixed phase grains having high crystallinity with a low grain density is formed under a first condition, and a microcrystalline semiconductor film is formed over the seed crystal under a second condition which allows the mixed phase grains in the seed crystal to grow to fill a space between the mixed phase grains. In the first condition, the flow rate of hydrogen is 50 times or greater and 1000 times or less that of a deposition gas containing silicon or germanium, and the pressure in a process chamber is greater than 1333 Pa and 13332 Pa or less. In the second condition, the flow rate of hydrogen is 100 times or greater and 2000 times or less that of a deposition gas containing silicon or germanium, and the pressure in the process chamber is 1333 Pa or greater and 13332 Pa or less. | 01-26-2012 |
20120187408 | MICROCRYSTALLINE SEMICONDUCTOR FILM, METHOD FOR MANUFACTURING THE SAME, AND METHOD FOR MANUFACTURING SEMICONDUCTOR DEVICE - An embodiment of the present invention is a microcrystalline semiconductor film having a thickness of more than or equal to 70 nm and less than or equal to 100 nm and including a crystal grain partly projecting from a surface of the microcrystalline semiconductor film. The crystal grain has an orientation plane and includes a crystallite having a size of 13 nm or more. Further, the film density of the microcrystalline semiconductor film is higher than or equal to 2.25 g/cm | 07-26-2012 |
20130095617 | THIN FILM TRANSISTOR AND METHOD FOR MANUFACTURING THE SAME - An object is to provide a thin film transistor with small off current, large on current, and high field-effect mobility, A silicon nitride layer and a silicon oxide layer which is formed by oxidizing the silicon nitride layer are stacked as a gate insulating layer, and crystals grow from an interface of the silicon oxide layer of the gate insulating layer to form a microcrystalline semiconductor layer; thus, an inverted staggered thin film transistor is manufactured. Since crystals grow from the gate insulating layer, the thin film transistor can have a high crystallinity, large on current, and high field-effect mobility. In addition, a buffer layer is provided to reduce off current. | 04-18-2013 |
Erika Kobayashi, Tokyo JP
Patent application number | Description | Published |
---|---|---|
20080256120 | Document processing apparatus, document processing method, document processing program and recording medium - The text format of input data is checked, and is converted into a system-manipulated format. It is further determined if the input data is in an HTML or e-mail format using tags, heading information, and the like. The converted data is divided into blocks in a simple manner such that elements in the blocks can be checked based on repetition of predetermined character patterns. Each block section is tagged with a tag indicating a block. The data divided into blocks is parsed based on tags, character patterns, etc., and is structured. A table in text is also parsed, and is segmented into cells. Finally, tree-structured data having a hierarchical structure is generated based on the sentence-structured data. A sentence-extraction template paired with the tree-structured data is used to extract sentences. | 10-16-2008 |
Erika Leri, Rivoli IT
Patent application number | Description | Published |
---|---|---|
20120277364 | TYRE REPAIR SEALING COMPOSITION - A tyre repair sealing composition having: 30 to 80% natural latex, 5 to 35% synthetic latex, and 10 to 60% ethylene glycol, and wherein the diameter of the synthetic latex particles advantageously has a mean particle-size distribution of 0.04 to 0.5 μm. | 11-01-2012 |
20150087746 | TYRE REPAIR SEALING COMPOSITION - A tyre repair sealing composition having: 30 to 80% natural latex, 5 to 35% synthetic latex, and 10 to 60% ethylene glycol, and wherein the diameter of the synthetic latex particles advantageously has a mean particle-size distribution of 0.04 to 0.5 μm. | 03-26-2015 |
Erika Lunceford, Brooklyn, NY US
Patent application number | Description | Published |
---|---|---|
20130318006 | ROLLING SETTLEMENT FOR TRI PARTY TRANSACTIONS - A system for settling trades in Tri-Party repurchasing agreements includes one or more processors configured to execute one or more computer program modules. The computer program modules are configured to obtain, on electronic storage media accessible to the one or more processors, security information associated with a plurality of securities securitizing a Tri-Party repurchasing agreement between a dealer and an investor. The computer program modules are also configured to execute one or more computer program modules configured to receive a cash amount from the dealer, the cash amount being less than required to repurchase an entirety of the plurality of securities. The computer program modules are further configured to execute one or more computer program modules configured to release a subset of the entirety of securities to the dealer, the subset of the entirety of securities being repurchased by the cash amount received from the dealer. | 11-28-2013 |
