Judit
Judit Angster, Stuttgart DE
Patent application number | Description | Published |
---|---|---|
20090038375 | PHOTOACOUSTIC FREE FIELD DETECTOR - The invention relates to a photoacoustic detector including an acoustically open measuring area which is not completely surrounded by a housing. The detector includes an arrangement for introducing excitation light into the measuring area, such that the excitation light can be absorbed by absorbent materials which are located in the measuring area and which are used to produce acoustic energy. The invention also relates to a detector which includes at least one acoustic sensor and an arrangement is provided in order to concentrate the acoustic energy, in order to reach a local maximum of the acoustic pressure on at least one position. The at least one sensor is arranged in the vicinity of the at least one position, whereon the local maximum of the produced acoustic pressure is present or can be produced. The invention also relates to an associated method. | 02-12-2009 |
20090183552 | GAS DETECTOR HAVING AN ACOUSTIC MEASURING CELL AND SELECTIVELY ADSORBING SURFACE - A gas detector with a selectively adsorbing surface ( | 07-23-2009 |
20100045991 | METHOD AND DEVICE FOR MEASURING A PHOTOACOUSTIC SIGNAL WITH COMPUTER-ASSISTED EVALUATION - The application relates to a method for measuring the photoacoustic signal in a photoacoustic cell ( | 02-25-2010 |
20100101305 | PHOTOACOUSTIC DETECTOR WITH TWO BEAM PATHS FOR EXCITATION LIGHT - A photoacoustic detector is presented having the following structure: a first and a second light source ( | 04-29-2010 |
20100103425 | PHOTOACOUSTIC DETECTOR FOR MEASURING FINE DUST - The invention relates to a photoacoustic detector for measuring the concentration of fine dust particles, especially carbon particles in gas, comprising a pulsed light source for providing excitation light, wherein a size distribution of the fine dust particles can be determined by changing the pulse length and/or the pulse repetition rate. | 04-29-2010 |
20100107732 | CYLINDRICAL PHOTOACOUSTIC DETECTOR WITH EXCITATION OF THE SECOND AZIMUTHAL RESONANCE - A device is presented for photoacoustic detection, having a cylindrical acoustic resonator ( | 05-06-2010 |
20100107733 | PHOTOACOUSTIC MULTIPASS CELL WITH CONCENTRATING REFLECTION MEANS - The invention relates to a photoacoustic multipass cell with a light source and means ( | 05-06-2010 |
Judit Bartalis, San Diego, CA US
Patent application number | Description | Published |
---|---|---|
20130225846 | SOLVENT EXTRACTION OF PRODUCTS FROM ALGAE - Processes for extracting product molecules from an algae feed are provided. The algae feed represents an input stream, batch sample, or other algae portion suitable for use in product extraction. The product extraction is typically performed at pressures greater than ambient pressure. This allows for improved extraction, including the potential for use of extraction solvents at temperatures greater than the boiling point for the solvent. | 08-29-2013 |
Judit Bartis, Westford, MA US
Patent application number | Description | Published |
---|---|---|
20090028952 | Hydroxy sulfonate of quinone compounds and their uses - The present invention provides sodium 6-hydroxy-2,2-dimethyl-5-oxo-3,4,5,6-tetrahydro-2H-benzo(h)chromene-6-sulfonate, and its synthesis and uses in the treatment of cancer. | 01-29-2009 |
Judit Cervenak, Budakeszi HU
Patent application number | Description | Published |
---|---|---|
20100041743 | TRANSGENIC ANIMAL WITH ENHANCED IMMUNE RESPONSE AND METHOD FOR THE PREPARATION THEREOF - The present invention provides a method for producing a transgenic (Tg) non-human animal capable of developing an enhanced humoral immune response against an antigen as compared to a non-transgenic control animal of the same species, comprising introducing into said non-human animal a genetic construct providing for enhanced MHC class I-related neonatal Fc receptor (FcRn) activity. Also provided a Tg non-human animal comprising a genetic construct providing for enhanced FcRn activity, as well as the use of such animal in a non-therapeutical method. Therapeutic genetic constructs and methods are also provided. The present invention further provides methods for producing immunoglobulins. | 02-18-2010 |
