Inventors list

Assignees list

Classification tree browser

Top 100 Inventors

Top 100 Assignees


25 or more peptide repeating units in known peptide chain structure

Subclass of:

514 - Drug, bio-affecting and body treating compositions

514001000 - DESIGNATED ORGANIC ACTIVE INGREDIENT CONTAINING (DOAI)

514002000 - Peptide containing (e.g., protein, peptones, fibrinogen, etc.) DOAI

Patent class list (only not empty are listed)

Deeper subclasses:

Entries
DocumentTitleDate
20100048482COMPOSITIONS AND METHODS FOR MODULATING EPSILON PROTEIN KINASE C-MEDIATED CYTOPROTECTION - Compositions and methods for reducing ischemic cell damage and treating mitochondrial disorders using therapeutic agents derived from the V2 domain of epsilon protein kinase C (PKC) are described.02-25-2010
20090291891VEGF variant that lacks VEGFR-1 binding activity and its use in promotion of re-endothelization and prevention of in-stent restenosis11-26-2009
20100113358LEPTIN COMPOSITIONS AND METHODS FOR TREATING PROGRESSIVE COGNITIVE FUNCTION DISORDERS RESULTING FROM ACCUMULATION OF NEUROFIBRILLARY TANGLES AND AMLYOID BETA - The present disclosure provides compositions containing a leptin product and methods of clinical therapy and diagnostic methods for progressive cognitive disorders. According to one aspect, the described invention provides a method for treating a progressive cognitive disorder. According to another aspect, the described invention provides a method for improving resilience of cognitive function in a subject in need thereof. According to another aspect, the described invention provides a method for identifying an effective therapeutic agent for treating a progressive cognitive dysfunction disease or disorder that results from at least one of accumulation of Aβ, hyperphosphorylation of tau, or accumulation of neurofibrillary tangles.05-06-2010
20080200388Stem cell factor-like proteins and uses thereof - The invention relates to pharmaceutical compositions comprising gastrointestinal proliferative factor SCFA2, SCFA4 or SCFA4v polynucleotides and polypeptides. The invention further relates to the therapeutic use of SCFA2, SCFA4 or SCFA4v to prevent or treat conditions or disorders associated with the degeneration of the epithelial mucosa.08-21-2008
20090209459Method of Treating Myasthenia Gravis - The invention relates to the use of agents that bind the complement protein C5 in the treatment of diseases associated with inappropriate complement activation and in particular in the treatment of myasthenia gravis.08-20-2009
20090203591Methods and compositions for emergency contraception using endothelin receptor antagonists - Disclosed are methods and compositions containing endothelin receptor antagonists for emergency contraception.08-13-2009
20090197808METHODS AND COMPOSITIONS FOR THE REDUCTION OF NEUTROPHIL INFLUX AND FOR THE TREATMENT OF BRONCHPULMONARY DYSPLASIA, RESPIRATORY DISTRESS SYNDROME, CHRONIC LUNG DISEASE, PULMONARY FIBROSIS, ASTHMA AND CHRONIC OBSTRUCTIVE PULMONARY DISEASE - The present invention relates generally to the use of recombinant human CC10 (rhCC10), also known as recombinant human uteroglobin, for use as a therapeutic in the treatment of Respiratory Distress Syndrome (RDS), Bronchopulmonary dysplasia (BPD), chronic lung disease and/or pulmonary fibrosis, Asthma and Chronic Obstructive Pulmonary Disease (COPD). More particularly, the invention provides methods, including broadly the critical dosage ranges of rhCC10, which may be administered to safely and effectively treat the aforementioned conditions. The invention further provides a composition useful in administering rhCC10 to humans.08-06-2009
20090197806ADIPONECTIN FOR TREATMENT OF VARIOUS DISORDERS - Methods for treating various disorders by orally administering adiponectin or a biologically active fragment thereof are described.08-06-2009
20100062981USE OF FIBRINOGEN AS A PROPHYLACTIC TREATMENT TO PREVENT BLEEDING DURING AND AFTER SURGERY AND AS A BIOMARKER TO IDENTIFY PATIENT WITH AN INCREASED RISK FOR EXCESSIVE BLEEDING AND BLOOD TRANSFUSION - The present invention provides a method for preventing peri- and postoperative bleeding in subjects undergoing surgery, in particular subjects with a preoperative fibrinogen plasma level equal to or above the normal range. The method comprises administration of a substance with fibrinogen-like activity to the subject in an amount that result in a circulating fibrinogen plasma level of from about 1.0 g/L. The present invention also provides a method for determining the risk of subjects with a preoperative fibrinogen plasma level equal to or above the normal range to bleed postoperatively. Furthermore, the present invention provides means for predicting the necessity of blood or plasma transfusion after a subject with a preoperative fibrinogen plasma level equal to or above the normal range has been subject to a surgical procedure. The means involves measurement of the fibrinogen level of the subject before surgery and comparing the level with a risk curve.03-11-2010
20100022451USE OF INFANT FORMULA WITH REDUCED PROTEIN CONTENT - A method of continuously reducing the circulating level of insulin like growth factor 1 (IGF-1) in the first few months of the life of an infant comprises administering to the 5 infant a nutritional composition comprising proteins in an amount such that the composition contains less than 2.25 g of protein per 100 kcal. As IGF-1 is known to be a key control point in nutritional regulation of growth, this may offer a method of reducing the risk of developing obesity in later life.01-28-2010
20080312153PYRAZOLE DERIVATIVE, MEDICINAL COMPOSITION CONTAINING THE SAME, MEDICINAL USE THEREOF, AND INTERMEDIATE FOR PRODUCTION THEREOF - The present invention provides pyrazole derivatives represented by the general formula:12-18-2008
20100016222NOVEL AGENT FOR INDUCING APOPTOSIS COMPRISING MSX1 OR A GENE ENCODING THE SAME AS AN ACTIVE INGREDIENT - The present invention relates to a novel use of Msx1 protein or a nucleotide encoding the same for inducing apoptosis. The Msx1 of the present invention induces apoptosis through direct interaction with p53 via a homeodomain and such interaction leads to increased stability, and/or nuclear localization of p53 in cells. The Msx1 or homeodomain thereof can be effectively used for the treatment of tumors, in which wild-type p53 protein has lost its function by some mechanism that inactivates p53 proteins.01-21-2010
20080269120ADP-ribosyl transferase fusion variant proteins - The present invention relates to novel chimeric C3-like Rho antagonists and their use for promoting repair and neuron survival in injured mammalian central and peripheral nervous system and for treating or preventing cancer.10-30-2008
20090069234CELL-PERMEABLE PEPTIDE INHIBITORS OF THE JNK SIGNAL TRANSDUCTION PATHWAY - The invention provides cell-permeable peptides that bind to JNK proteins and inhibit JNK-mediated effects in JNK-expressing cells.03-12-2009
20090137476Apo-2 ligand variants and uses thereof - The disclosure provides Apo-2 ligand variant polypeptides. Methods of making and chemically modifying Apo-2 ligand variant polypeptides are also provided. In addition, formulations of Apo-2 ligand variant polypeptides are provided.05-28-2009
20090325865Liquid Formulations of Pegylated Growth Hormone - Pharmaceutical compositions comprising pegylated growth hormone at pH 7 or below are provided.12-31-2009
20090181888Skin Repair Accelerating Therapeutic Agent Containing Ghrelin and Derivatives Thereof or Substance Acting On GHS-R1a as Active Ingredient - The present invention provides a novel therapeutic agent for skin injuries and a skin regeneration accelerator. The therapeutic agent for skin injuries and the skin regeneration accelerator containing a substance acting on a growth hormone secretagogue receptor or a pharmaceutically acceptable salt thereof as an active ingredient.07-16-2009
20100016228TRUNCATED BARD1 PROTEIN, AND ITS DIAGNOSTIC AND THERAPEUTIC USES - The invention concerns a novel polypeptide derived from the cleavage of the BARD1 protein, a nucleic acid encoding for said polypeptide, and their diagnostic and therapeutic uses, in particular for treating tumors.01-21-2010
20080318867Virulent Phages to Control Listeria Monocytogenes in Foodstuffs and in Food Processing Plants - The present invention relates to virulent (lytic) 12-25-2008
20090054327TAT-utrophin as a protein therapy for dystrophinopathies - Disclosed is a fusion protein including a full-length TAT-utrophin or an anti-dystrophinopathic fragment thereof, a method of treating dystrophinopathies (including Duchenne muscular dystrophy) using the fusion protein, a pharmaceutical composition for treating treating dystrophinopathies in mammals comprising the fusion protein, and nucleic acid constructs for expressing the fusion protein.02-26-2009
20100130426COMPOSITIONS CONTAINING SATIOGENS AND METHODS OF USE - Provided herein are methods and compositions for treating metabolic diseases and conditions associated with metabolic diseases.05-27-2010
20100056447IMMUNIZATION AGAINST CHLAMYDIA PNEUMONIAE - The published genomic sequence of 03-04-2010
20080269131Inhibitors of Akt Activity - Invented are novel 1H-imidazo[4,5-c]pyridin-2-yl compounds, the use of such compounds as inhibitors of protein kinase B activity and in the treatment of cancer and arthritis.10-30-2008
20090305962IL-6 binding proteins - Polypeptides comprising monomer domains that bind to IL-6, or portions thereof, are provided.12-10-2009
20080306004Methods and materials relating to stem cell growth factor-like polypeptides and polynucleotides - The invention provides novel polynucleotides and polypeptides encoded by such polynucleotides and mutants or variants thereof that correspond to a novel human secreted stem cell growth factor-like polypeptides. In particular, the invention relates to novel stem cell growth factor-like polypeptides, including novel proteins named SCGF3248Fk081_aa2, SCGF3248Fk081_aa1, SCGFFk081_aa3, and SCGF323401Fe131_aa1. Other aspects of the invention include vectors containing processes for producing novel human secreted stem cell growth factor-like polypeptides, and antibodies specific for such polypeptides.12-11-2008
20090105144ONE-COMPONENT BONE CEMENT PASTES AND METHODS FOR CURING THEM - One-component bone cement pastes, containing: 04-23-2009
20090118172Shortened glucagon-like peptide 1(sglp-1) preparation method and application - This invention relates to similar compound of glucagon-like peptide 1(glucagon-like peptide-1, GLP-1) secreted by insulinotropic hormone, i.e. shortened glucagon-like peptide 1(sGLP-1) consisting of 26 aminoacids. Its sequence is as follows:05-07-2009
20080280827INHIBITOR OF TGF-BETA ACTIVATION REACTION - The present invention aims to provide a substance(s), especially a peptide(s) capable of inhibiting the TGF-β activation reaction. The present invention provides a peptide consisting of 11 to 50 amino acid residues, which comprises an amino acid sequence Gln-Ile-Leu-Ser-X1-X2-X3-X4-Ala-Ser-Pro (SEQ ID NO: 1) wherein each of X1 to X4 independently represents any given amino acid residue, and X1-X2-X3-X4 is a sequence that is not Lys-Leu-Arg-Leu (SEQ ID NO: 12) and is not cleavable by proteases.11-13-2008
20100009907Glucagon-Like Peptides and Uses Thereof - The present invention relates to non-mammalian Glucagon-like peptides (nmGLP-1), analogs thereof, related nucleic acids, and processes production of such peptides. The nmGLP-1 peptides and analogs thereof of the invention include one or more amino acid sequence modifications. In addition, methods and compositions are disclosed to treat and prevent obesity, reducing body weight, controlling glycemia, controlling or reducing appetite, and reducing food intake.01-14-2010
20090325877Combination Product of Receptor Tyrosine Kinase Inhibitor and Fatty Acid Synthase Inhibitor for Treating Cancer - A pharmaceutical combination product is disclosed that comprises a receptor tyrosine kinase inhibitor and a fatty acid synthase inhibitor, and to the use thereof in the manufacture of a medicament for use in the treatment or prophylaxis of cancer.12-31-2009
20100160229TREATMENT OF EARLY-STAGE OSTEOARTHRITIS - A method for treating early-stage osteoarthritis in an animal is provided. The method comprises delivery of a therapeutically effective amount of a parathyroid hormone (PTH) or a PTH derived substance to an affected joint cavity of the patient. Methods for inhibiting articular chondrocytes apoptosis and for inhibiting a degenerative process of articular chondrocytes in an afflicted animal are also provided.06-24-2010
20100160232PHYSIOLOGICALLY ACTIVE COMPLEX COMPRISING PROTAMINE AND/OR SALT THEREOF AND AN ACIDIC MACROMOLECULAR SUBSTANCE, AND USE THEREOF - To provide a method of reducing an intrinsic harsh/astringent taste of protamine and a protamine salt and effectively using a fat absorption suppressive effect of these.06-24-2010
20100160231AXMI-150 DELTA-ENDOTOXIN GENE AND METHODS FOR ITS USE - Compositions and methods for conferring pesticidal activity to bacteria, plants, plant cells, tissues and seeds are provided. Compositions including a coding sequence for pesticidal polypeptides are provided. The coding sequences can be used in DNA constructs or expression cassettes for transformation and expression in plants and bacteria. Compositions also include transformed bacteria, plants, plant cells, tissues, and seeds. In particular, isolated pesticidal nucleic acid molecules are provided. Additionally, amino acid sequences corresponding to the polynucleotides are encompassed. In particular, the present invention provides for isolated nucleic acid molecules having nucleotide sequences encoding the amino acid sequence shown in SEQ ID NO:2, the nucleotide sequence set forth in SEQ ID NO:1, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12, as well as variants and fragments thereof.06-24-2010
20100160228METHOD FOR INHIBITING OR STIMULATING ANGIOGENESIS IN AN INDIVIDUAL - The invention concerns a method for inhibiting vascular endothelial growth factor receptor 2 (VEGFR2) signalling in an individual by administering an effective amount of an agent capable of activating T cell protein tyrosine phosphatase (TCPTP), and a method for inhibiting angiogenesis and treating or preventing diseases related thereto. Furthermore, this invention concerns a method for stimulating angiogenesis or for treatment or prevention of a disease benefiting from increasing the growth of blood vessels in an individual by inhibiting TCPTP.06-24-2010
20100160226Y-RECEPTOR AGONISTS - Human Pancreatic Polypeptide mutants are provided which have utility, inter alia, for regulation of energy intake or energy metabolism, control of intestinal secretion, decrease of gastrointestinal tract motility, decrease of rate of gastric emptying, treatment of obesity or overweight, or conditions in which obesity or overweight is a contributory factor.06-24-2010
20090029918Method for producing mature VWF from VWF Pro-Peptide - The present invention relates to a method for producing a mature von Willebrand Factor (VWF) from von Willebrand Factor pro-peptide comprising the steps: 01-29-2009
20100152107LONG-TERM FEED - CANCER PATIENT - Pursuant to the present invention, methods and compositions are provided for providing long-term tube-fed nutrition. More specifically, pursuant to the present invention, methods and compositions are provided for providing long-term tube-fed nutrition to cancer patients.06-17-2010
20090192087Methods and Compositions Using Klotho-FGF Fusion Polypeptides - The present invention is directed to methods, kits and compositions for preventing or treating age-related conditions or metabolic disorders. The Klotho fusion polypeptides of the invention include at least a Klotho protein or an active fragment thereof. The Klotho fusion proteins are useful in the treatment and prevention of a variety of age-related conditions and metabolic disorders.07-30-2009
20090192086IDENTIFICATION OF A NOVEL BHD GENE - The present disclosure relates to Birt-Hogg-Dubé syndrome, nucleic acids encoding the BHD gene, and methods of using the nucleic acids and proteins encoded thereby. In particular, the present disclosure relates to methods of diagnosing BHD disease and related conditions, such as spontaneous pneumothorax and kidney cancer, and methods of treating BHD skin lesions.07-30-2009
20090192084Compositions and method of treating hypoxia-associated diseases - Hypoxia, a state of lower than normal tissue oxygen tension, has recently been implicated in a host of human diseases, including cancer, heart disease, and neurological disorders. Novel associations between p97 and other proteins, including UBX-domain-containing proteins (UBX-polypeptides), HIF1α, and a variety of E3 ligases are provided herein. The disclosure provides complexes comprising UBX-domain-containing polypeptides (UBX-polypeptides) and other polypeptides involved in the degradation of ubiquitinated proteins. In addition, the disclosure provides uses for active agents that modulate protein-protein complex formation between an UBX-polypeptide and its complementary-binding substrate. For example, the disclosure provides methods for treating or preventing hypoxia-related disorders or conditions in a patient or a cell by administration of an active agent that modulates the activity of an UBX-polypeptide and/or its complementary binding-substrate. Furthermore, the disclosure provides uses for active agents that modulate HIF1α activity; such agents may be used to modulate processes that are regulated by HIF1α. The disclosure also provides many screening assays to identify test agents that modulate complex formation between an UBX-polypeptide and its complementary-binding substrate or methods for evaluating modes of action and/or effects of active agents that have already been identified as modulators of an UBX-polypeptide and/or its complementary-binding substrate.07-30-2009
20090192081Casein derived peptides and uses thereof - Biologically active peptides that are derived from or are similar to sequences identical with the N-terminus of the αS1 fraction of milk casein. These peptides are capable of stimulating and enhancing immune response, protecting against viral infection, normalizing serum cholesterol levels, and stimulating hematopoiesis. The casein-derived peptides are non-toxic and can be used to treat and prevent immune pathologies, hypercholesterolemia, hematological disorders and viral-related diseases, alone or in combination with other peptides or blood cell stimulating factors.07-30-2009
20100087370MODULATION OF NITRIC OXIDE SIGNALING TO NORMALIZE TUMOR VASCULATURE - The instant invention provides methods for treating a solid tumor in a subject comprising modulating nitric oxide production in the tumor to normalize tumor vasculature and administering an anti-tumor therapy to the subject. The invention further provides methods of treating a solid tumor in a subject comprising selectively increasing cyclic guanosine monophosphate (cGMP) or cGMP dependent protein kinase G production in the tumor vasculature to an amount effective to normalize tumor vasculature and administering an anti-tumor therapy to the subject.04-08-2010
20100087367PRODUCTS AND METHODS USING SOY PEPTIDES TO LOWER TOTAL AND LDL CHOLESTEROL LEVELS - Controlled studies demonstrate that products and related methods using soy related peptides lower total and LDL cholesterol levels in individuals. In one exemplary embodiment of the present disclosure, a product containing an effective amount of lunasin peptides that lowers cholesterol levels in an individual that consumes the lunasin peptides is provided. In another exemplary embodiment of the present disclosure, a composition containing an effective amount of lunasin peptides or lunasin peptide derivatives and one or more enzyme inhibitors is provided. In a related exemplary embodiment of the present disclosure, a method for lowering or reducing cholesterol levels in an individual is provided where a product containing an effective amount of lunasin peptides to an individual is provided and a claim that the product lowers or reduces cholesterol, total cholesterol, LDL cholesterol or lipid levels in an individual that consumes the composition is made.04-08-2010
20100087366GH SECRETAGOGUES AND USES THEREOF - The invention relates to use of a GH secretagogue (e.g. GRF or an analog thereof) for (1) altering a lipid parameter in a subject; (2) altering a body composition parameter in a subject, (3) treating a condition characterized by deficient or decreased bone formation in a subject (4) improving daytime vigilance and/or cognitive function in a subject, (5) improving a metabolic condition in a subject, (6) improving anabolism in a catabolic condition in a subject, and/or (7) improving and/or reconstituting immune function in a subject.04-08-2010
20080242615SURFACTANT PROTEIN-D FOR PREVENTION AND TREATMENT OF LUNG INFECTIONS AND SEPSIS - Surfactant protein D (SP-D) is a member of the collectin family of collagenous lectin domain-containing proteins that is expressed in epithelial cells of the lung. Administration of SP-D protein or fragments thereof is useful for the prevention or treatment of sepsis or lung infection.10-02-2008
20100137204GLP-1 PHARMACEUTICAL COMPOSITIONS - The present invention is directed to peptide analogues of glucagon-like peptide-1, the pharmaceutically-acceptable salts thereof, to methods of using such analogues to treat mammals and to pharmaceutical compositions useful therefore comprising said analogues.06-03-2010
20100081619Peptide Toxin Formulation - Procedures are described which use solvents to increase the topical insecticidal activity of toxic insect peptides. These procedures comprise drying the peptides, if needed, followed by the addition of either: 1) a polar organic solvent, with or without water, to a dried peptide, or 2) the addition of polar aprotic solvent or other adjuvant to the dried peptide, followed by the addition of either: 1) a polar organic solvent, with or without water, (where a polar aprotic solvent is added first) or 2) a polar aprotic solvent or other adjuvant to the peptide polar organic solvent (where the polar organic solvent is added first), to the peptide formulation.04-01-2010
20100081616EXTRACELLULAR MATRIX-BINDING PROTEINS FROM STAPHYLOCOCCUS AUREUS - An isolated extracellular matrix-binding protein, designated as SdrD and its corresponding amino acid and nucleic acid sequences and motifs are described. The proteins, peptides, fragments thereof or antigenic portions thereof are useful for the prevention, inhibition, treatment and diagnosis of 04-01-2010
20090215689FGF2-BINDING PEPTIDES AND USES THEREOF - FGF2-binding peptides are here described, which have been designed starting from the N-terminal region of PTX3, in particular spanning the PTX3(82-110) region. Synthetic peptides related to this sequence are able to bind FGF2 and to inhibit its pro-angiogenic activity in vitro and in vivo with no anticipated impact on innate immunity.08-27-2009
20090093411Long-acting hormone and growth factor compositions and uses thereof - This invention provides VEGF-FSH compounds having increased serum half-lives relative to either native VEGF or FSH, in which both VEGF and FSH are biologically active. This invention also provides related compositions and methods for increasing fertility, egg production and spermatogenesis in a subject, as well as methods for increasing vascularization in a tissue, particularly in ovarian tissue.04-09-2009
20100137208INTRATUMORALLY ADMINISTERED LACTOFERRIN IN THE TREATMENT OF MALIGNANTNEOPLASMS AND OTHER HYPERPROLIFERATIVE DISEASES - The present invention relates to methods of treating a hyperproliferative disease by administering a composition of lactoferrin alone or in combination with standard anti-cancer therapies.06-03-2010
20100048467Cystine-Knot Fold Cytokine - This invention relates to a novel protein (INSP002), herein identified as a secreted protein that is a member of the Dan family of the cystine-knot fold cytokine superfamily and to the use of this protein and nucleic acid sequences from the encoding genes in the diagnosis, prevention and treatment of disease.02-25-2010
20080318856MONOMER PROTEIN WITH BONE MORPHOGENETIC ACTIVITY AND MEDICINAL AGENT CONTAINING THE SAME FOR PREVENTING AND TREATING DISEASES OF CARTILAGE AND BONE - This invention provides for a protein of the TGF-β superfamily in which the cysteine involved in the normal formation of homodimers is changed to another amino acid. These mutant proteins, as monomers, display higher bone morphogenetic activity than the wild-type protein dimers. Also provided is a method for producing and isolating these monomers by plasmid driven expression in various host systems including 12-25-2008
20090069230GDNF-DERIVED PEPTIDES - Compositions that include peptides derived from glial-derived neurotrophic factor (GDNF) (e.g., substantially pure polypeptides comprising a fragment of a GDNF precursor protein) and biologically active variants thereof are provided. The compositions can include one or more types of peptides and can include other substances (e.g., pharmaceutically acceptable carriers or diluents or liposomes). Also provided are methods for using the compositions for treatment of neurological disorders (e.g., motor system disorders and sensory system disorders).03-12-2009
20090318353Acylated Exendin-4 Compounds - This invention provides new therapeutic peptides, i.e. new protracted Exendin-4 compounds, pharmaceutical compositions and the use of such.12-24-2009