Erika Mascheroni, Figino Serenza IT
Patent application number | Description | Published |
---|---|---|
20100116708 | STARCH-BASED COMPOSITIONS AND RELATED USE AND OBTAINMENT PROCESS - The present invention has, as object, biodegradable compositions consisting of starch, plasticising agent, proteins, a cross-linking enzyme and water; the process for obtaining said compositions; their use for producing biodegradable items, useful in particular for packaging food products, and the biodegradable items thus obtained. In particular, such composition, which is normally obtained in granule form, contains 40%-70% starch, 8%-40% plasticiser, 5%-30% cellulose, 0.5%-5% proteins; the cross-linking enzyme is transglutaminase. | 05-13-2010 |
Erika Mazotti, San Martin, CA US
Patent application number | Description | Published |
---|---|---|
20110233670 | METHOD OF FORMING A REGION OF GRADED DOPING CONCENTRATION IN A SEMICONDUCTOR DEVICE AND RELATED APPARATUS - A method for forming a doped region of a semiconductor device includes masking a portion of a substrate with a mask. The mask is configured to create a graded doping profile within the doped region. The method also includes performing an implant using the mask to create doped areas and undoped areas in the substrate. The method further includes diffusing the doped areas to create the graded doping profile in the doped region. The mask could include a first region having openings distributed throughout a photo-resist material, where the openings vary in size and spacing. The mask could also include a second region having blocks of photo-resist material distributed throughout an open region, where the photo-resist blocks vary in size and spacing. Diffusing the doped areas could include applying a high temperature anneal to smooth the doped and undoped areas to produce a linearly graded doping profile. | 09-29-2011 |
20120261753 | DMOS Transistor with a Slanted Super Junction Drift Structure - A DMOS transistor with a lower on-state drain-to-source resistance and a higher breakdown voltage utilizes a slanted super junction drift structure that lies along the side wall of an opening with the drain region at the bottom of the opening and the source region near the top of the opening. | 10-18-2012 |
Erika Meaddough, Gilroy, CA US
Patent application number | Description | Published |
---|---|---|
20100092484 | CD44 ANTIBODIES - The present invention relates to antibodies including human antibodies and antigen-binding portions thereof that bind to CD44, and that function to inhibit CD44. The invention also relates to heavy and light chain immunoglobulins derived from human CD44 antibodies and nucleic acid molecules encoding such immunoglobulins. The present invention also relates to methods of making human CD44 antibodies, compositions comprising these antibodies and methods of using the antibodies and compositions or medicaments for treatment. | 04-15-2010 |
20120093826 | FULLY HUMAN ANTIBODIES SPECIFIC TO CADM1 - The present disclosure provides isolated monoclonal antibodies, particularly human monoclonal antibodies, more particularly engineered antibodies resulting in increased binding to Fc receptors and/or increased potency for ADCC or immunoconjugates, which specifically bind to CADM1 with high affinity. Nucleic acid molecules encoding CADM1 antibodies, expression vectors, host cells and methods for expressing the CADM1 antibodies are also provided. Bispecific molecules and pharmaceutical compositions comprising the CADM1 antibodies are also provided. Methods for detecting CADM1, as well as methods for treating various cancers, including lung cancer and pancreatic cancer, are disclosed. | 04-19-2012 |
20130156788 | FULLY HUMAN ANTIBODIES SPECIFIC TO CADM1 - The present disclosure provides isolated monoclonal antibodies, particularly human monoclonal antibodies, more particularly engineered antibodies resulting in increased binding to Fc receptors and/or increased potency for ADCC or immunoconjugates, which specifically bind to CADM1 with high affinity. Nucleic acid molecules encoding CADM1 antibodies, expression vectors, host cells and methods for expressing the CADM1 antibodies are also provided. Bispecific molecules and pharmaceutical compositions comprising the CADM1 antibodies are also provided. Methods for detecting CADM1, as well as methods for treating various cancers, including lung cancer and pancreatic cancer, are disclosed. | 06-20-2013 |