20130109087 | Transgenic Animal with Enhanced Immune Response and Method for the Preparation Thereof | 05-02-2013 |
Judit Cselenyak, Budapest HU
Patent application number | Description | Published |
---|---|---|
20090215855 | New Crystalline Atorvastatin Hemicalcium Salt Polymorph Form - The present invention relates to a new crystalline polymorph B-52 form of atorvastatin hemicalcium salt [A[(3R,5R)-7-[3-phenyl-4-[(phenyl carbamoyl]-2-(4-fluorophenyl)-5-(1-methylethyl)-1H-pyrrole-1-yl]-3,5-dihydroxy-heptanoic acid calcium salt (2:1)], medicinal preparations containing the new polymorph form, process for the preparation thereof and the use of the new polymorph form for the preparation of medicinal products. | 08-27-2009 |
Judit Cserny, Gainesville, FL US
Patent application number | Description | Published |
---|---|---|
20140314866 | MATERIALS AND METHODS FOR MODULATING IMMUNE RESPONSES - The present invention provides nanoparticle-coupled tolerogenic Treg cell therapy for treatment of immune and/or autoimmune disorders. In certain specific embodiments, the present invention can be used in the prevention and/or treatment of autoimmune diseases including, but not limited to, type 1 diabetes, lupus erythematosus (SLE), multiple sclerosis (MS), inflammatory bowel disease (IBD), rheumatoid arthritis, oophoritis, and autoimmune pathology associated with Graft versus Host Disease (GvHD) following hematopoietic stem cell transplantation. | 10-23-2014 |
Judit Csörgö, Visznek HU
Patent application number | Description | Published |
---|---|---|
20120313323 | Quark Matter Card Games - The disclosed Quark matter card game and methods of playing with cards represent elementary particles which provides first-hand, fun, attractive and enjoyable experience for laypersons such as for example, children, students and researchers to have a hands-on experience of particle and high energy heavy ion or nuclear physics using simple and inexpensive tools. Anyone who knows the colors, red, green, blue, black and white, can start to play one of the games described herein. According an embodiment, the disclosed card game is directed to a deck for playing an educational game, the deck comprises a plurality of card-like devices having a face bearing a representation of an elementary particle. | 12-13-2012 |
Judit Csörgö, Visznek HU
Patent application number | Description | Published |
---|---|---|
20120313323 | Quark Matter Card Games - The disclosed Quark matter card game and methods of playing with cards represent elementary particles which provides first-hand, fun, attractive and enjoyable experience for laypersons such as for example, children, students and researchers to have a hands-on experience of particle and high energy heavy ion or nuclear physics using simple and inexpensive tools. Anyone who knows the colors, red, green, blue, black and white, can start to play one of the games described herein. According an embodiment, the disclosed card game is directed to a deck for playing an educational game, the deck comprises a plurality of card-like devices having a face bearing a representation of an elementary particle. | 12-13-2012 |
Judit Dredán, Budapest HU
Patent application number | Description | Published |
---|---|---|
20130195974 | PH-DEPENDENT GRADUAL RELEASE PHARMACEUTICAL COMPOSITION - The invention concerns a pH-dependent gradual sustained release composition for increasing the pH in the upper part of the small intestines. Particles of the composition are provided with a multilayer polymer coating of specific structure which ensures the gradual release of the active agent in the range of pH 4.5 to 5.5. A process for preparing said composition is also claimed. | 08-01-2013 |
Judit Dredán, Budapest HU
Patent application number | Description | Published |
---|---|---|
20130195974 | PH-DEPENDENT GRADUAL RELEASE PHARMACEUTICAL COMPOSITION - The invention concerns a pH-dependent gradual sustained release composition for increasing the pH in the upper part of the small intestines. Particles of the composition are provided with a multilayer polymer coating of specific structure which ensures the gradual release of the active agent in the range of pH 4.5 to 5.5. A process for preparing said composition is also claimed. | 08-01-2013 |
Judit Erchegyi, San Diego, CA US
Patent application number | Description | Published |