20090023652POLYCATIONIC CALCIUM MODULATOR PEPTIDES FOR THE TREATMENT OF HYPERPARATHYROIDISM AND HYPERCALCEMIC DISORDERS - The present invention provides methods and kits for treating hyperparathyroidism, bone disease and/or hypercalcemic disorders. In particular, methods for lowering serum PTH and serum calcium using polycationic calcium modulator peptides are provided. The calcium modulator peptides can be used to treat subjects having, for example: primary, secondary or tertiary hyperparathyroidism; hypercalcemia of malignancy; metastatic bone disease; or osteoporosis.01-22-2009
20100016223TREATMENT OF CARTILAGE DISORDERS WITH FGF-18 - This invention concerns the treatment of cartilage disorder and osteoarthritis in particular. More specifically, it relates to the use of FGF-18 in treatment regimens and for the manufacture of a medicament for the treatment of patients having a cartilage disorder such as osteoarthritis, such as for example knee osteoarthritis or secondary hip osteoarthritis. Specifically provided is a preferred treatment scheme comprising once weekly administration of an FGF-18 compound per treatment cycle.01-21-2010
20080274970VASCULAR ADHESION MOLECULES AND MODULATION OF THEIR FUNCTION - The invention relates to new polypeptides in isolated form belonging to a subfamily of the human immunoglobulin superfamily, which polypeptide shows at least 70% sequence homology with the amino acid sequence of the murine Confluency Regulated Adhesion Molecules 1 or 2 (CRAM-1 or CRAM-2) as depicted in FIG. 11-06-2008
20100113340NUCLEIC ACIDS CODING FOR ADHESION FACTOR OF GROUP B STREPTOCOCCUS, ADHESION FACTORS OF GROUP B STREPTOCOCCUS AND FURTHER USES THEREOF - The present invention is related to nucleic acids coding for adhesion factors of group B 05-06-2010
20100113364FACTOR VIII POLYMER CONJUGATES - The invention is a proteinaceous construct comprising a Factor VIII molecule which is conjugated to a water-soluble polymer via carbohydrate moieties of Factor VIII, and methods of preparing same.05-06-2010
20100113363Use of GLP-1 Peptides - GLP-1(1-45) or a fragment or an analogue thereof can be used in the preparation of a medicament for peripheral administration in the suppression of appetite or induction of satiety.05-06-2010
20100113343METHODS INVOLVING LEF-1 REGULATION AND USE OF LEF-1 OR COMPOUNDS ALTERING LEF-1 SIGNALLING FOR TREATING OR PREVENTING DISEASES - The present inventions relates to the use of LEF-1 or functional fragments or homologs thereof, or enhancer or inducer of LEF-1 expression, activity or LEF-1 mediated signalling for the preparation of a pharmaceutical for preventing or treating all types of cytopenia of the myeloid or lymphoid lineage. In particular, the present invention relates to the treatment of severe congenital neutropenia. In another embodiment the present invention relates to the treatment of various types of cancer, in particular, of cancer involving altered granulocyte proliferation, survival and differentiation from granulocytes progenitor cells.05-06-2010
20100113355NOVEL ANTIBODY MOLECULES AND NUCLEIC ACIDS BINDING TO FUNGAL STRESS PROTEIN HSP90 - An scFv peptide comprising a V05-06-2010
20100113350METHODS AND COMPOSITIONS FOR MODULATING PROSTASIN - The invention provides methods and compositions related to modulating prostasin.05-06-2010
20100113348PERCUTANEOUSLY ABSORBABLE PREPARATION, PROCESS FOR PRODUCTION THEREOF AND METHOD FOR PERCUTANEOUS ABSORPTION - This invention is to provide a transdermal permeation preparation which includes a concentrated transdermal active ingredient laminate and exhibits high transdermal permeation effect; and a method for producing the preparation05-06-2010
20100113347EXENATIDE AND DALARGIN-BASED MEDICINAL PREPARATION FOR TREATING PANCREATIC DIABETES - This invention relates to the field of medicine, in particular, to endocrinology. This invention offers a method of potentiation of a therapeutic effect of exenatide by administration of an effective quantity of exenatide in combination with an effective quantity of dalargin. Advantageous therapeutic effects of the invention include lowering of pathologically elevated levels of blood glucose and cholesterol in patients suffering from diabetes mellitus. This invention offers a method of treatment of diabetes mellitus by administration of an effective quantity of exenatide in combination with an effective quantity of dalargin. This invention offers the use of the combination of exenatide and dalargin for the preparation of the medication for the treatment of diabetes mellitus. This invention offers a medicinal preparation for the treatment of diabetes mellitus containing an effective quantity of exenatide, an effective quantity of dalargin and a pharmaceutically acceptable vehicle or diluent, as well as a method of preparation of this preparation. This invention offers a medicinal preparation for the treatment of diabetes mellitus in the form of a kit containing the medicinal preparation exenatide and the medicinal preparation dalargin, as well as a method of use of this medicinal preparation.05-06-2010
20100113342ANTIMICROBIAL KINOCIDIN COMPOSITIONS AND METHODS OF USE - The present invention provides novel kinocidin peptides comprising a C-terminal portion of a kinocidin, wherein the C-terminal portion encompasses an α-helical secondary structure and further displays antimicrobial activity. The kinocidin peptides of the invention are derived from and correspond to a C-terminal portion of a kinocidin that includes a γκo core and that can be a CXC, CC, or C class chemokine. Structural, physicochemical and functional properties of this novel class of antimicrobial peptides and amino acid sequences of particular kinocidin peptides are also disclosed. The invention also provides related antimicrobial methods.05-06-2010
20100113341METHODS OF USING CORTICOTROPIN-RELEASING FACTOR FOR THE TREATMENT OF CANCER - Provided herein is a method for treating cancer in a human by administering a high dose of corticotropin-releasing factor (CRF) for a period of time exceeding 3 days.05-06-2010
20100113339Serum albumin binding proteins with long half-lives - The present invention relates to amino acid sequences that are capable of binding to serum albumin; to compounds, proteins and polypeptides comprising or essentially consisting of such amino acid sequences; to nucleic acids that encode such amino acid sequences, proteins or polypeptides; to compositions, and in particular pharmaceutical compositions, that comprise such amino acid sequences, proteins and polypeptides; and to uses of such amino acid sequences, proteins and polypeptides.05-06-2010
20100075904Carbon nanotube composite scaffolds for bone tissue engineering - The present invention provides biocompatible composite materials that can be fabricated into a scaffold having properties suitable for bone repair and regeneration. These scaffolds have sufficient mechanical strength to be useful for the repair and regeneration of cortical bone.03-25-2010
20100075901NOVEL USE OF HIV NC PROTEIN - The present invention relates to a novel use of the HIV NC protein, and more particularly, it is relates to a pharmaceutical composition for preventing and treating AIDS having a polypeptide comprising HIV NC protein as an active component and the method of inhibiting HIV proliferation by using the polypeptide. The polypeptide comprising HIV NC protein of the present invention, when it is overexpressed, has the effect on inhibiting HIV proliferation. Accordingly, the present invention provides not only the novel means of inhibition of HIV proliferation, but also the novel method for preventing and treating AIDS.03-25-2010
20100075900Use of Nutritional Compositions for Preventing Disorders - The present invention relates to a method for preventing and/or treating visceral adiposity by administering a certain nutritional composition to an infant with the age between 0 and 36 months, and preventing the occurrence of diseases later in life.03-25-2010
20100075907NEUROMEDIN U RECEPTOR AGONISTS AND USES THEREOF - Neuromedin U receptor agonists for use in the treatment of metabolic disorders such as obesity and diabetes are disclosed.03-25-2010
20100075905Novel cellular factor-containing solution compositions - The invention is directed to novel cellular factor-containing solution compositions (referred to herein as “CFS” compositions), including novel sustained-release cellular factor-containing solution compositions (referred to herein as “SR-CFS” compositions), methods of making such novel compositions and uses thereof.03-25-2010
20100075903Lyophilized VEGF Antagonist Formulations for Intravitreal Administration - Ophthalmic formulations of a vascular endothelial growth factor (VEGF)-specific fusion protein antagonist are provided suitable for intravitreal administration to the eye. The ophthalmic formulations include a stable liquid formulation and a lyophilizable formulation. Preferably, the protein antagonist has the amino acid sequence shown in SEQ ID NO:4.03-25-2010
20100075902Recombinant XRGD-Enriched Gelatins Having High Stability - The invention concerns recombinant gelatin monomers and recombinant gelatins comprising or consisting of multimers of the monomers. The recombinant gelatins are of particular use in several applications involving cell attachment such as in cell culture work and applications involving cell cultures of anchor dependent cells and also in a variety of medical applications.03-25-2010
20100075898N-TERMINAL VDAC VARIANTS AND USES THEREOF - The present invention relates generally to variants and peptides of the mitochondrial protein, voltage-dependent anion channel (VDAC) and to polynucleotides encoding same. In particular, the present invention is directed to N-terminal truncated and mutated VDAC and specific amino acid and polynucleotide sequences thereof useful in inhibiting apoptosis, and to pharmaceutical compositions comprising same useful in the treatment of diseases associated with excess apoptosis.03-25-2010
20100075897METHOD FOR SUSTAINEDLY RELEASING BIOACTIVE PEPTIDES AND APPLICATION THEREOF - The present invention provides a method for sustainedly releasing bioactive peptide, comprising a bioactive peptide conjugated to a serum albumin binding peptide through a molecular linker so as to form a fusion polypeptide, in which the molecular linker is sensitive to plasma environment; and transferring the fusion polypeptide to a host, whereby plasma proteinase or alkaline pH of blood in the host can cleave the molecular linker to release the bioactive peptide therein. The fusion polypeptide is sensitive to plasma environment and the sustained release of bioactive peptide ensures the activity of released peptide, resulting in an increased circulation half-life in the host. The present invention also provides a method for using the fusion polypeptide drug as described above to treat human type 2 diabetes, human osteoporosis or cancer.03-25-2010
20100075896Repair of larynx, trachea, and other fibrocartilaginous tissues - Provided herein are methods and devices for inducing the formation of functional replacement nonarticular cartilage tissues and ligament tissues. These methods and devices involve the use of osteogenic proteins, and are useful in repairing defects in the larynx, trachea, interarticular menisci intervertebral discs, ear, nose, ribs and other fibrocartilaginous tissues in a mammal.03-25-2010
20100075899TARGETED PHOTODYNAMIC THERAPY AGENT - The present invention relates to the field of conjugates comprising a substrate, a photosensitizer, and a targeting ligand, and methods for their use. More particularly, the invention further relates to methods for treating cancer in a subject using the conjugates of the present invention.03-25-2010
20100041596Amelioration of Inflammatory Arthritis By Targeting the Pre-ligand Assembly Domain (Plad) of Tumor Necrosis Factor Receptors - The present invention provides a polypeptide comprising the isolated amino acid sequence of a pre-ligand assembly domain (PLAD) of a TNF receptor-like receptor. Also provided by this invention is a polypeptide comprising the isolated amino acid sequence of a pre-ligand assembly domain (PLAD), wherein the PLAD is selected from the group consisting of: the PLAD of a TNF-R, the PLAD of p60, the PLAD of p80, the PLAD of Fas (CD95/APO-1), the PLAD of TRAIL receptors, the PLAD of LTyR, the PLAD of CD40, the PLAD of CD30, the PLAD of CD27, the PLAD of HVEM, the PLAD of OX40 and the PLAD of DR4. TNF-R, p60, p80, Fas, TRAIL receptor, LTyR, CD40, CD30, CD27, HVEM, OX40, DR4, TROY, EDAR, XEDAR, DCR3, AITR, 4-1BB, DR3, RANK, TACI, BCMA, DR6, DPG, DR5, DCR1 AND DCR2 are all members of the TNF receptor superfamily or the TNF-like receptor family. The invention also provides the PLAD for other members of the TNF receptor superfamily. The polypeptides of the present invention can be utilized to inhibit oligomerization of members of the TNF receptor superfamily. These polypeptides can also be utilized to inhibit ligand binding to members of the TNF receptor superfamily. The present invention also provides a composition comprising an inhibitor of TNF receptor oligomerization. Further provided by this invention are members of the TNF receptor superfamily that are lacking a PLAD.02-18-2010
20090247456Complexes of alpha (2) macroglobulin and antigenic molecules for immunotherapy - The present invention relates to complexes of alpha (2) macroglobulin associated with antigenic molecules for use in immunotherapy. The invention relates to methods for using such compositions in the diagnosis and treatment of immune disorders, proliferative disorders, and infectious diseases.10-01-2009
20090197800Insulin Receptor Binding Peptides with Non-Insulin Gene Activation Profiles and Uses Thereof - Methods for binding insulin receptors (and typically activating one or more function of an insulin receptor) by contacting insulin receptor-presenting cells, such as cells in a subject, with an effective amount of one or more insulin receptor binding peptides, where upregulation of one or more components of the insulin receptor-associated cholesterol synthesis pathway is not desired, are provided.08-06-2009
20100035811Phosphoinositide Modulation For The Treatment Of Neurodegenerative Diseases - The present invention relates to the use of agents that inhibit the toxic effects of amyloid oligomers by increasing intracellular levels of phosphoinositol 4-phosphate (PI(4)P, or “PIP”) and/or phosphotidylinositol 4,5-biphosphate (PI(4,5)P2 or “PIP2”), the use of such agents for the treatment of neurodegenerative diseases, methods of treating neurodegenerative diseases by administration of agents which alter lipid metabolism, and methods of identifying agents which alter the association of presenilins with γ-secretase and lipid rafts.02-11-2010
20100035806Compositions and Methods for Detection and Modulation of T Cell Mediated Immune Responses Against Viral Vectors Utilized for Gene Therapy - Compositions and methods are provided for inhibiting T cell mediated destruction of virally transduced, trangene containing cells.02-11-2010
20090062201INTEGRIN BINDING MOTIF CONTAINING PEPTIDES AND METHODS OF TREATING SKELETAL DISEASES - Peptide sequences comprising 10 to 50 amino acids are disclosed. The sequences are characterized by containing at least one of an integrin binding motif such as an RGD sequence, a glycosaminoglycan binding motif, and a calcium binding motif, and the remainder of amino acids contiguous with the RGD sequence in matrix extracellular phosphoglycoprotein. The sequences may be formulated for injection or dispersed in toothpaste or a mouthwash or gum patch and administered to enhance bone/tooth growth and/or reduce excessive urinary phosphate loss from the body.03-05-2009
20100120685METHODS AND COMPOSITIONS FOR THE TREATMENT OF CANCER - Oligopeptides which can be used to treat cancer are disclosed. Further disclosed are methods of treating cancer, including breast cancer, skin cancer, prostate cancer and multiple myeloma (MM). These methods include administration of a polypeptide encoded by the Mesd gene, or an oligopeptide comprising a contiguous subsequence of a Mesd polypeptide.05-13-2010
20090069236PROCESS FOR THE PREPARATION OF HYPOALLERGENIC MAJOR BIRCH POLLEN ALLERGEN rBet v 1 - The invention relates to a process for the preparation of hypoallergenic major birch pollen allergens by means of one or more chromatographic purification steps using essentially unbuffered aqueous bases as eluent and subsequent neutralisation. The hypoallergenic major birch pollen allergens are distinguished by a lack of, but at least by reduced immunoglobulin E binding with simultaneous retention of therapeutically relevant T-cell stimulation. They can therefore be employed as low-side-effect therapeutic agents for specific immunotherapy.03-12-2009
20090318345MEANS AND METHODS FOR MODULATING STEM CELL MOBILIZATION - Mobilization of stem cells in individuals is currently used in methods for their collection and in methods for therapeutically intervening in disease processes in the human body. The present invention provides means and methods for increasing numbers of mobilized stem cells and provides uses therefore.12-24-2009
20090036380Composition And Method For Brain Tumor Therapy - A method of treating a disease associated with abnormal apoptosis in a subject in need thereof is disclosed. The method comprises administering to the subject a therapeutically effective amount of at least one agent capable of increasing and/or stabilizing an interaction between at least an active portion of TrkA and at least an active portion of Karet, thereby treating the disease in the subject.02-05-2009
20090069228Screening Method - The present invention provides compounds or their salts that promote or inhibit the activities of a protein comprising the same or substantially the same as the amino acid sequence represented by SEQ ID NO: 1, compounds or their salts that promote or inhibit the activities of a gene for said protein, antisense polynucleotides comprising the whole or part of a base sequence complimentary or substantially complimentary to the base sequence of a polynucleotide encoding said protein or its partial peptide, antibodies to said protein, etc. These compounds or their salts, antisense nucleotides, antibodies, etc. can be used as agents for the prevention/treatment of mental disorders, prolactin-related disorders, etc.03-12-2009
20090181891NUCLEIC ACID AND CORRESPONDING PROTEIN ENTITLED 213P1F11 USEFUL IN TREATMENT AND DETECTION OF CANCER - A novel gene (designated 213P1F11) and its encoded protein, and variants thereof, are described wherein 213P1F11 exhibits tissue specific expression in normal adult tissue, and is aberrantly expressed in the cancers listed in Table I. Consequently, 213P1F11 provides a diagnostic, prognostic, prophylactic and/or therapeutic target for cancer. The 213P1F11 gene or fragment thereof, or its encoded protein, or variants thereof, or a fragment thereof, can be used to elicit a humoral or cellular immune response; antibodies or T cells reactive with 213P1F11 can be used in active or passive immunization.07-16-2009
20090176708CHEMICALLY MODIFIED FACTOR IX - The present invention discloses a chemically modified FIX, wherein the activation peptide region contains a covalently coupled water-soluble hydrophilic polymer.07-09-2009
20090042786Kunitz-type recombinant inhibitor - The present invention presents a Kunitz-type recombinant inhibitor obtained from a gene cloned from a cDNA library of salivary glands of the 02-12-2009
20080312142Composition for Increasing Body Height - This invention provides a composition for increasing a body height of a patient with short stature or an individual other than patients with short stature. More specifically, the invention provides: a composition for increasing the body height of an individual comprising a guanyl cyclase B (GC-B) activator as an active ingredient, the composition being to be administered to an individual free from FGFR3 abnormality; a method for increasing the body height of an individual free from FGFR3 abnormality which comprises activating GC-B; a method for screening an agent for increasing the body height of an individual which comprises selecting an agent for increasing the body height using GC-B activity as an indication; and a method for extending a cartilage bone free from FGFR3 abnormality which comprises activating GC-B in an individual.12-18-2008
20090170772INTERLEUKIN PRODUCTION REGULATOR, PHARMACEUTICAL COMPOSITION OR FOOD COMPRISING THE INTERLEUKIN PRODUCTION REGULATOR, AND METHOD FOR PRODUCTION OF THE INTERLEUKIN PRODUCTION REGULATOR - An object is to provide an interleukin production regulator which can be used for prevention, treatment or recurrence prevention of a gastrointestinal disease or an autoimmune disease accompanied by an inflammation as the main symptom, which is highly safe, and which can be administered over a long period. Another object is to provide a method for production of the interleukin production regulator. Further object is to provide a pharmaceutical composition and a food, each of which comprises the interleukin production regulator.07-02-2009
20090253619Novel peptide involved in energy homeostasis - The expression of a mRNA encoding a putative 76 amino acid, secreted protein (“Enho1”) was found to negatively correlate with fasting triglyceride and cholesterol levels. A recombinant adenovirus was used to increase the expression of Enho1 mRNA in two mouse models of obesity, KK-A10-08-2009
20090042785Compound with Affinity for the Cytotoxic T Lymphocyte-Associated Antigen (Ctla-4) - The present invention relates to a compound with affinity for the cytotoxic T lymphocyte-associated antigen (CTLA-4), wherein the compound exhibits a synergistic mode of action in that the compound: (a) increases T cell priming or T cell expansion or the generation of memory T cells by blocking of CTLA-4, and (b) enhances effector T cell activity in tumor tissue or lymphoid tissue by blocking of CTLA-4. The compound of the invention can be a protein, a small organic molecule, a peptide, or a nucleic acid. The invention also relates to a mutein derived from a protein selected from the group consisting of human neutrophil gelatinase-associated lipocalin (hNGAL), rat α2-microglobulin-related protein (A2m) and mouse 24p3/uterocalin (24p3), said mutein having binding specificity for the cytotoxic T lymphocyte-associated antigen (CTLA-4), wherein said mutein: (a) comprises amino acid replacements at least one of the sequence position corresponding to sequence positions 33 to 54, 66 to 83, 94 to 106, and 123 to 136 of hNGAL, and (b) binds human CTLA-4 with a K02-12-2009
20100099607CASEIN COMPLEXES - Complexes comprising resveratrol and a casein, a process for their manufacture, their uses and compositions comprising them.04-22-2010
20100099622WOUND HEALING - The present invention relates to the use of p38 MAP kinase inhibitors and p38 MAP kinase inhibition to promote wound healing.04-22-2010
20100099617Secreted proteins - The invention provides human secreted proteins (SECP) and polynucleotides which identify and encode SECP. The invention also provides expression vectors, host cells, antibodies, agonists, and antagonists. The invention also provides methods for diagnosing, treating, or preventing disorders associated with aberrant expression of SECP.04-22-2010
20100099613PEPTIDES FOR INDUCING A CTL AND/OR HTL RESPONSE TO HEPATITIS C VIRUS - The present invention is directed to peptides, and nucleic acids encoding them, derived from the Hepatitis C Virus (HCV). The peptides are those which elicit a CTL and/or HTL response in a host. The invention is also directed to compositions and vaccines for prevention and treatment of HCV infection and diagnostic methods for detection of HCV exposure in patients.04-22-2010
20100099612RECOMBINANT HUMAN INTERFERON-LIKE PROTEINS - This application relates to recombinant human interferon-like proteins. In one embodiment a recombinant protein created by gene shuffling technology is described having enhanced anti-viral and anti-proliferative activities in comparison to naturally occurring human interferon alpha 2b (HuIFN-α2b). The invention encompasses a polynucleotide encoding the protein and recombinant vectors and host cells comprising the polynucleotide. Preferably the polynucleotide is selected from the group of polynucleotides each having a sequence at least 93% identical to SEQ ID: No. 1 and the protein is selected from the group of proteins each having an amino acid sequence at least 85% identical to SEQ ID No: 2. The proteins and compositions comprising the proteins can be used for treatment of conditions responsive to interferon therapy, such as viral diseases and cancer.04-22-2010
20100099608TREATMENT OF DEMYELINATING DISORDERS WITH SOLUBLE LYMPHOTOXIN-BETA-RECEPTOR - Methods of treating a demyelinating disorder using inhibitors of the lymphotoxin pathway.04-22-2010
20100099623Cross-Linked Collagen and Uses Thereof - The present invention discloses collagen cross-linked in a micro to non-fibrillar form and at a high concentration. The cross-linked collagen gel has improved volume stability or persistence than collagen cross-linked at a neutral pH. Also disclosed are methods for preparing the inventive cross-linked collagen and using such for augmenting soft tissues in mammals.04-22-2010