Erika Menosso, Pordenone IT
Patent application number | Description | Published |
---|---|---|
20130153562 | COOKING EQUIPMENT AND A METHOD OF DETECTING OPERATING CONDITIONS OF A COOKING EQUIPMENT - A cooking equipment includes an oven cavity ( | 06-20-2013 |
20130156917 | COOKING EQUIPMENT AND A METHOD OF OPERATING A COOKING EQUIPMENT - A Cooking equipment comprises an oven cavity ( | 06-20-2013 |
20130171305 | COOKING EQUIPMENT AND A METHOD OF OPERATING A COOKING EQUIPMENT - A cooking equipment includes a first database, containing first energy consumption data, indicating energy required to maintain, operating conditions prescribed by a cooking program stored in a control device, in the absence of food; and a second database, containing second energy consumption data-indicating additional energy to be supplied in excess of energy of the first energy consumption data to have a unit weight of the food processed according to the cooking program. The control device includes a processing unit that estimates daily energy consumption for the cooking program from the first and second energy consumption data. The first energy consumption data relate to respective individual iterations of the cooking process and include an initial energy excess associated with a first iteration of consecutive iterations of the cooking process; and a common energy level indicative of energy associated with subsequent iterations of the consecutive iterations of the cooking process. | 07-04-2013 |
Erika Menosso, Chions IT
Patent application number | Description | Published |
---|---|---|
20110062151 | APPARATUS FOR COOKING FOOD PRODUCTS ON BOTH SIDES THEREOF - An apparatus for cooking food products on both sides thereof, including a base member ( | 03-17-2011 |
Erika Merschrod, St. John'S CA
Patent application number | Description | Published |
---|---|---|
20110039033 | METHOD OF DEPOSITING A POLYMER MICROPATTERN ON A SUBSTRATE - A method for the direct construction of micropatterned devices using polymeric materials is disclosed. In particular, the present invention relates to a method of depositing a thermocurable or photocurable polymer micropattern on a substrate. | 02-17-2011 |
Erika Misaki, San Francisco, CA US
Patent application number | Description | Published |
---|---|---|
20080307307 | Image capture and manipulation - The present disclosure includes, among other things, systems, methods and program products for image capture and manipulation. | 12-11-2008 |
20120076471 | IMAGE CAPTURE AND MANIPULATION - Systems and techniques to provide image capture and manipulation. In general, in one implementation, the technique includes receiving an input stream including image data from a source, displaying the input stream in real-time including displaying a plurality of instantiations of the stream at a same time, each stream different, the step of displaying including applying a filter to each instantiation of the input stream, and receiving a prompt to select one of the instantiations of the stream. | 03-29-2012 |
20120096386 | USER INTERFACE FOR APPLICATION TRANSFERS - Methods, systems and machine readable tangible storage media that provide a user interface to an application store. In one embodiment, an icon representing an application being transferred to a user device appears to fly across the display area during the download and installation of the application before landing on a dock or other program control area from which the application can subsequently be launched. The user device synchronizes the flight of the icon with the progress of the download and installation by tracking the progress in communication with the server from which the application was transferred. The appearance of flight can be both vertical and horizontal and the icon bounces after the download and installation is complete conveying to the user that the application is ready to launch. The appearances of the locations from which the icon begins and ends its journey are changed to enhance the simulation of flight. Other embodiments are also described. | 04-19-2012 |
20120243748 | Image Capture and Manipulation - The present disclosure includes, among other things, systems, methods and program products for image capture and manipulation. | 09-27-2012 |