---|---|---|
20080260638 | RECEPTOR(SSTR2)-SELECTIVE SOMATOSTATIN ANTAGONISTS - SRIF peptide antagonists, which are selective for SSTR2 in contrast to the other cloned SRIF receptors and which bind with high affinity to the cloned human receptor SSTR2 but do not activate the receptor, have many useful functions. Because they do not bind with significant affinity to SSTR1, SSTR3, SSTR4 or SSTR5, their administration avoids potential undesirable side effects. Because they block the receptor function, they can be used therapeutically to block certain physiological effects which SSTR2 mediates. By incorporating radioiodine or the like in these SSTR2-selective SRIF antagonists, a labeled compound useful in drug-screening methods is provided. Alternatively, for use in therapy, highly radioactive moieties can be N-terminally coupled, complexed or chelated thereto. | 10-23-2008 |
20080299040 | SOMATOSTATIN RECEPTOR 2 ANTAGONISTS - The invention is directed to somatostatin analogs which are receptor antagonists of the somatostatin receptor, including receptor-selective antagonists, especially sst2-selective antagonists. Related compounds and compositions are included, including antagonists complexed with or conjugated to radioactive nuclides. The antagonists of the invention are useful in diagnosing and treating neoplastic and non-neoplastic mammalian diseases; such methods, and kits, are encompassed. | 12-04-2008 |
20110269683 | RECEPTOR(SSTR2)-SELECTIVE SOMATOSTATIN ANTAGONISTS - SRIF peptide antagonists, which are selective for SSTR2 in contrast to the other cloned SRIF receptors and which bind with high affinity to the cloned human receptor SSTR2 but do not activate the receptor, have many useful functions. Because they do not bind with significant affinity to SSTR1, SSTR3, SSTR4 or SSTR5, their administration avoids potential undesirable side effects. By incorporating radioiodine or the like in these SSTR2-selective SRIF antagonists, a labeled compound useful in drug-screening methods is provided. Alternatively, for use in therapy, highly radioactive moieties can be N-terminally coupled, complexed or chelated thereto. Because they block the receptor function, they can be used therapeutically to block certain physiological effects which SSTR2 mediates. | 11-03-2011 |
Judit Kanyo, Budapest Xiii HU
Patent application number | Description | Published |
---|---|---|
20090276245 | AUTOMATED HEALTHCARE IMAGE REGISTRATION WORKFLOW - Systems, methods and apparatus are provided through which in some implementations automatic selection of a number of options in a clinical scenario of healthcare image workflow is provided. The options include selection of datasets, registration process, display mode, fusing process and/or publication. The automatic selection provides for a fully automated workflow. | 11-05-2009 |
Judit Keresö, Szeged HU
Patent application number | Description | Published |
---|---|---|
20140295501 | NOVEL METHOD TO LOAD A MAMMALIAN ARTIFICIAL CHROMOSOME WITH MULTIPLE GENES - The invention provides for a system for uploading genes of interest into an artificial chromosome expression system (ACE) that has been engineered to include multiple sites for site-specific, recombination directed integration, whereby a second or further gene of interest can be loaded onto the ACE by a targeting vector, through the acceptor recombination site(s) on said ACE. | 10-02-2014 |
Judit Laszy, Nagykovacsi HU
Patent application number | Description | Published |
---|---|---|
20090143398 | PYRIMIDINYL-PIPERAZINES USEFUL AS D3/D2 RECEPTOR LIGANDS - The present invention relates to new dopamine D | 06-04-2009 |
20100240640 | (THIO) Carbamoyl-Cyclohexane Derivatives as D3/D2 Receptor Antagonists - The present invention relates to new D3 and D2 dopamine receptor subtype preferring ligands of formula (I): | 09-23-2010 |
20110112093 | PYRIMIDINYL-PIPERAZINES USEFUL AS D3/D2 RECEPTOR LIGANDS - The present invention relates to new dopamine D | 05-12-2011 |
Judit Lisoni, Oud-Heverlee BE
Patent application number | Description | Published |
---|---|---|