20090170763Modified gherlin peptides - The present invention provides a novel peptide-type compound which induces secretion of growth hormone and which has the activity of increasing the intracellular calcium ion concentration, wherein at least one amino acid is replaced by a modified amino acid and/or a non-amino acid compound, or a pharmaceutically acceptable salt thereof.07-02-2009
20100144625Organic Compounds - A powder formulation for inhalation comprising a macromolecule and a crystalline carrier material.06-10-2010
20100144614ALTERING MEMORY BY AFFECTING STAUFEN FUNCTION - The present invention provides methods for screening a pharmaceutical agent for its ability to modulate long term memory formation, performance of a hippocampal-dependent cognitive task or STAUFEN function. The present invention also provides methods for modulating long term memory formation or performance of a hippocampal-dependent cognitive task by modulating staufen-dependent protein expression. The present invention further provides methods for treating a defect in long term memory formation associated with a defect in STAUFEN and methods for treating a defect in performance of a hippocampal-dependent cognitive task associated with a defect in STAUFEN.06-10-2010
20100144638GLUCAGON-LIKE PEPTIDE-1 SECRETAGOGUE, GLUCAGON-LIKE PEPTIDE-1 SECRETAGOGUE FOOD OR DRINK, INHIBITOR OF POSTPRANDIAL RISE IN BLOOD GLUCOSE, AND INHIBITORY FOOD OR DRINK OF POSTPRANDIAL RISE IN BLOOD GLUCOSE - The invention relates to a GLP-1 secretagogue and an inhibitor of postprandial rise in blood glucose, containing κ-casein as an active ingredient, and a food or drink for promoting GLP-1 secretion and an inhibitory food or drink of postprandial rise in blood glucose, containing a milk-derived casein protein wherein κ-casein accounts for 60% by mass or more of the milk-derived casein.06-10-2010
20100144637NUCLEIC ACID AND CORRESPONDING PROTEIN ENTITLED 161P5C5 USEFUL IN TREATMENT AND DETECTION OF CANCER - A novel gene (designated 161P5C5) and its encoded protein, and variants thereof, are described wherein 161P5C5 exhibits tissue specific expression in normal adult tissue, and is aberrantly expressed in the cancers listed in Table I. Consequently, 161P5C5 provides a diagnostic, prognostic, prophylactic and/or therapeutic target for cancer. The 161P5C5 gene or fragment thereof, or its encoded protein, or variants thereof, or a fragment thereof, can be used to elicit a humoral or cellular immune response; antibodies or T cells reactive with 161P5C5 can be used in active or passive immunization.06-10-2010
20100041611Rapid Isolation of Osteoinductive Protein Mixtures From Mammalian Bone Tissue - A method for purifying bone-derived osteoinductive proteins including a demineralization process, a protein extraction process, a high molecular weight ultrafiltration process, a low molecular weight ultrafiltration process, and a recover process. The high and low ultrafiltration processes preferably select proteins having a nominal molecular weight between approximately 8 kilodaltons and approximately 100 kilodaltons. Processes of the present invention may be used to recover osteoinductive proteins from bone demineralization waste streams.02-18-2010
20100041602Methods for treating immune disorders associated with graft transplantation with soluble CTLA4 mutant molecules - The present invention provides use of soluble CTLA4 mutant molecules which bind with greater avidity to the CD80 and/or CD86 antigen than wild type CTLA4 or non-mutated CTLA4Ig in the treatment of immune disorders associated with graft transplantation.02-18-2010
20100041603Method of Promoting Wound Healing - The present disclosure relates to methods of administering relaxin to promote wound healing and reduce scar formation. The disclosure further contemplates the use of relaxin in reconstructive and plastic surgery.02-18-2010
20100041608METHOD FOR STIMULATING WOUND HEALING - The present invention relates to a method for stimulating wound healing, and more particularly to a method for stimulating wound healing in a subject in need thereof, comprising administering to a wound of the subject an effective amount for stimulating wound healing of a composition, wherein the composition comprises p43 having an amino acid sequence set forth in SEQ ID NO: 1 or functional equivalents thereof. The composition used in the method of the present invention can be efficiently utilized for the wound healing, since p43, an effective ingredient of the composition, has an excellent effect on the wound healing by its action including the induction of macrophage/monocyte and endothelial cell re-epithelization, proliferation of fibroblasts or angiogenesis.02-18-2010
20100041606Methods of Use of Eggshell Polypeptides - Identified herein is an active component of chicken eggshells, which is shown ex-vivo studies to have a stimulating effect on bone building cells (osteoblasts). The substance is a polypeptide mixture extracted from eggshells. It has been discovered herein that a composition comprising eggshell polypeptides stimulates osteoblasts, and has osteoinductive/osteogenic properties, hematopoietic properties, and cartilage formation or differentiation properties. The eggshell polypeptide extracts can be locally or systemically administered.02-18-2010
20100041604NOVEL ANTIVIRAL PEPTIDES AGAINST INFLUENZA VIRUS - The present disclosure generally relates to peptides having antiviral properties. More particularly, the invention relates to peptides exhibiting activity against influenza viruses, to pharmaceutical compositions comprising the peptides, and to methods of using the peptides to prevent and/or treat influenza viral infections.02-18-2010
20100041610INSECTICIDAL TOXIN COMPLEX FUSION PROTIENS - The subject invention relates to insecticidal toxin complex (“TC”) fusion proteins and to polynucleotides that encode these fusion proteins. In some embodiments, the invention provides a fusion protein comprising a Class A protein, a Class B protein, and a Class C TC protein fused together to form a single protein. In some other embodiments, the invention provides a fusion protein comprising a Class B and a Class C TC proteins fused together. In the latter embodiments, the BC or CB fusion protein can be used to enhance or potentiate the anti-insect activity of a “Toxin A” or Class A protein. The subject invention also includes plants, cells (bacterial and plant cells for example), and seeds that comprise the polynucleotides. The subject invention also includes methods of controlling pests (preferably insects and other plant pests) with fusion proteins of the subject invention.02-18-2010
20100041601Use of VEGF and homologues to treat neuron disorders - The present invention relates to neurological and physiological dysfunction associated with neuron disorders. In particular, the invention relates to the involvement of vascular endothelial growth factor (VEGF) and homologues in the aetiology of motor neuron disorders. The invention further concerns a novel, mutant transgenic mouse (VEGF02-18-2010
20100041607UNCTUOUS COMPOSITIONS - The present invention relates to unctuous composition containing at least one solid active ingredient, at least one hydrophobic protective colloid and at least one edible oil. The active ingredient is preferably a carotenoid. The preferred protective colloids are prolamines. The invention compositions are simple to produce, have good bioavailability and dyestuff yield, and are used an addition to animal feed agents, foods, and dietary supplements and pharmaceutical and cosmetic agents.02-18-2010
20100041605Use of VEGF-C or VEGF-D in Reconstructive Surgery - The present invention provides materials and methods for repairing tissue and using vascular endothelial growth factor C (VEGF-C) genes and/or proteins. Methods and materials related to the use of VEGF-C for the reduction of edema and improvement of skin perfusion is provided. Also provided is are materials and methods for using VEGF-C before, during, and after reconstructive surgery.02-18-2010
20100041600INTERFERON GAMMA POLYMORPHISMS AS INDICATORS OF SUBJECT OUTCOME IN CRITICALLY ILL SUBJECTS - The invention provides methods, nucleic acids, compositions and kits for predicting a subject's outcome with an inflammatory condition and a subject's response to treatment with activated protein C or protein C like compound to identify subjects having a greater benefit from treatment with activated protein C. The method generally comprises determining a interferon gamma (IFNG) gene polymorphism genotype(s) of a subject for one or more polymorphisms in the IFNG gene or associated sequence, comparing the determined genotype with known genotypes for the polymorphism that correspond with an improved response polymorphism to identify potential subjects having an inflammatory condition who are more likely to benefit from treatment with activated protein C or protein C like compound and subsequent to treatment recover from the inflammatory condition. The invention also provides for methods of treating such subjects with an anti-inflammatory agent or anti-coagulant agent based on the subject's genotype.02-18-2010
20100041599Compositions and methods for bone formation, bone remodeling and toxin protection - The present invention identifies compounds that disrupt the interaction between anthrax proteins and LRP5/6 receptors, resulting in a reduction in anthrax toxicity. The compounds act to disrupt the intracellular transport of toxin complexes into a target cell. The present invention also provides methods for testing the effect of compounds on Wnt activity, through the use of in vitro experiments involving cells that have in at least one gene mutation involved in the Wnt pathway.02-18-2010
20100041598Use of Prolactin in the Prophylactic Treatment of Cancer - The present invention relates to compositions and methods for treating cancer. In particular, the invention describes prolactin containing compositions for the prophylactic treatment of breast cancer.02-18-2010
20100041595Bone morphogenetic protein 3 and osteogenic devices and pharmaceutical products containing thereof - The present invention relates to reindeer bone formation inducing protein called bone morphogenetic protein 3c (BMP-3c), nucleotide molecules encoding the protein and host cells expressing the protein. The present invention relates also to the use of said BMP-3c for treating disorders related to bone and cartilage formation. Osteogenic devices and pharmaceutical compositions containing the protein are also disclosed.02-18-2010
20100041597PEPTIDES TARGETED TO PROTEIN KINASE C ISOFORMS AND USES THEREOF - Peptides having a sequence of general formula (I), or the retro form thereof, and having an affinity for one or more mammalian protein kinase C-alpha isoforms are provided: X—[(HY—HB)02-18-2010
20090156502DIPHTHERIA TOXIN VARIANT - The present invention relates to methods and compositions of modified variants of diphtheria toxin (DT) that reduce binding to vascular endothelium or vascular endothelial cells, and therefore, reduce the incidence of Vascular Leak Syndrome. One aspect of the present invention relates to a polypeptide toxophore from a modified DT, wherein the mutation is the substitution or deletion at least one amino acid residue at the amino acid residues 6-8, 28-30 or 289-291 of native DT. Another aspect of the present invention relates to a fusion protein which comprises a modified DT and a non-DT fragment. Another aspect of the present invention relates to the use of modified DT for the treatment of cancer.06-18-2009
20090156500NEUREGULINS FOR PREVENTION AND TREATMENT OF DAMAGE FROM ACUTE ASSAULT ON VASCULAR AND NEURONAL TISSUE AND AS REGULATORS OF NEURONAL STEM CELL MIGRATION - Neuregulin, a known neuroprotein, has been found to ameliorate or prevent damage caused by mechanical or chemical assault to blood vessels and, when administered into the cerebral spinal fluid, can ameliorate damage to neuronal tissue caused by stroke or inflammation. Additionally, neuregulin has been found to be useful for enhancement of stem cell migration from the ventricle to the site of injury to the brain.06-18-2009
20090156499Antimicrobial Peptides and Methods of Identifying the Same - Antimicrobial peptides and methods of identifying the same are provided.06-18-2009
20090156498FUSION PROTEINS FOR DELIVERY OF GDNF TO THE CNS - The invention provides compositions, methods, and kits for increasing transport of GDNF across the blood brain barrier while allowing its activity to remain substantially intact. The GDNF is transported across the blood brain barrier via one or more endogenous receptor-mediated transport systems.06-18-2009
20090156497Non-cytotoxic PAP mutants - Disclosed are PAP mutants that are less toxic than wild type PAP and that exhibit depurination activity. Also disclosed are transgenic plants that produce the PAP mutants, and methods for preparing the plants. Further disclosed are bioconjugates containing the PAP mutants, pharmaceutical compositions containing the bioconjugates, and methods of administering the compositions to treat disease.06-18-2009
20090156495COMPOSITIONS AND METHODS FOR MODULATING IMMUNE RESPONSES - The present invention provides a newly identified B7 receptor, zB7R1 that functions as lymphocyte inhibitory receptor, which is a PD-1-like molecule and is expressed on T cells. The present invention also provides the discovery of zB7R1's ability to bind to CD155. Methods and compositions for modulating zB7R1-mediated negative signaling and interfering with the interaction of its counter-receptor for therapeutic, diagnostic and research purposes are also provided.06-18-2009
20090156494COMPOSITIONS AND METHODS COMPRISING GASTRIN COMPOUNDS - The invention relates generally to novel compositions and methods comprising a gastrin compound. The compositions and methods provide beneficial effects, in particular sustained beneficial effects, in the treatment of diabetes.06-18-2009
20090156493UROCORTIN-III AND USES THEREOF - A search of the public human genome database identified a human EST, GenBank accession number AW293249, which has high homology to known pufferfish urocortin sequences. The full length sequence was amplified from human genomic DNA and sequenced. Sequence homology comparisons of the novel sequence with human urocortin I and urocortin II revealed that the sequence encoded a novel human urocortin, which was designated urocortin III (UcnIII). While urocortin III does not have high affinity for either CRF-R1 or CRF-R2, the affinity for CRF-R2 is greater than the affinity for CRF-R1. Urocortin III is capable stimulating cyclic AMP production in cells expressing CRF-R2α or β. Thus, the affinity is high enough that urocortin III could act as a native agonist of CRF-R2. However, it is also likely that urocortin III is a stronger agonist of a yet to be identified receptor.06-18-2009
20090156491METHODS OF INHIBITING ANGIOGENESIS WITH FRAGMENTS AND HOMOLOGS OF TROPONIN SUBUNIT I - The present invention relates to methods of inhibiting angiogenesis associated with a disease or disorder with peptides homolgous to amino acid residues 130-137 or 132-139 of human troponin subunit I.06-18-2009
20090156490PEPTIDES FOR DIAGNOSTIC AND THERAPEUTIC METHODS FOR CELIAC SPRUE - Detection of toxic gluten oligopeptides refractory to digestion and antibodies and T cells responsive thereto can be used to diagnose Celiac Sprue. Analogs of such oligopeptides are useful in the inhibition of immune responses.06-18-2009
20090156489PROMOTION OF AXONAL REGENERATION - The present invention concerns a method of promoting axonal regeneration. In particular, the invention concerns a method of promoting the growth or regeneration of neurons, and treating disease or conditions associated with the loss, loss of function or dysfunction of nerve cells, in particular thalamic nerve cells, by administering a polypeptide having a high degree of sequence identity with a native sequence Netrin G1 (NGL-1) or an agonist thereof.06-18-2009
20090156488USE OF NEUREGULIN FOR ORGAN PRESERVATION - The present invention provides compositions and methods for preservation, perfusion or reperfusion of an organ, such as heart, for transplantation. The compositions comprise a preservation solution and an effective amount of neuregulin. The methods comprising contacting an organ with an effective amount of neuregulin.06-18-2009
20090156487INFANT NUTRITIONAL COMPOSITIONS FOR PREVENTING OBESITY - The present invention relates to a method for preventing obesity later in life by administering a certain nutritional composition to an infant with the age between 0 and 36 months. The composition comprises linoleic and alpha-linolenic acid.06-18-2009
20090156481Use of Factor VIIa or Factor VIIa Equivalents for Preventing or Attenuating Haemorrhage Growth, and/or Oedema Generation Following Intracerebral Haemorrhage (ICH) in Patients Treated with Antiplatelet Therapy - The invention relates to the use of Factor VIIa or a Factor VIIa equivalent for the manufacture of a medicament for preventing complications in ICH patients treated with antiplatelet therapy.06-18-2009
20090156492Methods of Using IL-1 Antagonists to Treat Autoinflammatory Disease - Methods of treating, inhibiting, or ameliorating an autoinflammatory disorder, disease, or condition in a subject in need thereof, comprising administering to a subject in need a therapeutic amount of an interleukin 1 (IL-1) antagonist, wherein the autoinflammatory disorder, disease, or condition is treated, inhibited, or ameliorated. The IL-1 antagonist is an IL-1 trap, preferably comprising a sequence selected from the group consisting of SEQ ID NO: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, or a substantially identical having at least 95% identity to the sequence shown in SEQ ID NO: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26 and capable of binding and inhibiting IL-1. The therapeutic methods are useful for treating a human adult or child suffering from Neonatal Onset Multisystem Inflammatory Disorder (NOMID/CINCA), Muckle-Wells Syndrome (MWS), Familial Cold Autoinflammatory Syndrome (FCAS), familial mediterranean fever (FMF), or systemic onset juvenile rheumatoid arthritis (Still's Disease).06-18-2009
20090156486PRODUCTION OF HUMAN DEFENSINS IN PLANT CELLS - The present invention relates, generally, to the production of human defensins from plant cells. Heterologous DNA comprising genes encoding one or more desired human defensins are introduced into plant cells. The one or more human defensins can be recombinantly-produced in the plant cells, purified from the plant cells, and used as an anti-infective agent, a wound treatment agent, a skin care agent, or an agent in the treatment of various intestinal diseases, including irritable bowel disease (IBD), ulcerative colitis, and Crohn's disease. The recombinantly-produced α-defensins can be provided as oral and topical formulations.06-18-2009
20090156478Acylated GLP-1 Compounds - Protracted GLP-1 compounds and therapeutic uses thereof.06-18-2009
20090156477Compositions and Methods for Regulating Inflammatory Responses - This invention relates, in part, to compositions and methods for the regulation of inflammatory responses. Specifically, the invention relates, in part, to compositions of and methods for using fibroblast growth factor (FGF) proteins, proteoglycans (e.g., syndecans), agents that modulate proteoglycans and agents that affect Wnt signaling. The invention also provides compositions and methods for treating subjects with undesired inflammatory activity and/or diseases associated therewith. The invention further provides, in part, compositions and methods for disrupting intercellular junctions with FGFs, such as for the enhanced delivery of therapeutic agents.06-18-2009
20090156475Gene defects and mutant ALK kinase in human solid tumors - In accordance with the invention, novel gene deletions and translocations involving chromosome 2 resulting in fusion proteins combining part of Anaplastic Lymphoma Kinase (ALK) kinase with part of a secondary protein have now been identified in human solid tumors, e.g. non-small cell lung carcinoma (NSCLC). Secondary proteins include Echinoderm Microtubule-Associated Protein-Like 4 (EML-4) and TRK-Fusion Gene (TFG). The EML4-ALK fusion protein, which retains ALK tyrosine kinase activity, was confirmed to drive the proliferation and survival of NSCLC characterized by this mutation. The invention therefore provides, in part, isolated polynucleotides and vectors encoding the disclosed mutant ALK kinase polypeptides, probes for detecting it, isolated mutant polypeptides, recombinant polypeptides, and reagents for detecting the fusion and truncated polypeptides. The disclosed identification of this new fusion protein enables new methods for determining the presence of these mutant ALK kinase polypeptides in a biological sample, methods for screening for compounds that inhibit the proteins, and methods for inhibiting the progression of a cancer characterized by the mutant polynucleotides or polypeptides, which are also provided by the invention.06-18-2009
20090156474Methods for treating obesity and obesity related diseases and disorders - Methods for treating obesity or obesity related disorders are disclosed. These methods include the use of anti-obesity agents directed to the forebrain in combination with anti-obesity agents directed to the hindbrain.06-18-2009
20090156476Dimeric or Multimeric Microproteins - Disclosed is a polypeptide comprising at least two microproteins, which preferably comprise an amino acid sequence having a specific binding activity to a target protein. Furthermore, disclosed are polynucleotides encoding such a polypeptide as well as pharmaceutical compositions and kits comprising said polypeptide or polynucleotide. Also disclosed herein are methods of treatments and second medical uses applying the disclosed polypeptide or polynucleotide. Additionally, the disclosure of the present application relates to a method for forming a covalent bond in a microprotein which can be used for producing the disclosed polypeptides.06-18-2009
20100105618Non-Natural Recombinant Gelatins with Enhanced Functionality - The invention concerns recombinant gelatin monomers and recombinant gelatins comprising or consisting of multimers of the monomers. The recombinant gelatins can be produced with enhanced stability.04-29-2010
20100105621Therapies for acute renal failure - The present invention provides methods for the treatment, and pharmaceuticals for use in the treatment, of mammalian subjects in, or at risk of, acute renal failure, or subject to, or at risk of, inflammation, neutrophil-mediated cell damage, and apoptosis resulting from tissue damage or injury. The methods involve the administration of certain proteins of the osteogenic protein/bone morphogenetic protein (OP/BMP) family within the TGF-β superfamily of proteins.04-29-2010
20100105615Nutritional Composition To Promote Healthy Development And Growth - A nutritional composition for improving the immunological function of a subject, including a lipid or fat; a protein source; about 5 to about 100 mg/100 kcal of a source of long chain polyunsaturated fatty acids which comprises docosahexanoic acid; and about 0.1 to about 1 mg/100 kcal of a prebiotic composition, wherein the prebiotic composition comprises at least 20% of an oligosaccharide which has a fermentation rate which is demonstrably slower than that of galacto-oligosaccharide.04-29-2010
20100105614ULTRA LOW DOSE DOXEPIN AND METHODS OF USING THE SAME TO TREAT SLEEP DISORDERS - The invention relates to doxepin, pharmaceutically acceptable salts and prodrugs of doxepin; compositions containing the same, and the use of any of the aforementioned for the treatment of sleep disorders.04-29-2010
20100105617C-Terminal Attachment of Two Chemical Groups to Peptides - The present invention relates to a method for C-terminal attachment of two property-modifying groups to a peptide.04-29-2010
20100105616POLYETHYLENE GLYCOL-G-CSF CONJUGATE - The present invention relates to three-branched PEG-G-CSF conjugate of general formula (1) in which the bonding ratio of three-branched polyethylene glycol (PEG) and G-CSF is 1:1 (mol/mol), wherein PEG has an average molecular weight of from 200 to 45,000 daltons; a pharmaceutical composition comprising the same, and a preparing method thereof.04-29-2010
20100105619CYSTEINE-CONTAINING PEPTIDES HAVING ANTIOXIDANT PROPERTIES - Cysteine containing amphipathic alpha helices of the exchangeable apolipoproteins, as exemplified by apolipoprotein (apo) A-I04-29-2010
20100105623SCHIZOPHRENIA-RELATED ISOFORM OF KCNH2 AND DEVELOPMENT OF ANTIPSYCHOTIC DRUGS - The invention is related to a novel primate specific brain isoform of the potassium channel KCNH2 and genetic association with risk for schizophrenia.04-29-2010
20100105622Protein Product for Treatment of Infectious Diseases and Related Inflammatory Processes - The inventors have found that CD6, a member of the Scavenger Receptor Cysteine-Rich (SRSR) superfamily expressed on human lymphocytes binds to Gram-positive and Gram-negative bacteria, as well as to other microbial structures. Thus, a CD6 product is useful for the manufacture of a medicament for therapeutic and/or preventive treatment of an infectious disease or of an inflammatory condition related to an infectious disease or to the presence of a product derived from an infectious agent in a mammal including a human. Examples of such inflammatory conditions are systemic inflammatory response syndrome (SIRS), sepsis, severe sepsis and septic shock.04-29-2010