20140188808 | BACKUP USER INTERFACE - Methods, systems, and apparatus, including computer programs encoded on a computer storage medium, for storing data are disclosed. In some implementations, visual representations of files are generated for presentation in a backup user interface. The visual representations are generated from sparse file system metadata stored on the computing device, thus allowing faster navigating of the backup user interface. During a restore operation, the metadata can be used to retrieve the items from their physical storage locations. In some implementations, when the storage capacity of a backup storage device exceeds a threshold, the data for the N oldest backups are replaced with sparse file system metadata, which can be used to generate visual representations for presentation in the backup user interface. | 07-03-2014 |
Erika Morizzo, Gent BE
Patent application number | Description | Published |
---|---|---|
20120264917 | BIPARATOPIC PROTEIN CONSTRUCTS DIRECTED AGAINST IL-23 - Biparatopic protein constructs that are directed against IL-23, and in particular against the p19 subunit of IL-23. The constructs comprise at least a first binding domain or binding unit directed against a first defined epitope on p19 and at least a second binding domain or binding unit directed against a second defined epitope on p19 (or the p19/p40 interface). The binding domains or binding units may in particular be a domain antibody, a single domain antibody, a dAb or a Nanobody®. The constructs and pharmaceutical compositions comprising the same can be used for the prevention and/or treatment of diseases and disorders associated with IL-23 or IL-23 mediated signaling, such as inflammation and inflammatory disorders such as colitis, Crohn's disease and IBD, infectious diseases, psoriasis, cancer, autoimmune diseases, sarcoidosis, transplant rejection, cystic Fibrosis, asthma, chronic obstructive pulmonary disease, rheumatoid arthritis, viral infection, and common variable immunodeficiency. | 10-18-2012 |
20130109842 | AMINO ACID SEQUENCES OF NANOBODIES DIRECTED AGAINST P19 SUBUNIT OF THE HETERODIMERIC CYTOKINE IL-23 | 05-02-2013 |
20150044215 | PSEUDOMONAS AERUGINOSA PCRV BINDING SINGLE VARIABLE DOMAIN ANTIBODIES - Polypeptides are provided that are capable of significantly inhibiting andor neutralizing | 02-12-2015 |
Erika Navarro-Sanchez, Montreuil-Sous-Bois FR
Patent application number | Description | Published |
---|---|---|
20100226924 | CHIMERIC POLY PEPTIDES AND THE THERAPEUTIC USE THEREOF AGAINST A FLAVIVIRIDAE INFECTION - The invention relates to building a chimeric polypeptide used for preventing or treating a Flaviviridae infection. The use of the inventive chimeric polypeptide for producing recombinant viral vectors such as a measles living viral vector is also disclosed. | 09-09-2010 |
20120201825 | CHIMERIC POLY PEPTIDES AND THE THERAPEUTIC USE THEREOF AGAINST A FLAVIVIRIDAE INFECTION - The invention relates to building a chimeric polypeptide used for preventing or treating a Flaviviridae infection. The use of the inventive chimeric polypeptide for producing recombinant viral vectors such as a measles living viral vector is also disclosed. | 08-09-2012 |
20150071963 | CHIMERIC POLY PEPTIDES AND THE THERAPEUTIC USE THEREOF AGAINST A FLAVIVIRIDAE INFECTION - The invention relates to building a chimeric polypeptide used for preventing or treating a Flaviviridae infection. The use of the inventive chimeric polypeptide for producing recombinant viral vectors such as a measles living viral vector is also disclosed. | 03-12-2015 |
Erika Petzke, Pfungstadt DE
Erika Polyakova, Brooklyn, NY US
Patent application number | Description | Published |
---|---|---|
20110289783 | APPARATUS AND METHOD FOR PROVIDING A HAND-HELD INSTRUMENT WITH AT LEAST ONE SELECTIVELY OPERABLE RETRACTABLE PROTECTIVE ELEMENT - The present invention is directed to a hand-held instrument, which may comprise, in various exemplary embodiments thereof, a folding (manual, assisted opening, automatic, etc,) knife, a fixed blade knife, or any other hand-held tool comprising a handle, and at least one active region (e.g., a cutting, a saw blade, etc.), and which also advantageously comprises at least one novel user-operable protective element, that when placed, by the user, into an active position that is generally perpendicular to the handle of the instrument, is configured for protecting at least a portion of the user's hand while the instrument is held and/or utilized, and that when placed into a retracted position that is generally parallel to the handle of the instrument, streamlines the instruments longitudinal profile. In accordance with the present invention, the inventive apparatus is advantageously provided with at least one actuating element selectively operable by the user, that when activated, causes a corresponding at least one protective element to automatically extend into the active position. In an alternate embodiment of the present invention, in which the novel instrument comprises an automatic opening blade that exists a predefined region within the handle thereof in response to the user's activation of an opening element, the novel instrument is advantageously provided with an actuating mechanism connected to at least one protective element that is operable to automatically cause the at least one protective element to extend into its active position in conjunction with the blade's automatic opening movement. | 12-01-2011 |