20100276657 | MULTILAYER STRUCTURE COMPRISING A PHASE CHANGE MATERIAL LAYER AND METHOD OF PRODUCING THE SAME - A method of producing a multilayer structure is provided, wherein the method comprises forming a phase change material layer onto a substrate, forming a protective layer, forming a further layer on the protective layer, patterning the further layer in an first 5 patterning step, patterning the protective layer and the phase change material layer by a second patterning step. In particular, the first patterning step may be an etching step using chemical etchants. Moreover, electrodes may be formed on the substrate before the phase change material layer is formed, e.g. the electrodes may be formed on one level, e.g. may forma planar structure and may not form a vertically structure. | 11-04-2010 |
Judit Martinez-Bauza, Sand Diego, CA US
Patent application number | Description | Published |
---|---|---|
20120014590 | MULTI-RESOLUTION, MULTI-WINDOW DISPARITY ESTIMATION IN 3D VIDEO PROCESSING - A disparity value between corresponding pixels in a stereo pair of images, where the stereo pair of images includes a first view and a second view of a common scene, can be determined based on identifying a lowest aggregated matching cost for a plurality of support regions surrounding the pixel under evaluation. In response to the number of support regions having a same disparity value being greater than a threshold number, a disparity value indicator for the pixel under evaluation can be set to the same disparity value. | 01-19-2012 |
Judit Masllorens Llinas, Girona ES
Patent application number | Description | Published |
---|---|---|
20090292141 | NEW METHOD FOR OBTAINING AN AMINOINDAN MESYLATE DERIVATIVE - The invention relates to processes for preparing rasagiline mesylate that avoid the use of alcohol solvents, thereby producing rasagiline mesylate free of any alkyl mesylates, including isopropyl mesylate. The invention further relates to processes for purifying rasagiline mesylate to obtain a product free of alkyl mesylates, and to the thus obtained rasagiline mesylate. | 11-26-2009 |
20100280272 | METHOD FOR OBTAINING AN AMINOINDAN MESYLATE DERIVATIVE - The invention relates to processes for preparing rasagiline mesylate that avoid the use of alcohol solvents, thereby producing rasagiline mesylate free of any alkyl mesylates, including isopropyl mesylate. The invention further relates to processes for purifying rasagiline mesylate to obtain a product free of alkyl mesylates, and to the thus obtained rasagiline mesylate. | 11-04-2010 |
20110313200 | New Method for Obtaining an Aminoindan Mesylate Derivative - The invention relates to processes for preparing rasagiline mesylate that avoid the use of alcohol solvents, thereby producing rasagiline mesylate five of any alkyl mesylates, including isopropyl mesylate. The invention further relates to processes for purifying rasagiline mesylate to obtain a product free of alkyl mesylates, and to the thus obtained rasagiline mesylate. | 12-22-2011 |
Judit Mohás-Cseh, Pecs HU
Patent application number | Description | Published |
---|---|---|
20140128472 | TREATMENT AND PREVENTION OF DISEASES RELATED TO OXIDATIVE STRESS - The present invention relates to the field of treatment and prevention of conditions related to oxidative stress and hormone resistance. Preferably, insulin resistance, erythropoietin resistance and acetyl-choline resistance are in the focus. The invention also relates to the field of use of amino acids, in particular p-L-Tyrosine and a precursor thereof as a medicament or composition or formulation in the prevention or treatment of said conditions. | 05-08-2014 |
Judit Nagyne Bagdy, Budapest HU
Patent application number | Description | Published |
---|---|---|
20080221190 | High Purity Butoconazole Nitrate with Specified Particle Size and a Process for the Preparation Thereof - One object of the invention is high purity butoconazole nitrate of the formula (I) (I) containing maximum 0.1 wt % of chemical impurities, wherein at least 95% of the particles of the substance are below 75pm by diameter, whereas at least 99% of the particles are below 250 μm by diameter, and process for its preparation. A pharmaceutical composition comprising as active ingredient, high purity butoconazole nitrate of specified particle size in admixture with known auxiliaries is also within the scope of | 09-11-2008 |
20090270630 | PROCESS FOR THE SYNTHESIS OF BENZYLIDENE ROSIGLITAZONE BASE - Process for the synthesis of 5-{4-[N-methyl-N-(2-pyridyl)-amino-ethoxy]-benzylidene}-thiazolidine-2,4-dione (INN name: benzylidene-rosiglitazone) of formula (I), which consist of the following steps: | 10-29-2009 |