20100105624CALCITONIN DRUG-OLIGOMER CONJUGATES, AND USES THEREOF - Calcitonin drug-oligomer conjugates that include a calcitonin drug coupled to an oligomer including a single polyalkylene glycol moiety consisting of between 4 and 10 polyalkylene glycol subunits are disclosed. Pharmaceutical compositions including such conjugates and methods of treating bone disorders by administering such conjugates are also disclosed.04-29-2010
20100105620Polypeptides that bind Trail-R1 and Trail-R2 - Agonists for TRAIL death receptors including polypeptides having a multimerizing, e.g. trimerizing, domain and a polypeptide sequence that binds to at least one of TRAIL death receptors TRAIL-R1 and TRAIL-R2. Agonists are described that do not bind to TRAIL decoy receptors. The multimerizing domain may be derived from human tetranectin. The agonists can induce apoptosis in pathogenic cells expressing a TRAIL death receptor. Pharmaceutical compositions are described for treating diseases associated with cells expressing DR4 and DR5, such as tumor cells. Methods for selecting polypeptides and preparing multimeric complexes.04-29-2010
20100105612AGENT CONTAINING FUSED PROTEIN OF SOLUBLE RANKL WITH EPITOPE TAG - The present invention provides a reagent containing a fused protein of RANKL with an epitope tag that has improved effects of differentiating and activating osteoclasts and improved preservation stability compared with the case of using RANKL alone, and an agent for differentiating and activating osteoclasts that can be used in vitro or in vivo, containing, as an active ingredient, a fused protein of soluble RANKL with an epitope tag peptide.04-29-2010
20100105611METHOD OF TREATING RESPIRATORY DISORDERS - The invention relates to the use of agents that bind the complement protein C5 in the treatment of diseases associated with inappropriate complement activation, and in particular in the treatment of respiratory disorders.04-29-2010
20100105610Methods of Inhibiting Tumor Cell Aggressiveness Using the Microenvironment of Human Embryonic Stem Cells - The invention provides compositions comprising one or more isolated factors from a microenvironment of human embryonic stem cells (hESCs), including, but not limited to, Lefty and inhibitors of Nodal. The invention also provides methods of utilizing factors derived from human embryonic stem cells (hESC) and their microenvironment to treat and prevent tumor formation and progression and to inhibit tumor cell aggressiveness. The invention further provides methods of inhibiting tumor cell growth and/or treating aggressive tumors in a mammal comprising administering to the mammal, having at least one tumor cell present in its body, an effective amount of an inhibitor of Nodal activity.04-29-2010
20100105613THERAPEUTIC AGENT FOR OCCLUSIVE PERIPHERAL VASCULAR DISEASE, AND USE THEREOF - A study was made on the therapeutic effect of midkine on an occlusive peripheral vascular disease, and it was found that midkine has an activity of promoting neovascularization and that a blood vessel can be proliferated and the blood flow in the upper and lower limbs can be improved (in other words, the condition of an ischemic disease in the upper and lower limbs can be ameliorated) by introducing midkine into a site affected by the occlusive peripheral vascular disease.04-29-2010
20090275514USE OF CALMODULIN KINASE II INHIBITORS TO TREAT OR PREVENT HEART MUSCLE INFLAMMATION - Provided are compositions and methods of treating inflammation of the heart of a subject diagnosed with inflammation of the heart, comprising administering to the subject an effective amount of an inhibitor of Calmodulin Kinase II, whereby the administration of the inhibitor treats inflammation of the heart in the subject. Also provided are compositions and methods of preventing inflammation of the heart of a subject, comprising administering to the subject an effective amount of an inhibitor of Calmodulin Kinase II, whereby the administration of the inhibitor prevents inflammation of the heart in the subject.11-05-2009
20100120691NEUREGULINS FOR PREVENTION AND TREATMENT OF DAMAGE FROM ACUTE ASSAULT ON VASCULAR AND NEURONAL TISSUE AND AS REGULATORS OF NEURONAL STEM CELL MIGRATION - Neuregulin, a known neuroprotein, has been found to ameliorate or prevent damage caused by mechanical or chemical assault to blood vessels and, when administered into the cerebral spinal fluid, can ameliorate damage to neuronal tissue caused by stroke or inflammation. Additionally, neuregulin has been found to be useful for enhancement of stem cell migration from the ventricle to the site of injury to the brain.05-13-2010
20080293630Mucoadhesive Pharmaceutical Compositions Comprising Chemoattractants - The invention relates to a mucoadhesive pharmaceutical composition comprising a polymer and a chemoattractant wherein the pH of the composition is greater than 6 which is useful in the treatment of a anogenital or oral disease, particularly an anogenital or oral disease cause by the human papillomavirus.11-27-2008
20090149386NEUREGULINS FOR PREVENTION AND TREATMENT OF DAMAGE FROM ACUTE ASSAULT ON VASCULAR AND NEURONAL TISSUE AND AS REGULATORS OF NEURONAL STEM CELL MIGRATION - Neuregulin, a known neuroprotein, has been found to ameliorate or prevent damage caused by mechanical or chemical assault to blood vessels and, when administered into the cerebral spinal fluid, can ameliorate damage to neuronal tissue caused by stroke or inflammation. Additionally, neuregulin has been found to be useful for enhancement of stem cell migration from the ventricle to the site of injury to the brain.06-11-2009
20090143301HIGH CALORIE NUTRITIONAL SUPPLEMENT - The invention provides a nutritional supplement comprising a protein source including milk protein isolate and/or canola plant protein, as well as related methods for its production and use in treating a nutritional deficiency in an individual.06-04-2009
20090118184RECOMBINANT FACTOR VIII HAVING INCREASED STABILITY - The present invention relates to a recombinant factor VIII that includes one or more mutations that result in enhanced stability of both factor VIII and factor VIIIa. Methods of making and using the recombinant factor VIII, and pharmaceutical compositions containing the same are also disclosed. The present invention further relates to an isolated nucleic acid molecule that encodes the recombinant factor VIII, as well as DNA expression systems and host cells containing the isolated nucleic acid molecule.05-07-2009
20100069303METHODS OF TREATING BONE DISEASE USING VASCULAR ENDOTHELIAL GROWTH FACTOR FUSION CONSTRUCTS - The 121-amino acid isoform of vascular endothelial growth factor (VEGF03-18-2010
20090215693METHODS FOR INCREASING HYALURONIC ACID LEVELS AND IMPROVING MOISTURE RETENTION IN TISSUE - Disclosed is a method for increasing hyaluronic acid levels in tissue and increasing moisture retention in skin.08-27-2009
20090264349CD30 Ligand - There is disclosed a polypeptide (CD30-L) and DNA sequences, vectors and transformed host cells useful in providing CD30-L polypeptides. The CD30-L polypeptide binds to the receptor known as CD30, which is expressed on a number of cell types, among which are Hodgkin's Disease tumor cells, large cell anaplastic lymphoma cells, adult T-cell leukemia (T-ALL) cells, and a number of other malignant cell types. CD30-L polypeptides find use as carriers for delivering diagnostic and cytotoxic agents to cells expressing the CD30 receptor.10-22-2009
20080261886Single-Dose Administration of Factor VIIa - The present invention provides methods for preventing and/or treating bleeding episodes by administering a single dose of a Factor VIIa equivalent. Preferably, the single dose comprises between about 150 and about 500 ug/kg Factor VIIa equivalent.10-23-2008
20090239797PRODUCTION OF HIGH LEVELS OF TRANSGENIC FACTOR IX WITHOUT GENE RESCUE, AND ITS THERAPEUTIC USES - A non-human trangenic mammalian animal, as described above, contains an exogenous double stranded DNA sequence stably integrated into the genome of the animal, which comprises cis-acting regulatory units operably linked to a DNA sequence encoding human FIX protein without the benefit of the presence of a complete milk gene sequence for gene rescue, and a signal sequence is active in directing newly expressed Factor IX into the milk of the animal at levels in an unactivated form that is suitable for subsequent processing for therapeutic applications in treating Hemophilia B. The transgenic mammals are preferably pigs, cows, sheep, goats and rabbits. The applications include milk derivatives for oral delivery and oral tolerization in the treatment of Hemophilia B.09-24-2009
20090163424SOLUBLE TUMOR NECROSIS FACTOR RECEPTOR TREATMENT OF MEDICAL DISORDERS - The invention pertains to methods and compositions for treating medical disorders characterized by elevated levels or abnormal expression of TNFα by administering a TNFα antagonist, such as recombinant TNFR:Fc.06-25-2009
20100093627ALBUMIN FUSION PROTEINS - The present invention encompasses albumin fusion proteins. Nucleic acid molecules encoding the albumin fusion proteins of the invention are also encompassed by the invention, as are vectors containing these nucleic acids, host cells transformed with these nucleic acids vectors, and methods of making the albumin fusion proteins of the invention and using these nucleic acids, vectors, and/or host cells. Additionally the present invention encompasses pharmaceutical compositions comprising albumin fusion proteins and methods of treating, preventing, or ameliorating diseases, disorders or conditions using albumin fusion proteins of the invention.04-15-2010
20100093620TYROSINE-RICH CONOPEPTIDES - The invention relates to relatively short peptides (termed Conopeptide-Y family peptides or CPY family peptides or CPY peptides herein), about 30 residues in length, which are naturally available in minute amounts in the venom of the cone snails or analogous to the naturally available peptides, and which are rich in the amino acid tyrosine.04-15-2010
20100093628METHODS OF TREATMENT USING WISP POLYPEPTIDES - The present invention relates to methods for the treatment and repair of cartilage, including cartilage damaged by injury or degenerative cartilagenous disorders, including arthritis, comprising the administration of WISP polypeptide. Optionally, the administration may be in combination with one or more cartilage agents (e.g., peptide growth factor, catabolism antagonist, osteo-, synovial, anti-inflammatory factor). Alternatively, the method provides for the treatment and repair of cartilage damaged by injury or degenerative cartilagenous disorders comprising the administration of WISP polypeptide in combination with standard surgical techniques. Alternatively, the method provides for the treatment and repair of cartilage damaged by injury or degenerative cartilagenous disorders comprising the administration of chondrocytes previously treated with an effective amount of WISP polypeptide.04-15-2010
20100093618POLYPEPTIDE CAPABLE OF INHIBITING HIV-1 TRANSCRIPTION AND REPLICATION AND USES THEREOF - A polypeptide inhibitor of transcription and replication of Human Immunodeficiency Virus (HIV-1), and related compositions and methods.04-15-2010
20090124552Methods and Compositions for Regenerating Connective Tissue - Connective tissue regenerative compositions and methods of repairing and regenerating connective tissue using such compositions are provided. The compositions generally comprise a bioactive hydrogel matrix comprising a polypeptide, such as gelatin, and a long chain carbohydrate, such as dextran. The hydrogel matrix may further include polar amino acids, as well as additional beneficial additives. Advantageously, the compositions include further components, such as osteoinductive or osteoconductive materials, medicaments, stem or progenitor cells, and three-dimensional structural frameworks. The compositions are useful for regenerating connective tissue, and can be administered to an area having injury to, or a loss of, connective tissue, such as bone, cartilage, tendon, and ligament.05-14-2009
20090124551METHODS OF ADMINISTERING BONE HEALTH COMPOSITIONS DERIVED FROM MILK - The invention relates to bone health compositions comprising an acidic protein fraction of milk, to a method of producing said bone health composition, to methods of treatment comprising said bone health compositions and to medicinal uses of said bone health compositions. One broad aspect of the invention provides a bone health composition comprising an acidic protein fraction derived from milk, from a component of milk, from whey, from hydrolysates thereof, or from a combination thereof wherein the composition does not comprise caseinoglycomacropeptide (CGMP). Another broad aspect provides a method of manufacturing the composition of the invention using anion exchange chromatography.05-14-2009
20090124550Thrombin peptide derivative dimers - Disclosed are thrombin peptide derivative dimers comprising two polypeptides having the amino acid sequence Arg-Gly-Asp-Ala-Cys-Glu-Gly-Asp-Ser-Gly-Gly-Pro-Phe-Val (SEQ ID NO:2), or a C-terminal truncated fragment of the polypeptide having at least six amino acids. Zero, one, two, or three amino acids in the polypeptide or polypeptide fragment differ from the corresponding position of SEQ ID NO:2. Also disclosed are methods of treating a subject in need of treatment with a thrombin receptor agonist. The methods comprise the step of administering an effective amount of the thrombin peptide derivative described above.05-14-2009
20090124549METHODS FOR PRODUCING AN IMMUNE RESPONSE TO TUBERCULOSIS - Methods for producing an immune response to 05-14-2009
20090124543ACTIVITY DEPENDENT NEUROTROPHIC FACTOR III (ADNF III) - The present invention relates generally to Activity Dependent Neurotrophic Factor III (ADNF III), also known as Activity Dependent Neuroprotective Protein (ADNP). More particularly, the present invention relates to nucleic acid sequences encoding ADNF III polypeptides; ADNF III polypeptides encoded by such nucleic acid sequences; antibodies to ADNF III polypeptides; and methods of using such ADNF III polypeptides for the treatment of neurological deficiencies and for the prevention of cell death associated with (1) gp120, the envelope protein from HIV; (2) N-methyl-D-aspartic acid (excito-toxicity); (3) tetrodotoxin (blockage of electrical activity); and (4) β-amyloid peptide, a substance related to neuronal degeneration in Alzheimer's disease.05-14-2009
20090124541Method for the recovery and application of novel human defensins as biologically active proteins for the treatment of infections and other diseases - The invention relates to the novel peptides, derived from human blood, hBD-5 (human beta-defensin-5), hBD-6, hBD-7, hBD-8, hBD-10, hBD-11, hBD-12, hBD-13, hBD-14, hBD-15, hBD-16, hBD-17, hBD-18, hBD-19, hBD-20, hBD-22, hBD-23, hBD-24, hBD-25, hBD-26, hBD-27, hBD-28, hBD-29, hBD-30, hBD-31 and hBD-32 and their derivatives whose structure was elucidated for the purpose of therapeutic, diagnostic and commercial use as medicaments. The peptides can be prepared by biotechnological, recombinant methods, by chemical synthesis as well as by proteolysis from corresponding precursor proteins.05-14-2009
20090124548Method of Using Fish Plasma Components to Inhibit Glial Scarring and Promote Functional Recovery in the Mammalian CNS - A method includes applying salmon fibrin at a central nervous system injury site. For example, applying salmon fibrin can include injecting salmon fibrin. The method can also include causing the suppression of astrocyte activation, whereby glial scarring is at least reduced. The functional recovery of a patient who has suffered a central nervous system injury is promoted according to this method.05-14-2009
20090124546Antimicrobially Active Peptides - An antimicrobially active peptide comprises the DCD protein or a fragment of DCD, preferably derived from the C-terminal region.05-14-2009
20090124545NOVEL NUCLEIC ACID ENCODING A NOVEL PROTEIN OF CANDIDA ALBICANS AND USES THEREOF05-14-2009
20100069305Composition for maintaining gastrointestinal homeostasis - The invention relates to a suspension of albumin and tannic acid for maintaining gastrointestinal homeostasis.03-18-2010
20100069300C-Type Lectin Fold as a Scaffold for Massive Sequence Variation - This invention provides a class of binding proteins with a range of binding specificities and affinities based upon variation at select amino acid positions within a scaffold. The variable positions may be readily modified to produce a library of binding proteins with different binding specificities and affinities. The library may be screened to identify one or more as binding a ligand of interest. Compositions comprising the binding proteins, as well as methods of using the binding proteins are also provided.03-18-2010
20080269136METHOD OF USE OF PEPTIDE ANTAGONISTS OF ZONULIN TO PREVENT OR DELAY THE ONSET OF DIABETES - A method for preventing or delaying the onset of autoimmune diseases is disclosed.10-30-2008
20090042800ASSAY - A method for determining the risk of an individual of suffering from inflammation, opportunistic infection or disruption of immunoglobulin metabolism, comprising (a) determining the level of fragmentation or modification of Fc function of immunoglobulins in a sample taken from the individual and (b) determining thereby the risk of inflammation, impaired immune response or opportunistic infection. The invention also provides the use of a trypsin inhibitor in the manufacture of a medicament for use in the treatment or prevention of a disorder associated with elevated trypsin activity which is correlated with IgG fragmentation or modification.02-12-2009
20090042793Novel Antiviral Therapies - The field of the invention relates to the use of carbohydrate binding compounds as a medicine, their use to treat or prevent viral infections, their use to manufacture a medicine to treat or prevent viral infections and their use in a vaccination strategy. The present invention relates to the use of said compounds to manufacture a medicine to treat or prevent viral infections of subjects, more in particular infections with viruses having glycosilated envelop proteins such as Retroviridae (i.e. Lentivirinae), like HIV (human immunodeficiency virus), Flaviviridae, like HCV (hepatitis C virus), Hepadnaviridae, like HBV (hepatitis B virus), Coronaviridae, like SARS corona virus, and Orthomyxoviridae, like influenza A, B or C.02-12-2009
2009004279218 HUMAN SECRETED PROTEINS - The present invention relates to novel human secreted proteins and isolated nucleic acids containing the coding regions of the genes encoding such proteins. Also provided are vectors, host cells, antibodies, and recombinant methods for producing human secreted proteins. The invention further relates to diagnostic and therapeutic methods useful for diagnosing and treating diseases, disorders, and/or conditions related to these novel human secreted proteins.02-12-2009
20090042791INTEGRIN BINDING MOTIF CONTAINING PEPTIDES AND METHODS OF TREATING SKELETAL DISEASES - Peptide sequences comprising 10 to 50 amino acids are disclosed. The sequences are characterized by containing at least one of an integrin binding motif such as an RGD sequence, a glycosaminoglycan binding motif, and a calcium binding motif, and the remainder of amino acids contiguous with the RGD sequence in matrix extracellular phosphoglycoprotein. The sequences may be formulated for injection or dispersed in toothpaste or a mouthwash or gum patch and administered to enhance bone/tooth growth and/or reduce excessive urinary phosphate loss from the body.02-12-2009
20090042790TRANSMUCOSAL DELIVERY OF PEPTIDE DERIVATIVES - What is described is a biological agent, comprised of a biologically active protein, or a fragment or a mimetic thereof, conjugated to at least one poly(alkylene oxide) chain having a size less than about 20 kDa, pharmaceutical formulations for intranasal delivery of said biological agent, or uses of said biological agent in the manufacture of said pharmaceutical formulation for administering said biological agent to a mammal.02-12-2009
20090042788Peptides and chemical compound for inhibition of SHP2 function - The present invention relates to the inhibition of the function of SHP2 by both anti-SHP2 peptides and the chemical compound 4-(2-sulfaminoethyl)benzoic acid, SEBA, and SEBA derivatives binding to the phosphotyrosyl phosphatase domain of SHP2 thereby inhibiting the function of SHP2 both in vitro and in vivo. In addition, the inhibition of SHP2 may be useful as a treatment for human disease, and it has been shown that interfering with SHP2 function using the anti-SHP2 peptides and SEBA compounds reverses cell transformation and induces remission of preformed tumors in vivo demonstrating a possible treatment for cancer.02-12-2009
20090042787Proteolytically cleavable fusion proteins with high molar specific activity - The invention relates to therapeutic fusion proteins in which a coagulation factor is fused to a half-life enhancing polypeptide, and in which both are connected by a linker peptide that is proteolytically cleavable. The cleavage of such linkers liberates the coagulation factor from activity-compromising steric hindrance caused by the half-life enhancing polypeptide and thereby allows the generation of fusion proteins may show relatively high molar specific activity when tested in coagulation-related assays. Furthermore, the fact that the linker is cleavable can enhance the rates of inactivation and/or elimination after proteolytic cleavage of the peptide linker compared to the rates measured for corresponding therapeutic fusion proteins linked by the non-cleavable linker having the amino acid sequence GGGGGGV (SEQ ID NO: 94).02-12-2009
20090042780Modified TGF-Beta Superfamily Polypeptides and Related Methods - The disclosure relates to modified TGF-beta polypeptides. Certain modified polypeptides disclosed herein are chimeric, containing a conserved framework portion from one protein of this family (e.g., Nodal) and variable loops that mediate receptor interaction derived from a second protein of this family (e.g., BMP-2). The chimeras will generally be designed so as to mimic a biological effect of the family member from which the variable loops are derived. Other modified TGF-polypeptides disclosed herein have one or more post-translational modifications that may be situated in one or more core domains.02-12-2009
20090042777G-CSF Transferrin Fusion Proteins - A polypeptide comprising a G-CSF domain operably linked to a Tf domain, wherein the ability of the polypeptide to be transported into a cell expressing a TfR gene or the ability of the polypeptide to be transported across a cell expressing a TfR gene via transcytosis is higher than that of the G-CSF domain alone.02-12-2009
20090203592INFANT NUTRITION WITH HYDROLISED PROTEINS - The invention concerns a method to treat and/or prevent childhood obesity comprising administering a nutritional composition containing fat, digestible carbohydrates and protein, wherein the protein comprises at least 25 wt. % peptides with a chain length of 25 to 30 amino acids based on dry weight of protein.08-13-2009
20090221497Immunodynamic complexes and methods for using and preparing such complexes - The present invention is directed to immunodynamic complexes that, in embodiments of the invention, are surprisingly antimicrobial and immunoactive. By “immunoactive,” it is meant that such compositions are capable of modulating, stimulating and repairing the immune system. Moreover, in embodiments of the invention, an immunodynamic complex is capable of supporting, maintaining and/or enhancing the structure and function of the immune system. In addition, this invention is directed to a method for preparing and using such compositions. Embodiments of the immunodynamic complexes of this invention are prepared from lacteal secretions derived from ungulates, such as cows.09-03-2009
20100004175NOVEL BMP-12-RELATED PROTEINS AND METHODS OF THEIR MANUFACTURE - The invention provides novel BMP-12-related proteins, including methods of their manufacture. The proteins include substituted, truncated and substituted-truncated BMP-12-related proteins. The substituted BMP-12-related proteins contain a substitution at one or more oxidation-sensitive methionine residues with non-methionine residues, such as norleucine. The substituted BMP-12-related proteins exhibit normal bioactivity and enhanced resistance to oxidation, relative to the unsubstituted protein. The truncated BMP-12-related proteins exhibit enhanced activity.01-07-2010
20090192082CXCR4 ANTAGONIST TREATMENT OF HEMATOPOIETIC CELLS - Compositions comprising a peptide consisting of an amino acid sequence derived from a P2G-substituted SDF-1 protein are taught. The amino acid sequence consists of a first sequence consisting of 8 to 17 amino acids from the N-terminal portion of the SDF-1 protein and having a conserved KGVS motif. The amino acid sequences may also consist of one or more optional components selected from the group consisting of a second sequence consisting of 8 to 17 amino acids from the N-terminal portion of the SDF-1 protein and having a conserved KGVS motif, wherein the second sequence is covalently joined to the first sequence with or without a linker; and, a third sequence consisting of LKWIQEYLEKALN, or conservative substitutions thereof, wherein the third sequence is covalently joined to the first sequence with the linker. Methods of increasing multiplication of hematopoietic cells and enhancing proliferation of hematopoietic cells during engraftment are also taught.07-30-2009