Erika Pope-Gusev, Sarasola, FL US
Patent application number | Description | Published |
---|---|---|
20130130816 | KIT FOR CONSTRUCTING A PLAY STRUCTURE - A kit for constructing a variety of play structures for children includes a plurality of arcuate tubes, a plurality of linear tubes, and a plurality of connectors. At least one of the tubes is releasably assembled together with another one of the tubes using the connectors to form a frame. An instruction manual provides directions for releasably assembling the tubes and the connectors to form the variety of play structures from the kit. The kit may also include at least one covering and at least one covering connector to releasably affix the covering to at least a portion of the frame of the play structure. | 05-23-2013 |
Erika Pope-Gusev, Osprey, FL US
Patent application number | Description | Published |
---|---|---|
20140187117 | KIT FOR CONSTRUCTING A PLAY STRUCTURE - A kit for constructing a variety of play structures for children includes a plurality of arcuate tubes, a plurality of linear tubes, a plurality of connectors, a plurality of couplers, and a plurality of panels. At least one of the tubes is releasably assembled together with another one of the tubes using one of the couplers and the connectors to form a frame. The frame may also include at least one panel releasably coupled to at least one of the couplers. An instruction manual provides directions for releasably assembling the tubes, the connectors, the couplers, and the panels to form the variety of play structures from the kit. The kit may also include at least one covering and at least one covering connector to releasably affix the covering to at least a portion of the frame of the play structure. | 07-03-2014 |
Erika Pringsheim, Garching DE
Patent application number | Description | Published |
---|---|---|
20100133121 | METHOD FOR EVALUATING TARGET MOLECULES - A method for evaluating a target molecule bound to a probe molecule provided with a marker includes: applying AC voltage between a working electrode provided on a substrate and a counter electrode; and using a signal obtained from the marker on the probe molecule bound to the working electrode when a frequency of the AC voltage is varied, or an average value of the signal, to determine at least one of a Stokes radius or molecular weight of the target molecule, a binding rate between the probe molecule and the target molecule, a binding rate constant therebetween, a dissociation rate therebetween, and a dissociation rate constant therebetween. | 06-03-2010 |
Erika Pringsheim, Munich DE
Patent application number | Description | Published |
---|---|---|
20090130777 | METHOD FOR EVALUATING ANALYTE - In an analyte evaluation method for evaluating an analyte, AC voltage is applied between a substrate electrode on a substrate and a counter electrode, and signals obtained from a marker provided on an analyte bound to the substrate electrode are observed, wherein the frequency of the AC voltage is changed and the behavior of the average value of the marker signals is observed. A novel, highly-selective, low-noise method of evaluating a object of evaluation is thus achieved. | 05-21-2009 |
Erika Rosivatz, London GB
Patent application number | Description | Published |
---|---|---|
20090221702 | COMPOUNDS - The present invention provides the use of a compound of the Formula: (I) wherein R | 09-03-2009 |
Erika Scavetta, Bologna IT
Patent application number | Description | Published |
---|---|---|
20110017953 | Process for the Preparation of a Catalytic Specie Using Electro-Deposition - Process for the preparation of a catalytic specie consisting essentially of a metallic support, which is coated with a ceramic active phase layer, mainly compound of the general formula (I): | 01-27-2011 |
20120149548 | PROCESS FOR THE PREPARATION OF A CATALYTIC SPECIE USING ELECTRO-DEPOSITION - Process for the preparation of a catalytic specie consisting essentially of a metallic support, which is coated with a ceramic active phase layer, mainly compound of the general formula (I): | 06-14-2012 |
Erika Segraves, Sunnyvale, CA US
Patent application number | Description | Published |
---|---|---|