20110288329 | PROCESS FOR THE PREPARATION OF TRANS 4-AMINO-CYCLOHEXYL ACETIC ACID ETHYL ESTER HCL - The invention relates to a process for the preparation of trans 4-amino-cyclohexil ethyl acetate HCl wherein | 11-24-2011 |
Judit Orgad, Baton Rouge, LA US
Patent application number | Description | Published |
---|---|---|
20110137005 | Chain Extenders - This invention provides chain extender compositions. These compositions comprise | 06-09-2011 |
Judit Petlickijne, Buffalo Grove, IL US
Patent application number | Description | Published |
---|---|---|
20130205172 | Integrated System and Method for Validating the Functionality and Performance of Software Applications - The system and method presented provides a multi-phase, end-to-end integrated process for testing application software using a standard software testing tool. The system and method involve integrating the functional, automated regression and performance phases of software application testing by leveraging deliverables at each phase so that the deliverables may be efficiently reused in subsequent test phases. Deliverables such as functional and technical test conditions and manual test scripts are used as inputs for each phase of the integrated tests. The use of leveraged requirements-based deliverables between test phases significantly reduces much of the repetitive testing typically associated with functionality and performance testing and minimizes repetition of testing errors discovered in earlier test phases. This integrated system and method for validating the functionality and performance of software applications by leveraging deliverables provides enhanced efficiencies, test procedure consistency throughout multiple test phases, consistent test results and high quality software applications. | 08-08-2013 |
Judit Reményi, Budapest HU
Patent application number | Description | Published |
---|---|---|
20100118242 | PHASE MODULATOR SYSTEM COMPRISING A BEAM SPLITTER AND A LINEAR POLARISATION MODE PHASE MODULATOR AND METHOD FOR SEPARATING A LIGHT BEAM TRAVELLING TOWARD AND REFLECTED BACK FROM SUCH A PHASE MODULATOR - The object of the invention is a phase modulator system comprising a beam splitter and a reflection mode phase modulator suitable for modulating linearly polarised light of at least one specific polarisation state while maintaining said polarisation state. The beam splitter and the phase modulator are arranged along an optical path of a light beam. The beam splitter is a polarisation beam splitter and the phase modulator system further comprises an optical rotator being arranged along the optical path between the polarisation beam splitter and the phase modulator, and rotating the polarisation state of the light beam by | 05-13-2010 |
Judit Reményi, Budapest HU
Patent application number | Description | Published |
---|---|---|
20100118242 | PHASE MODULATOR SYSTEM COMPRISING A BEAM SPLITTER AND A LINEAR POLARISATION MODE PHASE MODULATOR AND METHOD FOR SEPARATING A LIGHT BEAM TRAVELLING TOWARD AND REFLECTED BACK FROM SUCH A PHASE MODULATOR - The object of the invention is a phase modulator system comprising a beam splitter and a reflection mode phase modulator suitable for modulating linearly polarised light of at least one specific polarisation state while maintaining said polarisation state. The beam splitter and the phase modulator are arranged along an optical path of a light beam. The beam splitter is a polarisation beam splitter and the phase modulator system further comprises an optical rotator being arranged along the optical path between the polarisation beam splitter and the phase modulator, and rotating the polarisation state of the light beam by | 05-13-2010 |
Judit Rodríguez Costero, Barbera Del Valles - Barcelona ES
Patent application number | Description | Published |
---|---|---|
20150118328 | COMPOSITION FOR SKIN HYGIENE AND/OR HYDRATION - The present invention relates to a composition for cleansing and/or moisturizing skin. The compositions of the invention which provide a cosmetic or dermatological composition for cleansing and/or moisturizing skin, preferably compositions used for showering or bathing, comprise: | 04-30-2015 |
Judit Sala Sabate, Barcelone ES