20090005300Antimicrobial Peptides and Methods of Use - Disclosed herein are novel antimicrobial peptides with useful, improved, or superior properties such as antimicrobial activity, desirable levels of hemolytic activity, and therapeutic index against a broad range of microorganisms including gram-negative and gram-positive bacteria and other organisms having a cellular or structural component of a lipid bilayer membrane. Also provided are methods of making and using such peptides to control microbial growth and in pharmaceutical compositions for treatment or prevention of infections caused by such microorganisms. Certain peptides are disclosed utilizing a structure-based rational design relating to an antimicrobial peptide, V01-01-2009
20090131309ICA512 COUPLES INSULIN SECRETION AND GENE EXPRESSION IN BETA-CELLS - The present invention relates to a method for stimulating expression of peptide hormones in peptide-hormone secreting endocrine cells or neurons comprising the step of promoting in said cells or neurons the presence or activity (aa) of (i) ICA512; or (ii) a derivative thereof having ICA512 function; or (iii) a fragment of ICA512 that may be cleaved by μ-calpain giving rise to a C-terminal fragment of ICA512 wherein said C-terminal fragment has the capability of being targeted to the nucleus; or (iv) a derivative of said fragment of (iii) that may be cleaved by μ-calpain giving rise to a derivative of said C-terminal fragment of ICA512 wherein said derivative of said C-terminal fragment has the capability of being targeted to the nucleus; or (v) a fragment or derivative of ICA512 that may be cleaved by μ-calpain giving rise to a C-terminal fragment of ICA512 or derivative thereof wherein said C-terminal fragment or derivative thereof has the capability of interacting with a PIAS protein in said cells or neurons; or (vi) a fragment or derivative of ICA512 that may be cleaved by μ-calpain giving rise to a C-terminal fragment of ICA512 or derivative thereof wherein said C-terminal fragment or derivative thereof has the capability of enhancing the nuclear levels, or tyrosine phosphorylation, or DNA binding activity of STATs in said cells or neurons; or (vii) a pro-form of any one of (i) to (vi); and (ab) optionally of μ-calpain or a fragment or derivative thereof having μ-calpain function; or (b) of a C-terminal fragment of ICA512 or a derivative thereof which has the capability of being targeted to the nucleus or which has the capability of interacting with a PIAS protein or of enhancing the nuclear levels, or tyrosine phosphorylation, or DNA binding activity of STATs in said cells or neurons. Additionally, the present invention relates to a method of promoting cell proliferation of peptide-hormone secreting endocrine cells or neurons comprising the step of promoting in said cells or neurons the presence or activity (aa) of (i) ICA512; or (ii) a derivative thereof having ICA512 function; or (iii) a fragment of ICA512 that may be cleaved by μ-calpain giving rise to a C-terminal fragment of ICA512 wherein said C-terminal fragment has the capability of being targeted to the nucleus; or (iv) a derivative of said fragment of (iii) that may be cleaved by μ-calpain giving rise to a derivative of said C-terminal fragment of ICA512 wherein said derivative of said C-terminal fragment has the capability of being targeted to the nucleus; or (v) a fragment or derivative of ICA512 that may be cleaved by μ-calpain giving rise to a C-terminal fragment of ICA512 or derivative thereof wherein said C-terminal fragment or derivative thereof has the capability of interacting with a PIAS protein in said cells or neurons; or (vi) a fragment or derivative of ICA512 that may be cleaved by μ-calpain giving rise to a C-terminal fragment of ICA512 or derivative thereof wherein said C-terminal fragment or derivative thereof has the capability of enhancing the nuclear levels, or tyrosine phosphorylation, or DNA binding activity of STATs in said cells or neurons; or (vii) a pro-form of any one of (i) to (vi); and (ab) optionally of μ-caipain or a fragment or derivative thereof having μ-calpain function; or (b) of a C-terminal fragment of ICA512 or a derivative thereof which has the capability of being targeted to the nucleus or which has the capability of interacting with a PIAS protein or of enhancing the nuclear levels, or tyrosine phosphorylation, or DNA binding activity of STATs in said cells or neurons. It is preferred in accordance with the invention that said endocrine cells are β-cells and that said peptide hormone is insulin.05-21-2009
20090318359COMPOSITIONS AND METHODS OF USE OF ORF1358 FROM BETA-HEMOLYTIC STREPTOCOCCAL STRAINS - The present invention relates to polynucleotides encoding 12-24-2009
20090318354Use of at least one isoform of progesterone receptor membrane component 1 (PGRMC1) - The invention relates to the use of at least one isoform of progesterone receptor membrane component 1 (PGRMC1) as diagnostic marker and/or therapeutic target for diseases associated with neogenin and/or DCC and/or for the manufacture of a medicament for treatment of diseases associated with neogenin and/or DCC, the use of at least one reagent that influences the function of at least one isoform of PGRMC1 for the manufacture of a medicament for treatment of diseases associated with neogenin and/or DCC, the use of at least one isoform of PGRMC1 for influencing abundance or subcellular localisation of at least one class of molecules interacting with PGRMC1, an assay kit for diagnosis and/or therapy of diseases associated with neogenin and/or DCC, comprising at least one isoform of PGRMC1 and/or at least one reagent that influences the function of at least one isoform of PGRMC1, the use of at least one isoform of PGRMC1 as diagnostic marker in diagnosis for diseases associated with aberrant bio-logical phenotypes, wherein the phosphorylation status of the at least one isoform of PGRMC1 is determined/and or estimated and the use of at least one reagent for influencing the abundance and/or activity of isoforms of proteins for diagnosis and/or therapy of diseases associated with aberrant biological phenotypes, wherein said proteins are involved in protein interaction or multiprotein complexes with either at least one isoform of phosphorylated or non-phosphorylated PGRMC1.12-24-2009
20090312243TREATMENT OF INFLAMMATORY BOWEL DISEASE (IBD) WITH ANTI-ANGIOGENIC COMPOUNDS - Inhibitors of angiogenesis are disclosed as being useful therapeutics for treating various aspects of inflammatory bowel disease, in particular Crohn's Disease. A method for decreasing the magnitude of intestinal inflammation or inflammatory infiltrate in bowel tissue, a method for lowering systemic or gut-associated levels of a proinflammatory cytokine in a subject, a method for reducing microvessel density in fixed bowel tissue sections and a method for treating an inflammatory bowel disease are disclosed. Preferred agents to achieve the foregoing are pentapeptides that include Pro-His-Ser-Cys-Asn (SEQ ID NO:1) and variants or derivatives thereof.12-17-2009
20100267636USE OF CYTOCHROME P450-METABOLIZED DRUGS AND GRF MOLECULES IN COMBINATION THERAPY - Combination therapies comprising a drug metabolized by cytochrome P450 and a growth hormone (GH)-inducing compound (such as a GRF molecule) are described, in which there are no or substantially no drug interactions.10-21-2010
20100035809STABLE LIQUID COMPOSITIONS FOR TREATING STOMATITIS COMPRISING EPIDERMAL GROWTH FACTOR - Provided is a liquid composition for treating stomatitis, the liquid composition including: an epidermal growth factor; an adhesive polymer; and at least one stabilizer selected from the group consisting of ethylenediaminetetraacetic acid (EDTA) and salts thereof, histidine, lysine and inorganic acid salts thereof, arginin and inorganic acid salts thereof, and dextran. The liquid composition includes a stabilizer selected from EDTA (or salts thereof) and a certain amino acid (or inorganic acid salts thereof) and thus, physicochemical and biological stability of the epidermal growth factor can be substantially increased. Thus, the liquid composition can be stored and distributed for a long period of time. The stabilized composition includes an adhesive polymer, and thus, when ejected in a spray form in the mouth of a user, the liquid composition can be quickly attached to an inflammation site and exhibits effectiveness for a long period of time.02-11-2010
20100130423TREATMENT OF MYELOPROLIFERATIVE DISORDERS WITH ADAPTOR PROTEIN LNK - Janus kinase 2 (JAK2) associates with cytokine receptors and is essential for signal transduction in hematopoietic cells. The JAK2 mutation, JAK2 V617F, prevalent in myeloproliferative disorders, confers cytokine-independent proliferation and constitutive activation of downstream signaling pathways, when co-expressed with homodimeric type I cytokine receptors. The adaptor protein LnK is a negative regulator of hematopoietic cytokine receptors, including EPOR and MPL. LnK attenuates wild type JAK2 signaling in hematopoietic Ba/F3 cells expressing MPL. LnK also inhibits cytokine-independent growth and signaling conferred by JAK2 V617F in those cells. LnK, via its SH2 domain, PH domain, and other regions, associates with JAK2 and JAK2 V617F. Additional LnK domains are involved in LnK downregulation of JAK2 V617F constitutive activation. Elucidating the pathways that attenuate JAK2 and JAK2 V617F signaling provides insight into myeloproliferative disorders and helps to develop therapeutic approaches. Inhibition of Lnk enhances the expression of hematopoetic stem cells and hematopoetic progenitor cells.05-27-2010
20100130411METHOD FOR TREATING CARTILAGE DISORDERS - The present invention relates to a method for the treatment of a cartilage disorder, including cartilage damaged by injury or degenerative cartilagenous disorders. The method involves contacting the cartilage with an IGF-1 analog with altered affinity for IGF-binding proteins (IGFBPs) or an IGFBP displacer peptide that prevents the interaction of an IGF with an IGFBP and does not bind to a human IGF receptor.05-27-2010
20100130428POLYMER FACTOR IX MOIETY CONJUGATES - Conjugates of a Factor IX moiety and one or more water-soluble polymers are provided. Typically, the water-soluble polymer is poly(ethylene glycol) or a derivative thereof. Also provided (among other things) are compositions comprising the conjugates, methods of making the conjugates, and methods of administering to a patient compositions comprising the conjugates.05-27-2010
20100130424CRHR2 PEPTIDE AGONISTS AND USES THEREOF - The present invention relates to novel peptides that are selective corticotrophin releasing hormone receptor type 2 (CRHR2) agonists and compositions thereof for the treatment, amelioration or inhibition of cardiovascular conditions, including but not limited to heart failure. The novel peptide agonist preferably comprise modifications that include pegylated peptides. Furthermore, the present invention also relates to methods for the treatment and prevention of a disease or disorder related to CRHR2 activity.05-27-2010
20100130416MODULATION OF ANGIOGENESIS BY A-BETA PEPTIDE FRAGMENTS - Provided are Aβ peptide fragments that are useful in inhibiting angiogenesis. Also provided are methods for the treatment of pathological or unwanted angiogenesis and conditions and diseases associated therewith by administering an effective amount of an Aβ fragment. In a particular embodiment, the peptide fragment includes the sequence HHQKLVFF.05-27-2010
20100130410Neural regeneration peptides and methods for their use - Embodiments of this invention include novel peptides that can promote survival of neurons and other cell types. Other embodiments of this invention include the methods for the use of peptides to promote neuronal migration, neurite outgrowth, neuronal proliferation, neural differentiation, neuronal survival and/or trophoblast proliferation, trophoblast migration and trophoblase survival. NRP compounds may be administered directly to a subject or to a subject's cells by a variety of means including orally, intraperitoneally, intravascularly or indirectly via a replicable vehicle. NRP compounds can be formulated into pharmaceutically acceptable dosage forms for therapeutic use. Kits containing pre-determined doses of an NRP can be used to conveniently store, prepare and administer an NRP to a subject in need thereof.05-27-2010
2009030599133 Human Secreted Proteins - The present invention relates to 33 novel human secreted proteins and isolated nucleic acids containing the coding regions of the genes encoding such proteins. Also provided are vectors, host cells, antibodies, and recombinant methods for producing human secreted proteins. The invention further relates to diagnostic and therapeutic methods useful for diagnosing and treating diseases, disorders, and/or conditions related to these novel human secreted proteins.12-10-2009
20090305990BI-LATERAL LOCAL RENAL DELIVERY FOR TREATING CONGESTIVE HEART FAILURE AND FOR BNP THERAPY - The invention relates to systems and methods for local renal delivery of agents to subjects that are at risk for congestive heart failure and other conditions. The invention encompasses devices for renal drug delivery and method of use.12-10-2009
20090305987Method For Inducing Beta Cell Neogenesis From Epithelial Cells - The invention provides a method of inducing β-cell neogenesis from epithelial cells. The method includes the step of exposing epithelial cells that have a disrupted G1-S cell cycle transition to a hedgehog protein in an amount effective to stimulate β-cell neogenesis from the epithelial cells. Cells resulting from the method are insulin-positive and express pancreatic progenitor cell markers including Pdx-1 and ngn3. β-cell population expansion is observed when the method is carried out in either in vitro or in vivo settings.12-10-2009
20090305986FGF21 Mutants and uses thereof - The invention provides nucleic acid molecules encoding FGF21 mutant polypeptides, FGF21 mutant polypeptides, pharmaceutical compositions comprising FGF21 mutant polypeptides, and methods for treating metabolic disorders using such nucleic acids, polypeptides, or pharmaceutical compositions.12-10-2009
20090305985Immunomodulatory Agents For Treatment of Inflammatory Diseases - The present invention provides methods and compositions suitable for treating inflammatory disorders such as allergy, asthma, artherosclerosis, autoimmune disease, infection, injury, meningitis, psoriasis, and transplant rejection. In particular, the present invention provides methods and compositions comprising human S100A8 and/or S100A9 for reducing inflammation.12-10-2009
20090305983Curable Bone Cement - The present invention describes a curable bone cement. The cement comprises a curable polymeric binder and a filler, and is capable of curing without substantial evolution of heat on exposure to a curing agent. The binder comprises phenol groups which are capable of reacting in order to cure the cement.12-10-2009
20090305982MUTEINS OF TEAR LIPOCALIN AND METHODS FOR OBTAINING THE SAME - The present invention relates to novel muteins derived from human tear lipocalin. The invention also refers to a corresponding nucleic acid molecule encoding such a mutein and to a method for its generation. The invention further refers to a method for producing such a mutein. Finally, the invention is directed to a pharmaceutical composition comprising such a lipocalin mutein as well as to various uses of the mutein.12-10-2009
20090305981SECRETED PROTEIN ACIDIC AND RICH IN CYSTEINE (SPARC) AS CHEMOTHERAPEUTIC SENSITIZERS - The present invention relates to compositions and methods of use thereof for cancer therapy sensitization. Such compositions comprise functional fragments of the nucleotide and/or polypeptide sequences of a Secreted Protein Acidic and Rich in Cysteine (SPARC). The compositions can be used in combination with existing chemotherapeutic agents for treatment of cancers. 12-10-2009
20090305980Methods and Compositions Related to TR4 - Disclosed are compositions and methods related to TR4 and cancer.12-10-2009
20090305979COMPOSITIONS COMPRISING HPV POLYPEPTIDES AND IMMUNOENHANCEMENT PEPTIDES FOR THE TREATMENT AND PREVENTION OF CERVICAL CANCER - The present invention relates to a fusion protein comprising a fusion polypeptide of E6 and E7 of a human papilloma virus, a signal peptide for secreting the polypeptide out of the cell, and an immune enhancing peptide for a subject; a polynucleotide encoding the fusion protein; and a vector containing the polynucleotide. The present invention further relates to a pharmaceutical composition comprising the fusion protein or the vector; and a method for treating a disease caused by a human papilloma virus using the pharmaceutical composition.12-10-2009
20090305975Use of Trap Protein Per se as an Active Ingredient for the Manufacture of a Medicament for the Treatment of Staphylococcus Aureus Infection - Disclosed herein is the use of TRAP per se as an active ingredient for the manufacture of a medicament for the treatment of 12-10-2009
20090305974THERAPEUTIC INDICATIONS OF COLONY STIMULATING FACTORS - The present invention relates to the use of at least one colony stimulating factor (CSF) for the production of medicinal products in the treatment or prophylaxis of coma or neurotoxicity.12-10-2009
20090305973NOVEL PEPTIDE AND USE THEREOF - The present invention relates to a novel peptide and use thereof, more particularly to an isolated peptide comprising 21-41 contiguous amino acids selected from the amino acid sequence of SEQ ID NO: 1 or the amino acid sequence having at least 90% sequence homology to the amino acid sequence of SEQ ID NO: 1 and methods for promoting fibroblast proliferation and wound healing, which comprise administering to a subject in need thereof an effective amount of the peptide.12-10-2009
20090305972NOVEL CANCER-ASSOCIATED ANTIGEN - The present invention provides a novel cancer-associated antigen that can be used in the treatment and diagnosis of cancer. Further, the invention provides amino acid and nucleic acid sequence of the novel antigen, binding proteins, and immuno-conjugates. The invention also relates to diagnostic and therapeutic methods and kits.12-10-2009
20090305977Method for treating peripheral arterial disease with zinc finger proteins - Disclosed is a method for the administration of zinc finger proteins (ZFPs) or nucleic acids that encode such ZFPs for treating peripheral arterial disease, particularly by the repeated administration at regular intervals if such ZFPs or nucleic acids that encode such ZFPs.12-10-2009
20090305992USE OF AN INTERLEUKIN 1 RECEPTOR ANTAGONIST AND/OR PYRROLIDINEDITHIOCARBAMATE FOR THE TREATMENT OR PROPHYLAXIS OF TYPE 2 DIABETES - Substances that inhibit the action of the members of the IL-1β/NF-κB pathway can be used for protecting and preserving β-cell mass and function in prediabetic and diabetic type 2 patients. Specifically, the present invention relates to the use of an Interleukin 1 receptor antagonist (IL-1Ra) and/or pyrrolidinedithiocarbamate (PDTC) for the treatment or prophylaxis of type 2 diabetes, as well as a method for the treatment of type 2 diabetes.12-10-2009
20090305976Cytokine Mediating Composition - The invention relates to an agent having cytokine mediating activity. In particular the invention relates to a composition comprising a fraction of denatured plasma proteins and at least one metal, metal ion or metal salt thereof, wherein said mixture has cytokine mediating activity.12-10-2009
20090305971Nogo-B Receptor - Nogo-B receptors bind to Nogo-B and mediate its biological function. We have discovered that Nogo-B receptor is a component of endothelial cells, and is highly expressed in intact blood vessels. The present invention provides compositions comprising the Nogo-B receptor and fragments and fusion proteins thereof. The present invention also relates to nucleic acids encoding the Nogo-B receptor and fragments and fusion proteins thereof, as well as vectors and cells comprising such nucleic acids. The present invention also relates to antibodies specific for the Nogo-B receptor and fragments and fusion proteins thereof. The present invention also provides methods for preventing, detecting and treating Nogo-B receptor-related diseases, disorders and conditions.12-10-2009
20090305970Toxin-Like Polypeptides, Polynucleotides Encoding Same and Uses Thereof - An isolated polynucleotide is disclosed comprising a nucleic acid sequence encoding a polypeptide which comprises an amino acid sequence at least 90% identical to a sequence as set forth in SEQ ID NO: 1, wherein the polypeptide comprises an ion channel modulatory activity. Polypeptides and uses thereof are also disclosed.12-10-2009
20090305968Cell-Permeable Peptide Inhibitors of the JNK Signal Transduction Pathway - The present invention refers to protein kinase inhibitors and more specifically to inhibitors of the protein kinase c-Jun amino terminal kinase. Additionally, the present invention provides JNK inhibitor sequences, chimeric peptides, nucleic acids encoding same as well as pharmaceutical compositions for treating pathophysiologies associated with JNK signaling.12-10-2009
20090305967GLYCOPEGYLATED FACTOR VII AND FACTOR VIIA - The present invention provides conjugates between Factor VII or Factor VIIa peptides and PEG moieties. The conjugates are linked via an intact glycosyl linking group that is interposed between and covalently attached to the peptide and the modifying group. The conjugates are formed from both glycosylated and unglycosylated peptides by the action of a glycosyltransferase. The glycosyltransferase ligates a modified sugar moiety onto either an amino acid or glycosyl residue on the peptide. Also provided are pharmaceutical formulations including the conjugates. Methods for preparing the conjugates are also within the scope of the invention.12-10-2009
20090305965Stabilized Parathyroid Hormone Composition Comprising Parathyroid Hormone, Buffer and Stabilizing Agent - Disclosed relates to a stabilized parathyroid hormone (PTH) comprising a buffer and a stabilizing agent and, more particularly, to a stabilized PTH composition in which succinic acid, malic acid, histidine or ammonium bicarbonate is used as the buffer and sorbitol or mannitol is used as the stabilizing agent. The PTH composition of the present invention can be used to formulate stably PTH protein that is much more unstable to be readily decomposed than normal low molecular weight drugs.12-10-2009
20090305969Skin Repair Accelerating Therapeutic Agent Containing Desacyl Ghrelin and Derivatives Thereof as Active Ingredient - The present invention provides a novel therapeutic agent for skin injuries and a skin regeneration accelerator. The therapeutic agent for skin injuries and the skin regeneration accelerator containing desacyl ghrelin or a pharmaceutically acceptable salt thereof as an active ingredient.12-10-2009
20090305961Novel chimeric plasminogen activators and their pharmaceutical use - The present invention relates to recombinant chimeric proteins comprising a surfactant protein precursor N-terminally fused to a plasminogen activator or comprising a mature surfactant protein N-terminally or C-terminally fused to a plasminogen activator. The invention is also directed to the corresponding nucleic acid molecules encoding such fusion proteins as well as to a method for their production. The invention further refers to a pharmaceutical composition comprising such a fusion protein and to pharmacological uses of an inventive fusion protein for the prevention and/or treatment of inflammatory and interstitial lung diseases.12-10-2009
20090186816POLYPEPTIDE TARGETING TO MITOCHONDRIA - Methods for delivering non-mitochondrial proteins to mitochondria are provided. Also provided are nucleic acid constructs comprising a coding sequence encoding a DNA-binding polypeptide, fused to a mitochondrial targeting sequence (MTS) and a nuclear export signal (NES), and the encoded proteins. The construct successfully delivers DNA binding proteins to the mitochondrion. A chimeric methylase based on the above construct is successfully delivered to mitochondria, resulting in modification of mtDNA.07-23-2009
20090093408Protection of exendin-4 peptides through conjugation - A method for protecting a peptide from peptidase activity in vivo, the peptide being composed of between 2 and 50 amino acids and having a C-terminus and an N-terminus and a C-terminus amino acid and an N-terminus amino acid is described. In the first step of the method, the peptide is modified by attaching a react group to the C-terminus amino acid, to the N-terminus amino acid, or to an amino acid located between the N-terminus and the C-terminus, such that the modified peptide is capable of forming a covalent bond in vivo with a reactive functionality on a blood component. In the next step, a covalent bond is formed between the reactive group and a reactive functionality on a blood component to form a peptide-blood component conjugate, thereby protecting said peptide from peptidase activity. The final step of the method involves the analyzing of the stability of the peptide-blood component conjugate to assess the protection of the peptide from peptidase activity.04-09-2009
20090093407MATRIX-TARGETED FUSION POLYPEPTIDES FOR TISSUE REGENERATION AND WOUND HEALING - The present invention relates to compositions and methods for promoting tissue repair and regeneration. The invention provides a fusion polypeptide useful for targeting tissues for regeneration and methods of use therefore.04-09-2009