20100173372 | Recombinant Halohydrin Dehalogenase Polypeptides - The present disclosure provides engineered halohydrin dehalogenase (HHDH) polypeptides having improved enzyme properties as compared to the wild-type HHDH enzyme HheC and other reference engineered HHDH polypeptides. Also provided are polynucleotides encoding the engineered HHDH enzymes, host cells capable of expressing the engineered HHDH enzymes, and methods of using the engineered HHDH enzymes to synthesize a variety of chiral compounds including chiral epoxides and chiral alcohols. | 07-08-2010 |
20120220002 | Recombinant Halohydrin Dehalogenase Polypeptides - The present disclosure provides engineered halohydrin dehalogenase (HHDH) polypeptides having improved enzyme properties as compared to the wild-type HHDH enzyme HheC and other reference engineered HHDH polypeptides. Also provided are polynucleotides encoding the engineered HHDH enzymes, host cells capable of expressing the engineered HHDH enzymes, and methods of using the engineered HHDH enzymes to synthesize a variety of chiral compounds including chiral epoxides and chiral alcohols. | 08-30-2012 |
Erika Siljeström, Skultuna SE
Patent application number | Description | Published |
---|---|---|
20130009491 | SWITCHING MODULE FOR USE IN A DEVICE TO LIMIT AND/OR BREAK THE CURRENT OF A POWER TRANSMISSION OR DISTRIBUTION LINE - A switching module, intended to be used in a medium or high voltage DC breaker or a DC current limiter, includes at least one power semiconductor switching element, a gate unit arranged to turn the at least one power semiconductor switching element on and off, respectively, according to a switching control signal, and an energy storage capacitor arranged to provide power to a power supply input of the gate unit. The switching module further includes a power transformation device arranged to receive an optical power signal, to transform the optical power signal into an electrical power signal and to provide the electrical power signal to the energy storage capacitor. | 01-10-2013 |
20130200859 | CAPACITOR DISCHARGE IN A CELL BASED VOLTAGE SOURCE CONVERTER - A method and a device to discharge cell capacitors in a cell based voltage source converter. Each cell has switching elements in half bridge or full bridge configuration and a capacitor in parallel to the half or full bridge. Each cell has two terminals, whereof at least one is between two switching elements. The converter has AC and DC terminals, with the possibility to connect each of the terminals to ground, via a further switching element. A resistor is implemented into at least one of the ground connections. To discharge to capacitors, the switching elements in the respective cells are configured such, that the capacitor is in parallel connection to the terminals. The capacitors are thus discharged via the resistor to ground. | 08-08-2013 |
Erika Smith, Beverly Hills, CA US
Patent application number | Description | Published |
---|---|---|
20120290439 | DIGITAL DIRECTORY OF BRAND GOODS USED IN MOTION PICTURES AND MEDIA - A method for online marketing may include the steps of collecting procurement data relating to items that are portrayed in entertainment media productions or in public images of a celebrity and electronically correlating the procurement data into a processor searchable data base. The correlated procurement data may be presented on a processor searchable website that is accessible to consumers. An operator of the website may accept online procurement orders from the consumers for any of the items. | 11-15-2012 |
Erika Snodderley, Avon, IN US
Patent application number | Description | Published |
---|---|---|
20130040815 | USES AND DETECTION OF HERBICIDE RESISTANCE GENES FOR RESISTANCE TO ARYLOXYALKANOATE HERBICIDES - The subject invention provides novel plants that are not only resistant to 2,4-D, but also to a pyridyloxyacetate herbicide. The subject invention also includes plants that produce one or more enzymes of the subject invention “stacked” together with one or more other herbicide resistance genes. The subject invention enables novel combinations of herbicides to be used in new ways. Furthermore, the subject invention provides novel methods of preventing the development of, and controlling, strains of weeds that are resistant to one or more herbicides such as glyphosate. The preferred enzyme and gene for use according to the subject invention are referred to herein as AAD-13 (AryloxyAlkanoate Dioxygenase). This highly novel discovery is the basis of significant herbicide tolerant crop trait and selectable marker opportunities. | 02-14-2013 |
Erika Sundqvist Byhlin, Virsbo SE
Patent application number | Description | Published |
---|---|---|