Patent application number | Description | Published |
---|---|---|
20100297938 | LARGE BAND INDUCTIVE ANTENNA FOR CONTACTLESS COMMUNICATION SYSTEMS - Signal transmission and/or reception device, by contactless inductive coupling comprising at least one structure forming one or several antennas, said structure comprising a plurality of conducting links ( | 11-25-2010 |
Judit Schultheisz, Budapest HU
Patent application number | Description | Published |
---|---|---|
20100022369 | TOY DEVICE FOR COORDINATION AND MOVEMENT SKILL DEVELOPMENT - Toy device ( | 01-28-2010 |
Judit Sovago, Basel CH
Patent application number | Description | Published |
---|---|---|
20150313884 | USE OF ALPHA 7 NICOTINIC ACETYLCHOLINE RECEPTOR AGONISTS - The invention concerns the use of certain alpha 7 nicotinic acetylcholine receptor agonist for the facilitation of emergence from general anesthesia. | 11-05-2015 |
Judit Szecsi, Chassagny FR
Patent application number | Description | Published |
---|---|---|
20140023675 | SULPHATED ARABINOGALACTANS, APIOGALACTURONANS AND SULPHATED HETEROGLYCANS FOR TREATING DISEASES CAUSED BY THE INFLUENZA VIRUS - The present invention relates to polysaccharides selected from sulphated arabinogalactans, apiogalacturonans and sulphated heteroglycans intended to be used as a drug for the preventive or curative treatment of an influenza virus, as well as to the pharmaceutical compositions including, in particular in combination with at least one pharmaceutically acceptable carrier: | 01-23-2014 |
Judit Tulla-Puche, Girona ES
Patent application number | Description | Published |
---|---|---|
20100249370 | PROCESS FOR THE PRODUCTION OF PRAMLINTIDE - Pramlintide, a peptide having the 37 amino acid sequence KCNTATCATQRLANFLVHSSNNFGPILPPT-NVGSNTY-NH2 is prepared via a convergent three-fragment synthesis strategy from the fragments comprising the amino acid residues 1-12, 13-24 and 25-37, respectively. | 09-30-2010 |
Judit Tulla-Puche, Barcelona ES
Patent application number | Description | Published |
---|---|---|
20090171068 | Method of peptide synthesis - A method for solid phase synthesis of Thymosin α | 07-02-2009 |
20090181424 | Mammalian Expression Vector Comprising the MCMV Promoter and First Intron of HCMV Major Immediate Early Gene - A mammalian expression vector that is a murine CMV promoter and the first intron of the major immediate early gene of the human cytomegalovirus. There are mammalian host cells containing the expression vector. There is also a process for the production of recombinant protein by using the expression vector. | 07-16-2009 |
20100292163 | Antitumoral Compounds - Antitumoral compounds of Formula I, and pharmaceutically acceptable salts, derivatives, tautomers, prodrugs or stereoisomers thereof | 11-18-2010 |
20110207674 | ANTITUMORAL COMPOUNDS - Antitumoral compounds of Formula I, and pharmaceutically acceptable salts, derivatives, tautomers, prodrugs or stereoisomers thereof | 08-25-2011 |
Judit Tulla-Puche, Palafrugell ES
Patent application number | Description | Published |
---|---|---|
20140094567 | Diketopiperazine Forming Dipeptidyl Linker - The invention relates to a method for homogeneous solution phase peptide synthesis (HSPPS) of a N-terminal peptide fragment PEP-N and a C-terminal peptide fragment C-PEP, with C-PEP carrying a specific diketopiperazine (DKP) comprising C-terminal protecting group, which contains a handle group HG, with HG being connected to the C-terminus of the peptide fragment; thereby this specific DKP comprising C-terminal protecting group can be selectively cleaved from the peptide as a conventionally used C-terminal protecting group. By the use of this DKP and HG comprising C-terminal protecting group, certain process steps in convergent peptide synthesis based on a combination of HSPPS and solid phase peptide synthesis (SPPS) can be avoided. The invention relates further to a method for the preparation of such specifically protected fragment C-PEP by SPPS by using a linker comprising a specific dipeptide and HG for connecting the growing peptide chain to the resin, which linker forms said DKP group, when the peptide fragment C-PEP is cleaved from the supporting resin; and further to the intermediates of the preparation method. | 04-03-2014 |