20090093406Vegetable Protein Concentrate Having a Reduced Insoluble Dietary Fiber Content and Increase Amount of Soluble Dietary Fiber Content - This invention relates to a vegetable protein composition of matter derived from an alcohol washed vegetable protein material, comprising; having a decreased amount of insoluble dietary fiber content and an increased amount of soluble dietary fiber content relative to said original amount of insoluble dietary fiber and soluble dietary fiber in the alcohol washed vegetable protein material.04-09-2009
20090093404ACCELERATED ANGIOGENESIS-INDUCING PROTEIN, COMPOSITIONS INDUCING ACCELERATED ANGIOGENESIS AND USES THEREOF - The present invention refers to an angiogenesis-inducing protein, a composition containing it and the uses of said protein.04-09-2009
20090093402Albumin Fusion Proteins - The present invention encompasses albumin fusion proteins. Nucleic acid molecules encoding the albumin fusion proteins of the invention are also encompassed by the invention, as are vectors containing these nucleic acids, host cells transformed with these nucleic acids vectors, and methods of making the albumin fusion proteins of the invention and using these nucleic acids, vectors, and/or host cells. Additionally the present invention encompasses pharmaceutical compositions comprising albumin fusion proteins and methods of treating, preventing, or ameliorating diseases, disorders or conditions using albumin fusion proteins of the invention.04-09-2009
20090093400Truncated keratinocyte growth factor (KGF) having increased biological activity - The present invention relates to a keratinocyte growth factor fragment, KGF04-09-2009
20090093413METHODS FOR THE MODULATION OF NEOVASCULARIZATION AND/OR THE GROWTH OF COLLATERAL ARTERIES AND/OR OTHER ARTERIES FROM PREEXISTING ARTERIOLAR CONNECTIONS - Described is the modulation of the neovascularization and/or growth of collateral arteries and/or other arteries from preexisting arteriolar connections. Methods are provided for enhancing neovascularization and/or the growth of collateral arteries and/or other arteries from preexisting arteriolar connections comprising contacting organs, tissue or cells with a colony stimulating factor (CSF) or a nucleic acid molecule encoding said CSF. Furthermore, the use of a CSF or a nucleic acid molecule encoding said CSF for the preparation of pharmaceutical compositions for enhancing neovascularization and/or collateral growth of collateral arteries and/or other arteries from preexisting arteriolar connections is described. Also provided are methods for the treatment of tumors comprising contacting an organ, tissue or cells with an agent which suppresses neovascularization and/or the growth of collateral arteries and/or other arteries from preexisting arteriolar connections through the inhibition of the biological activity of CSFs. Described is further the use of an agent which suppresses neovascularization and/or the growth of collateral arteries and/or other arteries from preexisting arteriolar connections through inhibition of the biological activity of CSFs for the preparation of pharmaceutical compositions for the treatment of tumors.04-09-2009
20090093398Use of Fibroblast Growth Factor Fragments - A discovery process beginning with an in vivo screening of proteins, peptides, natural products, classical medicinal compound or other substances. The administration of compounds to the animal can be either direct or indirect, such as by the administration and expression of cDNA-containing plasmids. Since the discovery process of the invention is based on a non-preconceived hypothesis and whole organism multi-organ analysis, a compound can be selected for testing in the absence of any biological selection criteria. The resulting organism-wide pattern of the gene expression changes in the transcriptome provides an overview of the activities at the molecular and organism-wide levels. The discovery process of the invention then integrates in vivo profiling and internal and external genomic databases to elucidate the function of unknown proteins, typically within few months. The invention further relates to medical uses of fibroblast growth factor 23 (FGF-23), FGF-23 fragments, FGF-23 C-terminal polypeptides, FGF-23 homologs and/or FGF-23 variants.04-09-2009
20090054320VESICULINS - The inventions relate generally to vesiculin peptides and vesiculin peptide chains, and fragments, variants and derivatives thereof, related compositions and formulations and their preparation and use, nucleic acids encoding such vesiculin peptides and vesiculin peptide chains, and fragments, variants and derivatives thereof and related vectors and host cells, hybridomas and antibodies, and methods for the prevention and treatment of conditions, diseases and disorders that would be improved, eased, or lessened by the administration of a composition of the invention, including but not limited to glucose metabolism diseases.02-26-2009
20090312249TLR4 decoy receptor protein - The present application discloses a nucleic acid molecule encoding a fusion polypeptide capable of binding myeloid differentiation protein-2 (MD-2) polypeptide, which includes: a nucleotide sequence encoding an MD-2 polypeptide-binding portion of human toll-like receptor 4 (TLR4), a leucine-rich repeats (LRR) module, and a multimerizing component.12-17-2009
20100056443RADIOPHARMACEUTICAL TO BE USED IN DISTINCTION BETWEEN INFLAMMATIONS AND INFECTIONS IN ORTHOPAEDIC IMPLANTS - The present invention relates to a radio-pharmaceutical to be used in distinction between inflammations and infections in orthopaedic implants, containing one or more radiomarked human recombinant defensins of -α or -β type, in particular -β defensin of type 3.03-04-2010
20090298776SPINAL FUSION METHODS AND DEVICES - Methods, devices and compositions for fusing adjacent vertebrae, and otherwise localizing bone growth, are provided. In one form of the invention, a method for fusing adjacent vertebrae includes preparing a disc space for receipt of an intervertebral disc implant in an interwertebral disc space between adjacent vertebrae, inserting the implant into the intervertebral disc space and providing an osteoinductive composition that includes an osteoinductive factor in a pharmaceutically acceptable carrier. The carrier is advantageously substantially impermeable to efflux of the osteoinductive factor and is released as the carrier is resorbed or biodegraded. Preferred carriers include a hardened, resorbable carrier, such as a calcium phosphate cement that retains at least about 50% of the osteoinductive factors greater than about 2 days. Preferred osteoinductive factors are growth factors and include bone morphogenctic proteins and LIM mineralization proteins. In alternative forms of the invention, the method may be performed without utilization of a load-bearing spinal implant by disposing the osteoinductive composition in the disc space. The method is advantageously performed on lumbar vertebrae by a posterior approach. Intervertebral fusion devices and methods for their preparation are also provided.12-03-2009
20090298777SPINAL FUSION METHODS AND DEVICES - Methods, devices and compositions for fusing adjacent vertebrae, and otherwise localizing bone growth, are provided. In one form of the invention, a method for fusing adjacent vertebrae includes preparing a disc space for receipt of an intervertebral disc implant in an intervertebral disc space between adjacent vertebrae, inserting the implant into the intervertebral disc space and providing an osteoinductive composition that includes an osteoinductive factor in a pharmaceutically acceptable carrier. The carrier is advantageously substantially impermeable to efflux of the osteoinductive factor and is released as the carrier is resorbed or biodegraded. Preferred carriers include a hardened, resorbable carrier, such as a calcium phosphate cement that retains at least about 50% of the osteoinductive factors greater than about 2 days. Preferred osteoinductive factors are growth factors and include bone morphogenctic proteins and LIM mineralization proteins. In alternative forms of the invention, the method may be performed without utilization of a load-bearing spinal implant by disposing the osteoinductive composition in the disc space. The method is advantageously performed on lumbar vertebrae by a posterior approach. Intervertebral fusion devices and methods for their preparation are also provided.12-03-2009
20090298772THERAPEUTICS TO INHIBIT MLL-MENIN INTERACTION FOR TREATING LEUKEMIA - Cell permeable peptides derived from MLL that block the interaction of MLL with menin for the treatment of acute mycloid and acute lymphoid leukemia are disclosed. Small molecules interfere with the interaction of MLL with any of its binding partners.12-03-2009
20090298770MAMMALIAN RELAXIN RECEPTORS - High affinity relaxin receptors, polypeptide compositions related thereto, as well as nucleotide compositions encoding the same, are provided. These proteins, herein termed LGR7 and LGR8, are orphan leucine-repeat-containing, G protein-coupled receptors. These receptors have a wide and a unique tissue expression pattern. The receptors, particularly soluble fragments thereof, are useful as therapeutic agents capable of inhibiting the action of relaxin and InsL3. The receptors and fragments thereof also find use in the screening and design of relaxin agonists and antagonists. Conditions treatable with relaxin agonists or antagonists include prevention or induction of labor, treatment of endometriosis, treatment of skin conditions such as scleroderma that require collagen or extracellular matrix remodelling. Additionally, relaxin has been implicated in the dilation of blood vessels' smooth muscle cells directly and through release of nitric oxide and atrial natriuretic peptide. Relaxin has also been used in the treatment of severe chronic pain, particularly pain arising from stretching, swelling, or dislocation of tissues.12-03-2009
20090298768STABLE LIQUID FORMULATION OF HUMAN GROWTH HORMONE - Disclosed herein is a stable liquid formulation comprising human growth hormone; L-lysine, L-arginine or polyethylene glycol 300; and poly(oxyethylene) poly(oxypropylene) copolymer, polyethylene glycol-15 polyoxystearate or polyethylene glycol-35 castor oil.12-03-2009
20090298767FORMULATION COMPRISING WHEY PROTEIN AND HYDROLYSATES FOR IMPROVING MUSCLE RECOVERY - The present invention relates to a formulation comprising whey protein or a hydrolysate of whey protein, which formulation is capable of inhibiting the expression of TNFα in lipopolysaccharide-stimulated macrophages in vitro. Also provided are uses of the formulation for attenuating a reduction in muscle function which results from muscle damage and/or for enhancing recovery from muscle damage and/or for enhancing the force generating capacity of muscle and methods of making the formulation.12-03-2009
20090298766DETECTION AND TREATMENT OF CANCERS - The present invention relates to methods and compositions for the detection and treatment of melanoma and skin cancers. More particularly, the invention discloses that BCSC-1 expression is altered in melanoma and skin cancer cells, allowing the design of effective detection methods and kits for such conditions. The invention also shows that restoring or increasing expression of BCSC-1 in melanoma and skin cancer cells suppresses tumorigenicity and represents a novel and effective approach for the treatment of melanoma and skin cancers. The invention may be used to detect the presence, stage or type of melanoma and skin cancers, as well as any predisposition thereto. The invention may be used in any mammalian subject, particularly human subjects.12-03-2009
20090298765Metastin derivatives and use thereof - The invention provides stable metastin derivatives having excellent biological activities (a cancer metastasis suppressing activity, a cancer growth suppressing activity, etc.). By modifying the constituent amino acids of metastin with specific modifying groups, metastin derivatives having more improved blood stability, etc. than native metastin and showing excellent cancer metastasis suppressing activity or cancer growth suppressing activity have been found. Furthermore, it has been found that these metastin derivatives exhibit effects of suppressing gonadotropic hormone secretion, suppressing sex hormone secretion, etc., which are wholly different from the effects heretofore known.12-03-2009
20090298763POLYNUCLEOTIDES AND POLYPEPTIDE SEQUENCES INVOLVED IN THE PROCESS OF BONE REMODELING - This invention relates, in part, to unique and newly identified genetic polynucleotides involved in the process of bone remodeling, variants and derivatives of the polynucleotides and corresponding polypeptides, uses of the polynucleotides, polypeptides, variants and derivatives, and methods and compositions for the amelioration of symptoms caused by bone remodeling disorders. Disclosed in particular are the isolation and identification of polynucleotides polypeptides variants and derivatives involved in osteoclast activity, validation of the identified polynucleotides for their potential as therapeutic targets and use of the polynucleotides, polypeptides, variants and derivatives for the amelioration of disease states and research purposes.12-03-2009
20090298764GENE AND PATHWAY AND THEIR USE IN METHODS AND COMPOSITIONS FOR PREDICTING ONSET OR PROGRESSION OF AUTOIMMUNE AND/OR AUTOINFLAMMATORY DISEASES - Embodiments of the present invention concern methods, compositions and uses thereof, relating to at least one of vitiligo, or vitiligo-associated autoimmune/autoinflammatory disease (VAAAD). In particular embodiments, genetic variations in the NALP1 gene are of use to detect, diagnose, predict the risk of or treat at least one of vitiligo or VAAAD. In more particular embodiments, the presence of genetic variations such as single-nucleotide polymorphisms (SNPs) in NALP1 genetic region are of use to detect, diagnose or predict the risk of VAAAD. In other embodiments, inhibitors targeted to NALP1, caspase-1 or caspase-5, ASC (PYCARD), interleukin-1β, interleukin-1β receptor, or interleukin 18 may be administered to a subject to treat VAAAD.12-03-2009
20090298775METHOD OF MEASURING NEPRILYSIN ACTIVITY - The present invention provides a method of measuring the activity of neprilysin, etc. More specifically, the present invention provides a method of measuring the activity of neprilysin in nerve cells; a method of screening a protein, a peptide or a compound enhancing the activity or expression of neprilysin in nerve cells by measuring the activity of neprilysin; a method of enhancing the activity or expression of neprilysin; and so on. Thus, the compound enhancing the activity and/or expression of neprilysin, which is obtained by the screening method characterized by using the method of measuring the activity of neprilysin in accordance with the present invention, is useful as a preventive and/or therapeutic agent for Alzheimer's disease. The method of measuring the activity of the present invention can be used for presymptomatic diagnosis of Alzheimer's disease.12-03-2009
20090291889Diagnostic assay and method of treatment for miscarriage risk or premature birth involving macrophage inhibitory cytokine-1 (MIC-1) - Methods for diagnosing risk of miscarriage and/or premature birth, foetal abnormalities, cancer (e.g. prostate cancer) and inflammatory disease (e.g. rheumatoid arthritis) are disclosed which involve determining abnormal levels of macrophage inhibitory cytokine-1 (MIC-1) in a body sample or, otherwise, determining the presence of a MIC-1 variant protein. Also disclosed are methods for reducing the risk of miscarriage and/or premature birth in pregnant subjects, and methods for treatment of inflammatory disease and/or cancer.11-26-2009
20090137469Use of ADNF polypeptides for treating peripheral neurotoxicity - This invention relates to the use of ADNF polypeptides in the treatment of neurotoxicity induced by chemical agents or by disease processes. The ADNF polypeptides include ADNF I and ADNF III (also referred to as ADNP) polypeptides, analogs, subsequences such as NAP and SAL, and D-amino acid versions (either wholly D-amino acid peptides or mixed D- and L-amino acid peptides), and combinations thereof which contain their respective active core sites.05-28-2009
20090281033Control of radiation injury - The invention relates to the field of drug development against acute radiation injury caused by exposure to high-energy electromagnetic waves (X-rays, gamma rays) or particles (alpha particles, beta particles, neutrons). To date, there is no effective drug to ameliorate radiation injury after accidental exposure to ionizing irradiation. The invention provides a method of treating radiation injury of a subject in need thereof comprising administering to the subject a peptide, or functional analogue or derivative thereof, of smaller than 30 amino acids. Furthermore, the invention provides use of a peptide, or functional analogue or derivative thereof, of smaller than 30 amino acids for the production of a pharmaceutical composition for the treatment of a subject suffering from or believed to be suffering from radiation injury. In particular, the invention provides anti-radiation peptides having a dose reduction factor (DRF) against acute gamma irradiation of at least 1.10, said DRF determinable by testing which dose of radiation results in 50% mortality at 30 days (LD50/30) after whole body radiation (WBI) in a test group of mice treated with said peptide at 72 hours after WBI and, testing which dose of radiation results in 50% mortality at 30 days (LD50/30) after whole body radiation (WBI) in a control group of mice treated only with the vehicle of said peptide at 72 hours after WBI and wherein the DRF is calculated by dividing the LD50/30 of the peptide-treated animals by the LD50/30 of the vehicle-treated animals.11-12-2009
20090270328METHODS OF INCREASING CEREBRAL BLOOD FLOW - Methods of increasing blood flow in a mammalian brain blood vessel characterized by, or otherwise experiencing, decreased blood flow due to an ischemic or other hypoxic event, vasoconstriction or vasospasm following hemorrhagic stroke; due to chronic high blood pressure; and/or due to idiopathic causes are provided. The method for increasing blood flow in such a mammalian brain blood vessel includes administering to a patient in need thereof a therapeutically effective amount of an inhibitor of δ protein kinase C. In certain embodiments, the inhibitor can be chronically administered without causing desensitization of the patient to the inhibitor. Kits for increasing blood flow in a mammalian brain blood vessel characterized by, or otherwise experiencing, decreased blood flow due to an ischemic or other hypoxic event, vasoconstriction or vasospasm following hemorrhagic stroke; due to chronic high blood pressure; and/or due to idiopathic causes are provided.10-29-2009
20090270312HIV-I GP41 FUSION PEPTIDES FOR IMMUNOMODULALTION - The present invention provides pharmaceutical compositions and methods for prevention or treatment of autoimmune diseases and other T cell mediated inflammatory diseases and conditions, which comprise as an active ingredient an effective quantity of a peptide derived from HIV gp41 fusion peptide domain or fragments, analogs, homologs and derivatives thereof. The invention further provides novel peptides derived from HIV gp41 fusion peptide domain, useful in the treatment of T cell mediated pathologies.10-29-2009
20090270331MULTI-DOMAIN AMPHIPATHIC HELICAL PEPTIDES AND METHODS OF THEIR USE - Disclosed herein are peptides or peptide analogs with multiple amphipathic α-helical domains that promote lipid efflux from cells via an ABCA1-dependent pathway. Also provided herein are methods of using multi-domain amphipathic α-helical peptides or peptide analogs to treat or inhibit dyslipidemic disorders. Methods for identifying non-cytotoxic peptides that promote ABCA1-dependent lipid efflux from cells are also disclosed herein.10-29-2009
20090270330PURIFIED ARABINOGALACTAN-PROTEIN (AGP) COMPOSITION USEFUL IN THE TREATMENT PSORIASIS AND OTHER DISORDERS - A purified Arabinogalactan-Protein (AGP) composition isolated through a selective method from the leaves and/or stems of 10-29-2009
20090270329METHODS OF ADMINISTERING PORCINE B-DOMAINLESS FVIII - The present invention provides a method of administering porcine B-domainless factor VIII (OBI-1) to a patient having factor VIII deficiency to provide more rapid and effective protection against bleeding episodes, compared to formerly available methods, or to provide more effective protection to such patients during non-bleeding periods. This invention is based on the discovery that the recombinant B-domainless porcine fVIII, termed OBI-1, has greater bioavailability compared to the natural porcine fVIII partially purified from porcine plasma, termed HYATE:C. Therefore, the inventive method employs lower unit doses of OBI-1, including, alternatively, omission of antibody-neutralizing dosage, or has longer intervals between the administration, compared to HYATE:C, to provide equivalent protection in patients having fVIII deficiency. The invention further provides pharmaceutical compositions and kits containing OBI-1 in combination with a pharmaceutically acceptable carrier, that are useful for treating patients in need of fVIII more effectively.10-29-2009
20090270325GROWTH FACTOR - We describe a chimeric protein comprising a growth hormone polypeptide linked to a polypeptide comprising the extracellular binding domain of growth hormone receptor; its use in enhancing the growth and metabolism of non-human animals and homodimers comprising said chimeric protein.10-29-2009
20090270324COMPLEMENT DEPLETION USING RECOMBINANT HUMAN C-3 DERIVATIVES - The invention provides isolated polypeptides having complement-modulating activity. Specifically, the invention resides in the provision of isolated polypeptides having complement depleting properties, i.e. that effect an efficient consumption of complement in human serum. The current invention thus provides human C3 derivatives that are capable of forming C3 convertases exerting an extended CVF, Bb-like half-life of up several hours, compared to 1.5 minutes of the naturally occurring C3 convertases, thus escaping the physiological degradation mechanisms.10-29-2009
20090270322G PROTEIN COUPLED RECEPTOR ANTAGONISTS AND METHODS OF ACTIVATING AND INHIBITING G PROTEIN COUPLED RECEPTORS USING THE SAME - The invention relates generally to G protein coupled receptors and in particular to agonists and antagonists of G protein receptors and methods of using the same.10-29-2009
20090270320Use of galectin-7 to promote the re-epithelialization of wounds - Methods for the therapeutic treatment of epithelial wounds in mammals comprising administering to a mammal afflicted with an epithelial wound a therapeutically effective amount of a galectin-3 protein and/or a galectin-7 protein are provided. Pharmaceutical compositions comprising a pharmaceutically suitable carrier or diluent and as an active agent a galectin-3 protein and/or a galectin-7 protein are also provided.10-29-2009
20090270319PHARMACEUTICAL USE OF PROTEIN MOLECULES IMMUNOLOGICALLY CORRELATED TO DIPTHERIA TOXIN - Protein molecules immunologically correlated to diphtheria toxin are proposed for the treatment of atherosclerosis and further correlated pathologies.10-29-2009
20090270318HIGH-AFFINITY ANTAGONISTS OF ELR-CXC CHEMOKINES - The present invention provides novel polypeptide sequences, methods for production thereof and uses thereof for novel ELR-CXC chemokine receptor agonists and antagonists.10-29-2009
20090270327Lepidopteran-Active Bacillus Thuringiensis Delta-Endotoxin Compositions and Methods of Use - Disclosed are 10-29-2009
20090270316HER-2 BINDING ANTAGONISTS - There is disclosed a pharmaceutical composition for treating solid tumors that overexpress HER-2, comprising an agent selected from the group consisting of (a) an isolated polypeptide having from about 50 to 79 amino acids taken from the sequence of SEQ ID NO:1, wherein the polypeptide binds to the extracellular domain ECD of HER-2 at an affinity of at least 108, (b) an isolated and glycosylated polypeptide having from about 300 to 419 amino acids taken from the sequence of SEQ ID NO:2, wherein the C terminal 79 amino acids are present, and wherein at least three N-linked glycosylation sites are present, (c) a monoclonal antibody that binds to the ECD of HER-2, and (d) combinations thereof, with the proviso that the agent cannot be the monoclonal antibody alone, and pharmaceutically acceptable carrier.10-29-2009
20090270315METHOD OF INHIBITING ANGIOGENESIS BY USING EPHRIN B2 - Methods and compositions for suppressing angiogenesis or neovascularization, as well as methods and compositions that are useful in treatment of a disease or disorder related to angiogenesis or neovascularization.10-29-2009
20090270314POLYPEPTIDE HAVING ANTI-ANGIOGENIC ACTIVITY - The present inventors found out four kinds of fragments (42 kD, 36 kD, 32 kD, 27 kD) by forcibly expressing vasohibin in a vascular endothelial cell. The present inventors analyzed those fragments and, as a result, found out low molecular weight vasohibin which has an anti-angiogenic activity. The low molecular weight vasohibin is useful as a therapeutic agent for various diseases such as a vascular disease associated with angiogenesis, an inflammatory disease, an entoptic neovascular disease, a reproductive disease, a central nervous system disease and cancer and the like. In addition, the low molecular weight vasohibin is also useful as a marker for angiogenesis.10-29-2009