20130140739 | TOOL AND METHOD FOR EXPANDING A PIPE END - A pipe end is expanded by an expander tool ( | 06-06-2013 |
Erika Svangard, Uppsala SE
Patent application number | Description | Published |
---|---|---|
20090099068 | ON-GROWTH INHIBITING COMPOUNDS - An on-growth inhibiting agent, for the inhibition and/or prevention of on-growth of biological organisms on objects or living beings, includes at least one cyclotide, and a suitable carrier medium. A plant extract containing a mixture of cyclotides is also usable. | 04-16-2009 |
Erika Szekres, San Ramon, CA US
Patent application number | Description | Published |
---|---|---|
20100143494 | Natural Silver Disinfectant Compositions - An antimicrobial composition contains a soluble silver salt and an alkanolamine or aminoalcohol. The composition may additionally contain an amino acid or amino acid salt and surfactant. The composition has additional stability and activity compared to prior art silver complexes. | 06-10-2010 |
Erika Szele, Miskolc HU
Patent application number | Description | Published |
---|---|---|
20130161250 | STATIC SEAL WITH INTEGRATED SCREEN OR FILTER ELEMENT - A static seal and method with integrated screen or filter element comprises at least one supporting layer | 06-27-2013 |
Erika Szilágyi, Tura HU
Patent application number | Description | Published |
---|---|---|
20130030183 | PROCESS FOR PREPARING A PHARMACEUTICAL COMPOUND - The object of the present invention is a one-pot process for preparing the 2-acetoxy-5-(2-fluoro-α-cyclopropyl-carbonyl-benzyl)-4,5,6,7-tetrahydro-4H-tieno[3,2-c]-pyridine (prasugrel) of the formula (I) by reacting the 5,6,7,7a-tetrahydro-4H-tieno[3,2-c]-pyridine-2-on of the formula (II) with 2-bromo-1-cyclopropyl-2-(2-fluorophenyl)-etanone of the formula (III) or with 2-chloro-1-cyclopropyl-2-(2-fluorphenyl)-etanone of the formula (IIIa) and acetylating of the formed compound of the formula (IV), wherein the reaction is carried out in the presence of an organic base with an acetylation agent without isolating the compound of the formula (IV). The coupling and acetylation are carried out in the presence of the same organic base such as triethylamine, N,N-diisopropyl-ethylamine or pyridine. At the end of the process the prasugrel of the formula (I) is purified by recrystallization from an organic solvent or a mixture of solvents. | 01-31-2013 |
Erika Szotek, Hanover Park, IL US
Patent application number | Description | Published |
---|---|---|
20090062243 | Lupane-Type Triterpenoids Modified at 30-Position and Analogues Thereof - The present invention comprises lupine-type triterpenoids that inhibit cell proliferations, in particular cancer and conditions associated with cancer. For example, associated malignancies include ovarian cancer, cervical cancer, breast cancer, colorectal cancer, and glioblastomas, among others. Accordingly, the compounds of the present invention are useful for treating, preventing, and/or inhibiting these diseases. Thus, the present invention also comprising pharmaceutical formulations comprising the compounds and methods of using the compounds and formulations to inhibit cancer and treat, prevent, or inhibit the foregoing diseases. | 03-05-2009 |
20100144688 | 23-Substituted Derivatives of Lupane-type Pentacyclic Triterpenoids - The present invention comprises small molecule inhibitors of cell proliferative conditions, in particular cancer and conditions associated with cancer. For example, associated malignancies include ovarian cancer, cervical cancer, breast cancer, colorectal cancer, and glioblastomas, among others. Accordingly, the compounds of the present invention are useful for treating, preventing, and/or inhibiting these diseases. Thus, the present invention also comprises pharmaceutical formulations comprising the compounds and methods of using the compounds and formulations to inhibit cancer and treat, prevent, or inhibit the foregoing diseases. | 06-10-2010 |
Erika Takahashi, Chigasaki JP
Patent application number | Description | Published |
---|---|---|
20130234131 | SEMICONDUCTOR DEVICE - A semiconductor device which has stable electrical characteristics and high reliability is provided. The semiconductor device includes a gate electrode over an insulating surface, a gate insulating film over the gate electrode, a semiconductor film which is over the gate insulating film and overlaps with the gate electrode, and a protective insulating film over the semiconductor film; and the protective insulating film includes a crystalline insulating film and an aluminum oxide film over the crystalline insulating film. | 09-12-2013 |
Erika Tanaka, Osaka JP
Patent application number | Description | Published |
---|---|---|