20140343227 | Diketopiperazine Forming Dipeptidyl Linker - The invention relates to a method for homogeneous solution phase peptide synthesis (HSPPS) of a N-terminal peptide fragment PEP-N and a C-terminal peptide fragment C-PEP, with C-PEP carrying a specific diketopiperazine (DKP) comprising C-terminal protecting group, which contains a handle group HG, with HG being connected to the C-terminus of the peptide fragmcnt; thereby this specific DKP comprising C-terminal protecting group can be selectively cleaved from the peptide as a conventionally used C-terminal protecting group. By the use of this DKP and HG comprising C-terminal protecting group, certain process steps in convergent peptide synthesis based on a combination of HSPPS and solid phase peptide synthesis (SPPS) can be avoided. The invention relates further to a method for the preparation of such specifically protected fragment C-PEP by SPPS by using a linker comprising a specific dipeptide and HG for connecting the growing peptide chain to the resin, which linker forms said DKP group, when the peptide fragment C-PEP is cleaved from the supporting resin; and further to the intermediates of the preparation method. | 11-20-2014 |
Judit Villen, Seattle, WA US
Patent application number | Description | Published |
---|---|---|
20110269161 | Methods, Compositions and Kits for High Throughput Kinase Activity Screening Using Mass Spectrometry and Stable Isotopes - A mass-spectrometry-based method and substrates are provided herein for large scale kinome activity profiling directly from crude lysates using 90 chemically synthesized peptide substrates with amino acid sequences derived from known phosphoproteins. Quantification of peptide phosphorylation rates was achieved via the use of stable isotope labeled synthetic peptides. Half of these peptides immediately or rapidly showed robust and site-specific phosphorylation after incubation with serum-starved HEK293 cell lysate. A method and substrates for obtaining 90 simultaneous activity measurements in a single-reaction format were developed and validated. Activating kinase pathways through insulin or EGF stimulation reproducibly altered the phosphorylation rates of peptides derived from known pathway protein substrates. While examining cell-cycle-specific activities with the panel, a peptide derived from phosphoinositide 3-kinase regulatory subunit demonstrated mitotic and tyrosine-specific phosphorylation, which was confirmed to be a Src kinase site in vivo. The kinome activity profiling strategy was successfully applied with lysates of each of: cells manipulated by various combination of mitogen stimulation, pharmacological perturbation and siRNA-directed kinase knockdown; seven different breast cancer cell lines treated with gefitinib; and each of normal and cancerous tissue samples from renal cell carcinoma patients. This method concurrently measures multiple peptide phosphorylation rates to provide a diagnostic fingerprint pattern for activated kinases, protein phosphatases, modulators of these enzymes, and pathways (kinome) from as little starting material as a few cells. | 11-03-2011 |
Judit Villen, Boston, MA US
Patent application number | Description | Published |
---|---|---|
20080214782 | Phosphopeptide compositions and anti-phosphopeptide antibody compositions and methods of detecting phosphorylated peptides - The present invention relates to phosphopeptide compositions and anti-phosphopeptide antibody compositions. Also provided are methods of identifying phosphorylation sites in phosphorylated peptides and phosphorylation site motifs. | 09-04-2008 |
20130004963 | Tyrosine, serine and threonine phosphorylation sites - The invention discloses 155 novel phosphorylation sites identified in carcinoma and leukemia, peptides (including AQUA peptides) comprising a phosphorylation site of the invention, antibodies specifically bind to a novel phosphorylation site of the invention, and diagnostic and therapeutic uses of the above. | 01-03-2013 |
20140336360 | Tyrosine, Serine and Threonine Phosphorylation Sites - The invention discloses 155 novel phosphorylation sites identified in carcinoma and leukemia, peptides (including AQUA peptides) comprising a phosphorylation site of the invention, antibodies specifically bind to a novel phosphorylation site of the invention, and diagnostic and therapeutic uses of the above. | 11-13-2014 |