20090270313Method of Treatment for Ischemic Heart Disease - The present invention provides a method of treatment for ischemic heart disease administering a scar formation accelerator containing at least one selected from SFRP2, SFRP4, Midkine, Pleiotrophin and Thymosin beta-10 as an effective ingredient to promote scar formation less fibrosis and retaining elasticity, and thereby improving cardiac function.10-29-2009
20090270326Cell Death Inhibitor - The present invention relates to an antioxidant response element (ARE) activator comprising a macrophage migration inhibitory factor (MIF) or a modified form thereof, an ARE activator comprising a combination of MIF or a modified form thereof and a substance capable of binding to MIF, and so on. These ARE activators are useful as safe and excellent cell death inhibitors, such as agents for the prevention/treatment of cardiovascular diseases, bone/joint diseases, infectious diseases, inflammatory diseases, renal diseases, central nervous system diseases, cancer or diabetes.10-29-2009
20090270317Pharmaceutical compositions comprising bioelastomer fusion proteins - Bioelastomers are disclosed for use in methods of binding compounds including immunoassay methods, in biosensors and methods or regenerating biosensors, and in methods for targeting the delivery of a compound to a particular location within an animal subjects. In general, the bioelastomer is conjugated to a binding compound, which is in turn used to bind a compound of interest. For targeted compound delivery, the bioelastomer is conjugated to the compound to be delivered.10-29-2009
20090270323METHODS FOR TREATMENT OF INSULIN-LIKE GROWTH FACTOR-1 (IGF-1) DEFICIENCY - The present invention provides methods and compositions for increasing the growth rates, alleviating the symptoms, or improving the metabolism of human patients having insulin-like growth factor-I deficiency (IGFD). The invention relates to methods comprising administering insulin-like growth factor-I to a patient having a height which, at the time of treatment or prior to initial treatment with IGF-1, is at least about 2 standard deviations below normal for a subject of the same age and gender, a blood level of insulin-like growth factor-I that, and at the time of treatment or prior to initial treatment with IGF-1, is below normal mean levels, usually at least about 1 standard deviations below normal mean levels, for age and gender.10-29-2009
20090088386AMYLOID FIBRILLOGENESIS-INHIBITING PEPTIDE - The present invention provides a peptide which functions as a mimic peptide of an amyloid β peptide and is capable of inhibiting the fibrillogenesis of an amyloid β peptide. The present invention relates to: an 8- to 30-amino acid residue peptide comprising an amino acid sequence represented by the following formula (I):04-02-2009
20090088380GHRH ANALOGS AND THERAPEUTIC USES THEREOF - Described herein are growth hormone-releasing hormone (GHRH) analogs and uses for such analogs. In some embodiments, growth hormone related diseases may be treated with one or more synthetic GHRH analogs of 29 amino acids or more, exhibiting concomitantly an increased resistance to proteolysis and high binding affinity to human GHRH receptor in in vitro studies, in comparison with human native GHRH (1-29)NH04-02-2009
20090082275OB PROTEIN COMPOSITIONS AND METHODS - The present invention provides methods and compositions for, for example, effecting weight loss and treating excess weight by administering OB protein, or a derivative thereof, in a form for constant supply, for example, continuous administration, at a dosage of less than or equal to about 1 mg protein/kg body weight/day. Compositions and methods used for production of recombinant murine and human OB protein are also provided. Compositions and methods for preparing recombinant murine methionyl OB protein and recombinant human methionyl OB protein, including DNA sequences, vectors, host cells, methods of fermentation, and methods of purification are provided herein.03-26-2009
20090253620METHODS AND COMPOSITIONS FOR TREATING GASTROINTESTINAL RADIOSENSITITIVITY IN A SUBJECT - A method and a related composition for treating gastrointestinal radiation sensitivity in a subject are disclosed. The method comprises administering to the subject an agent that increases either the amount of or the activity of a fasting-induced adipose factor (Fiaf) protein in a subject. The composition comprises a first agent that increases either the amount of or the activity of a fasting-induced adipose factor (Fiaf) protein in a subject and a second agent that ameliorates at least one symptom of gastrointestinal radiosensitivity in a subject.10-08-2009
20090247463POLYMER-BASED SUSTAINED RELEASE DEVICE - This invention relates to compositions for the sustained release of biologically active polypeptides, and methods of forming and using said compositions, for the sustained release of biologically active polypeptides. The sustained release compositions of this invention comprise a biocompatible polymer having dispersed therein, a biologically active polypeptide and a sugar.10-01-2009
20090069241Compositions and Methods for Use of Pigment Epithelial Derived Factor (PEDF) Peptide Fragments - The invention provides PEDF peptides which retain the biological activity of full-length PEDF. Fusion proteins comprising a PEDF peptide are also provided. The invention further provides a codon-optimized PEDF coding sequence and method of expressing it in bacteria. Compositions, methods of use and kits are also provided.03-12-2009
20090305966Use of histones for therapeutic purposes - The invention relates to the use of at least one human recombinant histone, especially at least one histone H1 subtype, and/or a therapeutic histone fraction as a basis for the treatment of thrombocytopenia.12-10-2009
20100009904Modified Exedins and Uses Thereof - Novel exendins with modifications at one or more of following positions: 2, 14, 27 or 28 and polyethylene glycol derivatives thereof are provided. These compounds are useful in treating type 2 diabetes as GLP-1 receptor agonists.01-14-2010
20090233857DNA VACCINE COMPOSITIONS AND METHODS OF USE - The present invention is directed to a DNA vaccine for immunization against HIV. The invention comprises a DNA molecule that has a sequence encoding a plurality of viral proteins capable of stimulating an immune response against HIV. The DNA molecule is rendered safe for used as a vaccine by the disruption of genes encoding reverse transcriptase, integrase, and Vif. The DNA molecule is further rendered safe by at least a partial deletion of the 3′ LTR.09-17-2009
20090233853USE OF OUTER MEMBRANE PROTEIN A IN TREATMENT/PREVENTION/DIAGNOSIS OF BACTERIAL INFECTION IN CENTRAL NERVOUS SYSTEM AND/OR PERIPHERAL BLOOD CIRCULATION - The present invention provides a method for the treatment and/or prevention of bacterial infection in central nervous system and/or peripheral blood circulation in a mammal by administering effective amount of outer membrane protein A (OmpA) or its derivatives to a mammal. Also provided is an antibody binding to OmpA that can assay OmpA levels in a biological sample and detect or diagnose bacterial infection in central nervous system and/or peripheral blood circulation.09-17-2009
20090233851Insulin Resistance Improver - A novel dosage regimen of GLP-1 receptor agonists causes little or no side effects or drug interactions and is suitable for improving insulin resistance. Also provided is an insulin resistance improver for use in the dosage regimen. The dosage regimen comprises repeatedly administering, preferably in a non-invasive manner, a GLP-1 receptor agonist at least before eating for a predetermined period of time to create a condition similar to what is observed with postprandial temporary secretion of the endogenous GLP-1 receptor agonist, rather than administering it continuously. This creates a similar or enhanced variation in the plasma levels of GLP-1 receptor agonist as compared to the circadian variation of the endogenous GLP-1 receptor agonist in a healthy individual. A pharmaceutical composition for use in the dosage regimen containing GLP-1 receptor agonist as an active ingredient is also provided.09-17-2009
20090233849Recombinant Alpha-Fetoprotein, Method and Means for Preparation Thereof, Compositions on the Base Thereof and Use Thereof - The invention relates to the microbiological and medical industry, genetic engineering, biotechnology. A 09-17-2009
20080249021BIOLOGICALLY ACTIVE PEPTIDES AND THEIR USE FOR REPAIRING INJURED NERVES - The present invention relates to biologically active peptides derived from the neurite outgrowth-promoting domain of laminin-1, i.e. the γ1 -chain of laminin-1. These peptides include the decapeptide RDIAEIIKDI (SEQ ID NO:1) and the truncated peptides derived therefrom comprising the biologically active domain thereof, the tripeptide KDI. The invention is directed to the biologically active tripeptide motif KDI, and to its use in promoting regeneration of neuronal or non-neuronal tissues and, in specific, to its use in the treatment of spinal cord injuries.10-09-2008
20090143283Pituitary Adenylate Cyclase Activating Peptide (PACAP) Receptor (VPAC2) Agonists and Their Pharmacological Methods of Use - This invention provides novel peptides that function in vivo as agonists of the VPAC2 receptor. These insulin secretagogue polypeptides are shown to lower blood glucose in vivo more than controls upon glucose challenge. The polypeptides of this invention are also stable in formulation and have long half-lives. The peptides of the present invention provide a new therapy for patients with decreased endogenous insulin secretion, in particular type 2 diabetics. In particular, the invention is a polypeptide selected from a specific group of VPAC2-related polypeptides, or functional equivalents thereof. The invention is also directed to a method of treating a metabolic disease in a mammal comprising administering a therapeutically effective amount of the insulin secretagogue peptides to said mammal. Also disclosed are methods of making the peptides, both recombinant and synthetic.06-04-2009
2009025362650 Human Secreted Proteins - The present invention relates to novel human secreted proteins and isolated nucleic acids containing the coding regions of the genes encoding such proteins. Also provided are vectors, host cells, antibodies, and recombinant methods for producing human secreted proteins. The invention further relates to diagnostic and therapeutic methods useful for diagnosing and treating diseases, disorders, and/or conditions related to these novel human secreted proteins.10-08-2009
20090281029LACTOFERRIN COMPLEX AND METHOD OF PRODUCING THE SAME - A biologically active complex of lactoferrin with a branched non-peptide hydrophilic polymer, one example of which is represented by the following formula [I]:11-12-2009
20090286729Epidermal Growth Factor Receptor Antagonists and Methods of Use - The present invention features epidermal growth factor receptor (EGFR) antagonists. These EGFR antagonists are polypeptide variants of ligands of EGFR. The EGFR ligand polypeptide variants of the invention possess EGFR antagonistic properties and can inhibit at least one EGFR-mediated biological activity such as inhibition of the receptor's kinase activation activity and subsequently, cell proliferation. Such polypeptide variants, and nucleic acids encoding these polypeptide variants can be used therapeutically in situations in which inhibition of EGFR activity is indicated.11-19-2009
20100035814N-Terminal Pegylated Prolactin Receptor Molecules - The invention is concerned with N-terminally pegylated polypeptides capable of binding to the prolactin receptor. Such polypeptides may for instance be N-terminally pegylated antagonists of the prolactin receptor, such as for instance prolactin variants.02-11-2010
20100004165Novel Protein Transduction Domains and Uses Therefor - The present invention provides novel transduction domains, compositions comprising such transduction domains, and their use for in vivo molecular delivery.01-07-2010
20090018081ACTIVATABLE CLOSTRIDIAL TOXINS - Compositions comprising activatable recombinant neurotoxins and polypeptides derived therefrom. The invention also comprises nucleic acids encoding such polypeptides, and methods of making such polypeptides and nucleic acids.01-15-2009
20090163417Activin-actrii antagonists and uses for increasing red blood cell levels - In certain aspects, the present invention provides compositions and methods for increasing red blood cell and/or hemoglobin levels in vertebrates, including rodents and primates, and particularly in humans.06-25-2009
20090221500MODIFIED TOXINS - The present application relates to compositions of modified toxins exhibiting reduced immunogenicity and reduced binding to vascular endothelium or vascular endothelial cells, thereby reducing the incidence of Vascular Leak Syndrome. Also provided are polypeptide toxophores from a modified diphtheria toxin, where modifications are in at least one amino acid residue of at least one T-cell epitope. Another aspect relates to a polypeptide toxophore from a modified diphtheria toxin, where modifications are in at least one amino acid residue of at least one T-cell epitope and at least one amino acid residue of at least one VLS motif of an unmodified native diphtheria toxin. Another aspect relates to a fusion protein which comprises a modified diphtheria toxin and a non-diphtheria toxin fragment that is a cell binding portion. Another aspect relates to the use of a modified diphtheria toxin for the treatment of a malignant disease or a non-malignant disease.09-03-2009
20090012001LIPID METABOLISM-IMPROVING AGENT - The present invention relates to an agent for improving lipid metabolism, a food/drink, and a feed, containing αs-casein as an active ingredient thereof. In addition, the present invention relates to an agent for suppressing body weight gain, an agent for reducing body fat, and an agent for reducing blood lipid, containing the agent for improving lipid metabolism.01-08-2009
20090012000Anti-Viral Peptide and Use Thereof - Disclosed is an anti-viral peptide which non-naturally occurs and is artificially synthesized. The peptide has at least one unit of the following amino acid sequence (a) and at least one unit of the following amino acid sequence (b) or (c): (a) an amino acid sequence constituted by at least five contiguous amino acid residues which is known as a nuclear localization sequence (NLS) or an amino acid sequence having a partial modification in the NLS; (b) a conserved sequence of VAP which is an endoplasmic reticulum protein or an amino acid sequence having a partial modification in the conserved sequence; and (C) an amino acid sequence which is known as a FFAT motif found in various lipid-binding proteins or an amino acid sequence having a partial modification in the amino acid sequence.01-08-2009
20090011999ORALLY ACTIVE ANDROCTONUS AMOREUXI PESTICIDAL BIOPEPTIDES - The present invention provides compositions and methods for orally active 01-08-2009
20090011998CALCIUM-INFLUX INHIBITORY FACTOR AND METHOD OF ISOLATION THEREOF - A purified factor isolated from human milk is provided. The factor is capable of inhibiting calcium-influx activity in polymorphonuclear leukocytes. A method for purification of the factor is also provided.01-08-2009
20090011997BIFUNCTIONAL HORMONE AND USES THEREOF - A bifunctional hormone exhibiting an alpha-MSH activity and a natriuretic peptide activity is described. The bifunctional hormone comprises for example a first domain having alpha-MSH related hormonal activity covalently linked to a second domain having natriuretic peptide related hormonal activity. The bifunctional hormone of the present invention is useful for example for the prevention and/or treatment of renal related diseases or conditions, such as acute renal failure (ARF) or acute kidney injury (AKI).01-08-2009
20090011995PRODUCTION OF A SOLUBLE NATIVE FORM OF RECOMBINANT PROTEIN BY THE SIGNAL SEQUENCE AND SECRETIONAL ENHANCER - The present invention is drawn to a method for enhancing secretional efficiency of a heterologous protein using a secretional enhancer consisting of a modified signal sequence which comprises the N-region of a signal sequence and/or a hydrophobic fragment of the said signal sequence comprising the said N-region and/or the hydrophilic polypeptide. The method of the present invention can be used not only for production of recombinant heterologous proteins by inhibiting insoluble precipitation and enhancing secretional efficiency of the recombinant protein into the periplasm or the extracellular fluid and but also for transduction of therapeutic proteins by enhancing membrane-permeability of the recombinant protein using a strong secretional enhancer.01-08-2009
20090011994NON-BASIC MELANIN CONCENTRATING HORMONE RECEPTOR-1 ANTAGONISTS AND METHODS - The present application provides compounds, including all stereoisomers, solvates, prodrugs and pharmaceutically acceptable forms thereof according to Formula I01-08-2009
20090011993Novel strategies for delivery of active agents using micelles and particles - The present invention provides biodegradable particles (e.g., three-dimensional particles) and micelles which can be used to encapsulate active agents for delivering to a subject. The present invention further provides methods for producing and delivering such particles and micelles. Additionally, the invention provides vaccination strategies that encompass the use of the novel particles and micelles.01-08-2009
20090011991Novel Curcuminoid-Factor VIIA Constructs as Suppressors of Tumor Growth and Angiogenesis - The fluorinated curcuminoid (3,5-bis-(2-fluorobenzylidene)-piperidin-4-one-acetate is about ten times more effective at arresting the growth of tumor cells than cisplatin. Conjugates for delivering a cytotoxic compound, such as a curcuminoid, specifically to cancer cells and to the vascular endothelial cells that nourish solid tumors, and methods of making and using thereof are described herein. The conjugate contains a cytotoxic compound bound to a protein such as in factor VIIa that retains high affinity for the surface protein tissue factor. The cytotoxic compound is bound to the protein via a linker and a hydrolyzable bond. Upon complexation, the resulting heterodimer is endocytosed and the drug is subsequently liberated inside the target cell via proteolytic cleavage.01-08-2009
20090011990CARBOHYDRATE FRACTION AND USE THEREOF FOR A FLAT POSTPRANDIAL GLUCOSE RESPONSE - The invention relates to a combination of heat-treated nutritional composition having a carbohydrate fraction comprising a) 5-30 wt % of one or more monosaccharides selected from galactose, ribose and mannose; b) carbohydrates capable of providing b1) sustained release glucose and b2) rapidly available glucose; c) optionally fructose; d) glucose-containing disaccharides other than maltose and sucrose; and e) optionally sugar polyols. The invention also pertains to the use of such a heat-treated nutritional composition for controlling glucose levels in blood and/or tissue, especially for preventing and/or treating diabetics, insulin-resistance, obesity, postprandial glucose response, metabolic syndrome, syndrome X, hyperglycemia, hypertriglyceridemia, hyperinsulinemia, dyslipidemia, dysfibrinolysis and/or disorders associated with major surgery or trauma.01-08-2009
20090011989Use of calmodulin kinase II inhibitors to treat myocardial dysfunction in structural heart disease - The present invention provides a method for treating structural heart disease in a subject, comprising administering an effective amount of an inhibitor of CaMKII to the subject, whereby the administration of the inhibitor treats the structural heart disease in the subject. Also provided are transgenic animal models for treating structural heart disease. Further provided is a means of screening for a compound that can treat structural heart disease.01-08-2009
20090011985GH SECRETAGOGUES AND USES THEREOF - The invention relates to use of a GH secretagogue (e.g. GRF or an analog thereof) for (1) altering a lipid parameter in a subject; (2) altering a body composition parameter in a subject, (3) treating a condition characterized by deficient or decreased bone formation in a subject (4) improving daytime vigilance and/or cognitive function in a subject, (5) improving a metabolic condition in a subject, (6) improving anabolism in a catabolic condition in a subject, and/or (7) improving and/or reconstituting immune function in a subject.01-08-2009
20090011984Biotin-binding receptor molecules - The subject invention pertains to a transmembrane protein capable of binding to biotinylated molecules, the protein comprising a cytoplasmic domain, a membrane-spanning domain and an extracellular domain, wherein the extracellular domain comprises biotin-binding activity, and methods of use. The protein can be expressed in a cell, thereby targeting a biotinylated drug.01-08-2009
20090011983186 Human Secreted Proteins - The present invention relates to novel human secreted proteins and isolated nucleic acids containing the coding regions of the genes encoding such proteins. Also provided are vectors, host cells, antibodies, and recombinant methods for producing human secreted proteins. The invention further relates to diagnostic and therapeutic methods useful for diagnosing and treating diseases, disorders, and/or conditions related to these novel human secreted proteins.01-08-2009
20090011982Flagellin Related Polypeptides and Uses Thereof - The use of flagellin and flagellin related polypeptides for the protection of mammals from the effects of apoptosis is described.01-08-2009
20090011981Novel Inhibitors of Angiogenesis - The present invention provides novel inhibitors of angiogenesis. The invention relates to PF4var1 and fragments and modifications thereof with anti-angiogenic activity. Therefore, the present invention relates to the use of said proteins and peptides as a medicine, more in particular for the treatment or prevention of angiogenesis or for the manufacture of a medicament for the prevention or treatment of angiogenic diseases. The invention also provides pharmaceutical compositions comprising said proteins and peptides and method of preventing or treating angiogenic disorders.01-08-2009
20090011980Method of Treating Parkinson's Disease in Humans by Direct Infusion of Glial Cell-Line Derived Neurotrophic Factor Into the Zona Incerta - A method of treating Parkinson's disease in humans is disclosed, wherein glial cell-line derive neurotrophic factor (GDNF) is chronically administered directly to the SNc and at least one subthalamic region or, alternatively, to the SNc, at least one sub thalamic region, and at least one putaminal region of the brain of a human in need of treatment thereof. In one aspect of the present invention the GDNF is infused directly into at least one caudal zona incerta and at least one postero-dorsal putamen of the brain through indwelling intraparenchymal brain catheters connected to an implantable pump.01-08-2009
20090011979IMMUNOMODULATORY PROTEIN AND USEFUL EMBODIMENTS THEREOF - The invention generally features the use of Yaba monkey tumor virus nucleic acid molecules and polypeptides for the treatment or prevention of immunoinflammatory disorders.01-08-2009
20090011978Use of Surfactant Preparations for the Treatment of Surgical Adhesions - The invention describes the use of surfactant comprising phospholipids and pulmonary surfactant proteins for the treatment of surgical adhesions.01-08-2009
20100087365Pharmaceutical Compositions of Hglp-1, Exendin-4 and Analogs Thereof - The present invention is directed to pharmaceutical composition comprising a clear solution or an aqueous mixture, a suspension or a semisolid of at least one peptide compound selected from the group consisting of hGLP-1(7-36)-NH04-08-2010
20100087369COMPOSITION COMPRISING OLIGOGALACTURONANS AND POLYCATIONIC SACCHARIDES - A ‘bioactive’ composition that has one or more oligogalacturonans ((1→4)-α-D-galacturonan) or any other oligosaccharides (oligoguluronans) that may present an ‘egg box’ conformation, this conformation being further stabilized by one or more polycationic saccharide(s), preferably either a chitosan oligosaccharide or a chitosan polysaccharide. A method prepares this composition and it is used, in medical, pharmaceutical, agricultural, nutraceutical, food, feed, textile, cosmetic, industrial and/or environmental applications.04-08-2010
20100087372GROWTH HORMONE SECRETION STIMULATOR - Provided are: an agent for promoting growth hormone-secretion, containing a milk-derived basic protein fraction as an active ingredient, with the promotion of growth hormone-secretion being mediated by the promotion of secretion of ghrelin having an effect for promoting growth hormone-secretion; and a method of promoting the secretion of ghrelin by using a milk-derived basic protein fraction. The agent for promoting growth hormone-secretion may be ingested on a daily basis and is highly safe even with its ingestion for a long period.04-08-2010