20150024320 | ELECTROSTATIC LATENT IMAGE DEVELOPING TONER - An electrostatic latent image developing toner includes toner particles. The toner particles each include a toner core containing a binder resin and a shell layer coating the surface of the toner core. The binder resin contains an ethylene-unsaturated carboxylic acid copolymer. The shell layers contain a unit derived from a monomer of a thermosetting resin. The thermosetting resin is at least one resin selected from the group of amino resins consisting of a melamine resin, a urea resin, and a glyoxal resin. | 01-22-2015 |
Erika Tsubaki, Koln (cologne) DE
Patent application number | Description | Published |
---|---|---|
20090125195 | OPERATOR CONTROL UNIT FOR DEVICES IN A MOTOR VEHICLE - An operator control unit for devices in a motor vehicle, having a carrier element and at least one operator control element arranged on the carrier element for generating an actuating signal for at least one device in the motor vehicle. The carrier element when in the installed state forms a storage space for holding objects to be stored in the passenger compartment of the motor vehicle. | 05-14-2009 |
Erika Volckova, Concord, MA US
Patent application number | Description | Published |
---|---|---|
20090028952 | Hydroxy sulfonate of quinone compounds and their uses - The present invention provides sodium 6-hydroxy-2,2-dimethyl-5-oxo-3,4,5,6-tetrahydro-2H-benzo(h)chromene-6-sulfonate, and its synthesis and uses in the treatment of cancer. | 01-29-2009 |
Erika Von Mutius, Leutstetten/ Starnberg DE
Patent application number | Description | Published |
---|---|---|
20080305089 | Pharmaceutical Composition for Protection from Allergies and Inflammatory Disorders - The present invention relates to a pharmaceutical composition which includes naturally occurring, non-transgenic isolated bacteria from the group of | 12-11-2008 |
Erika Watanabe, Mito-Shi JP
Patent application number | Description | Published |
---|---|---|
20130017425 | Storage Battery Cell, Assembled Battery, Assembled Battery Setup Method, Electrode Group, and Production Method of Electrode GroupAANM WATANABE; ErikaAACI Mito-shiAACO JPAAGP WATANABE; Erika Mito-shi JPAANM Togashi; ShigenoriAACI Abiko-shiAACO JPAAGP Togashi; Shigenori Abiko-shi JP - A storage battery cell includes: an electrode group in which a positive electrode including positive electrode current collector foil provided with a positive electrode layer containing a positive electrode active material, a negative electrode including negative electrode current collector foil provided with a negative electrode layer containing a negative electrode active material, and a separator that intervenes between the positive electrode and the negative electrode are laminated; a battery cell container; and an electrolyte, wherein: the positive electrode active material and the negative electrode active material respectively are substantially uniformly distributed, and the positive electrode layer and the negative electrode layer are provided respectively with regions in which respective quotients of the positive active material and the negative active material in the electrolyte are varied. | 01-17-2013 |
Erika Webb, Boulder, CO US
Patent application number | Description | Published |
---|---|---|
20130337909 | METHOD AND MECHANISM FOR IMPLEMENTING A GAMIFICATION APPLICATION - Disclosed is an improved approach to implement gamification of applications and activities. The approach can be used to create gamification for any application/activity. In some approaches, gamification is provided such that an application is not modified to include the game features. Instead, an external stand-alone gamification mechanism is provided to include the game features, where the external gamification mechanism is used in conjunction with the activity/application. | 12-19-2013 |
Erika Yssel, Richmond, VA US
Patent application number | Description | Published |
---|---|---|
20120240319 | Toilet Flange Assembly With Cover - A toilet flange is provided with a planar perimeter portion to assist the installer in accurately determining the distance to an adjacent wall as well as insuring the toilet fastening bolts are aligned parallel thereto. The toilet flange assembly includes a cover to store needed fastening elements while simultaneously preventing debris from entering the plumbing riser pipe. Additionally, a sleeve is provided that protects the threads of the toilet fastening bolts during construction and acts as an extendable flexible guide sleeve. The guide sleeve functionally extends the height of the toilet fastening bolt thereby assisting the toilet installer as a visual aid during installation. | 09-27-2012 |