20100087375Modulation of synaptogenesis - Soluble proteins, e.g. thrombospondins, can trigger synapse formation. Such proteins are synthesized in vitro and in vivo by astrocytes, which therefore have a role in synaptogenesis. These thrombospondins are only expressed in the normal brain exactly during the period of developmental synaptogenesis, being off in embryonic brain and adult brain but on at high levels in postnatal brain. Methods are provided for protecting or treating an individual suffering from adverse effects of deficits in synaptogenesis, or from undesirably active synaptogenesis. These findings have broad implications for a variety of clinical conditions, including traumatic brain injury, epilepsy, and other conditions where synapses fail to form or form inappropriately. Synaptogenesis is enhanced by contacting neurons with agents that are specific agonists or antagonists of thrombospondins. Conversely, synaptogenesis is inhibited by contacting neurons with inhibitors or antagonists of thrombospondins.04-08-2010
20100087377Compositions and Methods to Prevent Cancer with Cupredoxins - The present invention relates to compositions comprising peptides that may be variants, derivatives and structural equivalents of cupredoxins that inhibit the development of premalignant lesions in mammalian cells, tissues and animals. Specifically, these compositions may comprise azurin from 04-08-2010
20100087378Compositions and Methods for Treating Diseases Associate with Angiogenesis and Inflammation - Pharmaceutical compositions and methods for treating diseases associated with angiogenesis and inflammation. The invention relates to a pharmaceutical composition that includes a therapeutically effective amount of sCD26 and/or a biologically active derivative thereof and a pharmaceutically acceptable carrier. The composition may further include a therapeutically effective amount of sFlt-1 and/or a biologically active derivative thereof Additionally, the invention relates to methods for treating a disease associated with and/or progresses by an inflammatory cytokine-associated inflammation and/or VEGF-associated angiogenesis.04-08-2010
20100087379POLYPEPTIDES OF BOTRYOSPHAERIA RHODINA - The invention relates to functional polypeptides secreted from 04-08-2010
20080280826Methods for Bone Treatment by Modulating an Arachidonic Acid Metabolic or Signaling Pathway - Methods for promoting osteogenesis to accelerate or enhance bone fracture healing, treat bone defects, and enhance bone formation are disclosed. The methods modulate an arachidonic acid metabolic or signaling pathway in general, and, in particular, utilize 5-lipoxygenase inhibitors. These molecules can be delivered alone or in combination with one or more agents that inhibit bone resorption, regulate calcium resorption from bone, enhance bone accumulation, enhance bone formation, induce bone formation, impair growth of microorganisms, reduce inflammation, and/or reduce pain.11-13-2008
20090088377CYSTEIC ACID DERIVATIVES OF ANTI-VIRAL PEPTIDES - This invention relates to C34 peptide derivatives having improved aqueous solubility that are inhibitors of viral infection and/or exhibit antifusogenic properties. In particular, this invention relates to C34 derivatives having inhibiting activity against human immunodeficiency virus (HIV), respiratory synctial virus (RSV), human parainfluenza virus (HPV), measles virus (MeV), and simian immunodeficiency virus (SIV) with long duration of action for the treatment of the respective viral infections.04-02-2009
20090054339Novel cellular factor-containing solution compositions - The invention is directed to novel cellular factor-containing solution compositions (referred to herein as “CFS” compositions), including novel sustained-release cellular factor-containing solution compositions (referred to herein as “SR-CFS” compositions), methods of making such novel compositions and uses thereof.02-26-2009
20080312150Treatment and analysis of proliferative disorders - A method of treating a subject having unwanted cell proliferation which includes: inducing differentiation in a cell; providing said cell with a photosensitizer; and activating said PS, thereby the treating unwanted cell proliferation.12-18-2008
20080300188Immunoglobulin Fusion Proteins - Disclosed are fusion proteins comprising a biologically active molecule and an immunoglobulin (Ig) Fc domain which is linked to the biologically active molecule. The Fc domain is a hybrid human Fc domain of (i) IgG1, IgG2 or IgG4 or (ii) IgG4 and IgD. The hybrid Fc is useful as a carrier of biologically active molecules.12-04-2008
20080207502Anti-Angiogenic Peptides and Methods of Use Thereof - Anti-angiogenic peptides that inhibit activation or proliferation of endothelial cells are disclosed. Such peptides maybe used to inhibit VEGF binding to the VEGFR2 receptor (also known as the kinase domain receptor or KDR) and bFGF binding to its receptor. Such peptides may also be used to inhibit, VEGF, bFGF, or integrin activation of endothelial cells in angiogenesis-associated diseases such as cancer, leukemia, multiple myeloma, inflammatory diseases, eye diseases and skin disorders.08-28-2008
20090054317POLYVALENT INHIBITORS OF PATHOGENS - The present invention provides polyvalent host cell receptor-directed pathogen inhibitors and methods for designing and using such polyvalent inhibitors. Polyvalent inhibitors of the invention comprise a biocompatible scaffold having attached thereto a plurality of ligands, e.g. peptides, capable of binding a host cell receptor or portion thereof of a pathogen or toxin of a pathogen thereby preventing the pathogen or toxin thereof from binding to the host cell and causing toxicity of the host cell. Also provided are methods of designing such polyvalent host cell receptor-directed pathogen inhibitors and methods of using such inhibitors to prevent and/or treat infections of a host. The compositions of the inventions can be useful for treating anthrax.02-26-2009
20090156480Biodegradable nanoparticle having t-cell recognizable epitope peptide immobilized thereon or encapsulated therein - A biodegradable nanoparticle having a T cell recognizable epitope peptide immobilized thereon or encapsulated therein of the present invention is usable as a safe and effective immunotherapeutic agent, and is useful as an immunotherapeutic agent for treating, for example, pollinosis, year-round nasal allergic disease and seasonal nasal allergic disease.06-18-2009
20090156483Analogs of Ghrelin - The invention comprises peptidyl analogs according to formulae (I) or (II) as depicted below:06-18-2009
20100152114Antioxidant activity of GH-RH Antagonists - There are provided means for suppressing the Reactive Oxidant Species (ROS) of certain cells by the administration of GHRH antagonists. The therapeutic applications of the anti-oxidative action of GH-RH antagonists relate to the redox status of certain cells, including but not limited to cancer cells, reducing the metabolism of reactive oxygen and nitrogen species. This antioxidant activity of GHRH antagonists is employable in the treatment of diseases in which their pathogenesis is related to increased cellular level of oxidative stress.06-17-2010
20100167997METHOD FOR STIMULATION COLLAGEN SYNTHESIS AND/OR KGF EXPRESSION - The present invention relates to a method for stimulating collagen synthesis and/or KGF expression, and more particularly, to a method for stimulating collagen synthesis and/or KGF expression using the AIMP07-01-2010
20090042796DERIVATIVES OF THE IL-2 RECEPTOR GAMMA CHAIN, THEIR PRODUCTION AND USE - This invention relates to the use of the IL-2 common gamma (cγc) and related molecules for the modulation of signal activities controlled by NIK, and some new such molecules02-12-2009
20090042794GROUP B STREPTOCOCCUS ANTIGENS AND CORRESPONDING DNA FRAGMENTS - The present invention relates to antigens, more particularly antigens of Group B 02-12-2009
20090018074Peptides for Inhibiting Insects - The subject invention pertains to the use of peptide fragments of cadherins (including cadherin-like proteins). The subject invention includes a cell (and use thereof) comprising a polynucleotide that expresses the peptide fragment. The subject invention includes methods of feeding the peptides to insects. In preferred embodiments, the peptides are fed to target insects together with one or more insecticidal proteins, preferably (but not limited to) B.t. Cry proteins. When used in this manner, the peptide fragment can not only enhance the apparent toxin activity of the Cry protein against the insect species that was the source of the receptor but also against other insect species. Preferably, the cadherin is a 01-15-2009
20090318339Biodegradable polymers having a pre-determined chirality - Optically active polymers that are composed of monomer residues derived from chiral pre-polymerized monomers, which maintain the chirality of the pre-polymerized monomers upon polymerization are disclosed. These polymers can be composed of monomer residues that are derived from readily available chiral monomers and can be designed to have pre-determined characteristics such as chirality, biodegradability and functionality. Uses of these polymers as therapeutically active agents, and/or as carriers of therapeutically active agents, for delivering the active agents to a targeted bodily site and/or for a sustained release of the active agent, are further disclosed. Also disclosed are processed of preparing the polymers, compositions and medical devices containing the polymers, and conjugates of these polymers and various agents.12-24-2009
20100048465Peptide mimics of melanocyte stimulating hormone - Provided are peptides having melanocyte stimulating hormone activity. Also provided are vectors encoding these peptides and transgenic cells comprising the above vectors. Additionally, methods of reducing or preventing release of an inflammatory cytokine from mammalian cells are provided, as are methods for treating a mammal suffering from, or at risk for, a condition mediated by an inflammatory cytokine cascade. Further provided are methods of reducing levels of an inflammatory cytokine in a mammal, methods of treating an overweight mammal, methods of decreasing food intake in a mammal and methods of inhibiting innate immunity in the digestive system of a mammal.02-25-2010
20090099086Activin-ActRIIa antagonists and uses for promoting bone growth - In certain aspects, the present invention provides compositions and methods for promoting bone growth and increasing bone density.04-16-2009
20090018060Thymus-specific protein - The invention provides the novel thymus-specific human protein T101, an 84-amino acid polypeptide isolated from the human thymus. The full T101 peptide contains a 33-amino acid signal peptide and a 51-amino acid T101 peptide sequence with both immune stimulatory and inhibitory activities. Also provided are modified peptides and partial T101 peptide sequences.01-15-2009
20090075890Long lasting synthetic exendin-4 peptide conjugates and methods of use thereof - Modified insulinotropic peptides are disclosed. The modified insulinotropic peptides are capable of forming a peptidase stabilized insulinotropic peptide. The modified insulinotropic peptides are capable of forming covalent bonds with one or more blood components to form a conjugate. The conjugates may be formed in vivo or ex vivo. The modified peptides are administered to treat humans with diabetes and other related diseases.03-19-2009
20090075883Compositions for the treatment of cancer, and methods for testing and using the same - A composition comprising leukotoxin proteins isolated from a bacterium is provided. In this composition, greater than 85% of the leukotoxin proteins are chemically modified at a basic amino acid residue, and the proteins induce cell death in myeloid leukocytes, while remaining substantially non-toxic to lymphoid leukocytes, lymphocytes, and red blood cells. Also provided is a method of selectively inducing cell death in myeloid leukocytes. The method comprises contacting the myeloid leukocytes with a composition comprising leukotoxin proteins. These leukotoxin proteins may be isolated from the NJ03-19-2009
20080287348Soluble Hybrid Prion Proteins And Their Use In The Diagnosis, Prevention And Treatment Of Transmissible Spongiform Encephalopathies - The present invention relates to a soluble hybrid protein, comprising at least a first polypeptide sequence derived from a prion protein PrP11-20-2008
20090209465MCT1 Transporters Expressed in Blood Brain Barrier Cells - MCT1 is consistently expressed at high levels in brain microvessel endothelial cells. Disclosed herein are assays for determining whether a test material/molecule is a substrate for, and/or is actively transported by, the MCT1 transporter, and therefore a candidate substrate for crossing the blood brain barrier. The assays are useful in screening for therapeutic, cytotoxic or imaging compounds used in the treatment or diagnosis of neurological diseases.08-20-2009
20090099075Chimeric Keratin-Binding Effector Proteins - The invention relates to chimeric keratin-binding effector proteins and their use in dermocosmetics.04-16-2009
20100179093Neoropeptide-2-Receptor (Y-2R) Agonists - Provided herein are neuropeptide-2 receptor agonists of the formula (I):07-15-2010
20090054319Methods and Compositions for the Treatment of Hypertension and Gastrointestinal Disorders - The use of guanylin potentiating agents for treating various disorders, including hypertension as well as IBS and other gastrointestinal disorders and conditions (e.g., gastrointestinal motility disorders, chronic intestinal pseudo-obstruction, colonic pseudo-obstruction, Crohn's disease, duodenogastric reflux, dyspepsia, functional dyspepsia, nonulcer dyspepsia, a functional gastrointestinal disorder, functional heartburn, gastroesophageal reflux disease (GERD), gastroparesis, inflammatory bowel disease, irritable bowel syndrome, post-operative ileus, ulcerative colitis, chronic constipation, and disorders and conditions associated with constipation is described.02-26-2009
20090143294METHODS OF TREATING VASODILATORY SHOCK - The invention encompasses methods of decreasing the lumenal diameter of a blood vessel by contacting the vessel with a myosin light chain phosphatase inhibitor.06-04-2009
20090325882CHAPERONIN 10 MODULATION OF TOLL-LIKE RECEPTOR-INDUCIBLE CYTOKINE AND CHEMOKINE SECRETION - Methods of use of Chaperonin 10 (Cpn10) are provided for regulating Toll-like receptor signaling and/or Toll-like receptor inducible immunomodulator secretion. Cpn10 negatively regulates Toll-like receptor agonist-induced pro-inflammatory cytokine and chemokine secretion, examples being IL-6 and RANTES, respectively. Cpn10 positively regulates Toll-like receptor agonist-induced anti-inflammatory cytokine and chemokine secretion, an example being IL-10. These immunoregulatory activities of Cpn10 may be useful in the treatment of diseases, disorders and conditions resulting from excessive pro-inflammatory cytokine and chemokine secretion. This invention also relates to producing, designing and/or screening Cpn10 agonists and antagonists according to their ability to regulate Toll-like receptor signaling and/or Toll-like receptor inducible immunomodulator secretion.12-31-2009
20090318340IL-17 homologous polypeptides and therapeutic uses thereof - The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid sequences, chimeric polypeptide molecules comprising the polypeptides of the present invention fused to heterologous polypeptide sequences, antibodies which bind to the polypeptides of the present invention and to methods for producing the polypeptides of the present invention.12-24-2009
20090048168INHIBITORS OF BCL-2 - A purified polypeptide includes about 5 to about 80 amino acids and includes an amino acid sequence corresponding to a portion of SEQ ID NO:1. The polypeptide inhibiting binding of Bcl-2 to IP02-19-2009
20100190698Neuroprotective peptide inhibitors of AP-1 signaling and uses therefor - The present invention provides AP-1 signaling inhibitory peptides comprising the amino acid sequences of SEQ ID NOS: 28-31, 36-39, 45-48, 54-57 and 62-65, compositions comprising one or a plurality of said peptides, and methods of treatment of neurological disorders comprising the administration of the peptide(s) or compositions.07-29-2010
20100137207G PROTEIN COUPLED RECEPTOR AGONISTS AND ANTAGONISTS AND METHODS OF ACTIVATING AND INHIBITING G PROTEIN COUPLED RECEPTORS USING THE SAME - The invention relates generally to G protein coupled receptors and in particular to agonists and antagonists of G protein receptors and methods of using the same.06-03-2010
20090186822Thrombopoietic Compounds - The invention relates to the field of compounds, especially peptides or polypeptides, that have thrombopoietic activity. The peptides and polypeptides of the invention may be used to increase platelets or platelet precursors (e.g., megakaryocytes) in a mammal.07-23-2009
20090099079Novel Fungal Enzymes - This invention relates to novel enzymes and novel methods for producing the same. More specifically this invention relates to a variety of fungal enzymes. Nucleic acid molecules encoding such enzymes, compositions, recombinant and genetically modified host cells, and methods of use are described. The invention also relates to a method to convert lignocellulosic biomass to fermentable sugars with enzymes that degrade the lignocellulosic material and novel combinations of enzymes, including those that provide a synergistic release of sugars from plant biomass. The invention also relates to a method to release cellular content by degradation of cell walls. The invention also relates to methods to use the novel enzymes and compositions of such enzymes in a variety of other processes, including washing of clothing, detergent processes, biorefining, deinking and biobleaching of paper and pulp, and treatment of waste streams.04-16-2009
20100004167CSF3R POLYPEPTIDES AND USES THEREOF - The present invention relates to CSF3R polypeptide variants and their uses, particularly for therapeutic or prophylactic treatment in human subjects. The invention also relates to nucleic acids encoding said polypeptides, vectors comprising such nucleic acids and recombinant cells containing the same. The invention further discloses methods of producing such polypeptides, as well as methods and tools for detecting or dosing these polypeptides in any sample.01-07-2010
20090105147Deuterated etravirine - This disclosure relates to novel di-aryl-pyrimidine (DAPY) compounds and pharmaceutically acceptable salts thereof. This disclosure also provides compositions comprising a compound of this disclosure and the use of such compositions in methods of treating diseases and conditions that are beneficially treated by administering a non-nucleoside reverse transcriptase inhibitor (NNRTI).04-23-2009
20090163407COMPOSITIONS AND METHODS FOR ALTERING WNT AUTOCRINE SIGNALING - The present invention relates to compounds and methods for treating cancers in which the autocrine Wnt canonical signaling pathway is activated. In particular, there is provided a method for inhibiting growth of a tumor cell or sensitizing a cancer cell to treatment by contacting such a tumor cell with a compound that alters Wnt signaling. The compound that alters Wnt signaling can be a Wnt antagonist, a Wnt receptor antagonist, or a combination thereof.06-25-2009
20090048159KIT FOR TREATING A HEALTH CONDITION BY INDUCING TRANSLOCATION OF A CALRETICULIN PROTEIN TO A CELLULAR MEMBRANE - A kit for treating a health condition in a mammal comprises a calreticulin protein and/or compound for inducing a translocation of a calreticulin protein to a cellular membrane in order to provoke an immunogenic apoptosis. The calreticulin protein may include any one or more of: endogenous calreticulin, recombinant calreticulin, and calreticulin in mimetic form. The endogenous form of calreticulin may include any one of: a plasma membrane calreticulin and an intracellular calreticulin.02-19-2009
20100267635USE OF PROTEASE INHIBITORS AND GRF MOLECULES IN COMBINATION THERAPY - Combination therapies comprising a protease inhibitor and a growth hormone (GH)-inducing compound (such as a GRF molecule) are described, in which there are no or substantially no drug interactions.10-21-2010
20090143292Liquid Formulation of G-CSF Conjugate - The present invention relates to a liquid pharmaceutical composition comprising a granulocyte colony stimulating factor polypeptide conjugated with a polymer. In various embodiments, the composition has a pH value in the range of 4.5 to 5.5. Exemplary compositions further comprise a surfactant and optionally one or more other pharmaceutically acceptable excipients. The invention provides, inter alia, formulations free from tartaric acid or salts thereof and/or from succinic acid and salts thereof as buffering agents. Exemplary formulations are essentially devoid of not amino acids as stabilizers. The composition has good storage stability and is especially useful for the prophylaxis and treatment of disorders and medical indications where granulocyte colony stimulating factor preparations are considered as useful remedies.06-04-2009
20090149378GLP-1 ANALOGUES - The present invention is directed to peptide analogues of glucagon-like peptide-1, the pharmaceutically-acceptable salts thereof, to methods of using such analogues to treat mammals and to pharmaceutical compositions useful therefor comprising said analogues.06-11-2009
20080242605CHEMOTAXIS-INHIBITING PROTEIN OF STAPHYLOCOCCUS (CHIPS) AND ITS USE - The present invention relates to a new protein of the bacteria 10-02-2008
20100004166Endothelin and Endothelin Receptor Agonists in the Treatment of Metabolic Diseases - Methods for treating conditions or disorders which can be alleviated by reducing food intake are disclosed which comprise administration of an effective amount of an endothelin or an endothelin agonist, alone or in conjunction with other compounds or compositions that affect satiety. The methods are useful for treating conditions or disorders, including obesity, Type II diabetes, eating disorders, and insulin-resistance syndrome. Pharmaceutical compositions for use in the methods of the invention are also disclosed.01-07-2010
20100222275THERAPEUTIC AGENT FOR VITILIGO AND METHOD OF ACCELERATING PIGMENTATION - Provided are a pharmaceutical product capable of treating vitiligo by thickening the epidermis at a vitiligo-affected site, which has been thinned, to thereby accelerate pigmentation, and a method of accelerating pigmentation by thickening the epidermis.09-02-2010
20100120679Targeting NBS1-ATM Interaction To Sensitize Cancer Cells To Radiotherapy And Chemotherapy - Provided herein are compositions and methods for use in sensitizing cancer cells to radiation and chemotherapy.05-13-2010
20090062205Reconstitution Medium For Protein and Peptide Formulations - Compositions useful for reconstitution of concentrated formulations containing protein/peptide pharmaceuticals are provided. The composition generally includes one or more lipids, as well as one or more alcohols that promote and stabilize the formation of (a) lipid molecular assemblies with greater protein encapsulation; (b) protein-lipid complexes and (c) protein and lipid solutions. The reconstitution medium improves the protein-lipid association that in turn alters the pharmaceutical properties.03-05-2009
20080242614COMPOSITIONS AND METHODS FOR TREATING INFECTIONS USING ANALOGUES OF INDOLICIDIN - Compositions and methods for treating infections, especially bacterial infections, are provided. Indolicidin peptide analogues containing at least two basic amino acids are prepared. The analogues are administered as modified peptides, preferably containing photo-oxidized solubilizer.10-02-2008
20090312256USES OF HUMAN ZVEN PROTEINS AND POLYNUCLEOTIDES - The present invention provides methods of using Zven1 and Zven2 polypeptides to increase chemokine production. The present invention also provides methods for treating intestinal motility disorders and improving gastrointestinal function with Zven1 and Zven2 polypeptides.12-17-2009
20090192085FKBP-L And Uses Thereof - Disclosed are methods and compositions that employ FKBP-L polypeptides for modulating angiogenesis and/or tumor metastasis. The FKBP-L polypeptides may be used for the treatment of disorders mediated by angiogenesis such as cancer.07-30-2009
20090176707HUMAN SIGNAL PEPTIDE-CONTAINING PROTEINS - The invention provides a human signal peptide-containing proteins (SIGP) and polynucleotides which identify and encode SIGP. The invention also provides expression vectors, host cells, antibodies, agonists, and antagonists. The invention also provides methods for treating or preventing disorders associated with expression of SIGP.07-09-2009
20100210540USE OF THE PEPTIDE COMBINATION THYMOSIN BETA 4 AND DELTA SLEEP INDUCING PEPTIDE AS A THERAPEUTIC AGENT - The present invention is directed to the use of the combination of the peptide compounds Ac-Ser-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH and Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu-OH as a therapeutic combination for prophylaxis and/or treatment of cancer, a heart and vascular disease, an infectious disease, a fibrotic disease, an inflammatory disease, a neurodegenerative disease, or an autoimmune disease.08-19-2010
20100120680METHOD OF TREATING HEPATITIS C VIRUS - A method of treating or inhibiting hepatitic C virus (HCV). The method comprises administering an effective amount of at least one pokeweed antiviral protein (PAP) mutant alone or in combination with other anti-HCV agents.05-13-2010
20090305964PHARMACEUTICAL PREPARATIONS OF A GLP-1 MOLECULE AND AN ANTI-EMETIC DRUG - The present invention relates to a kit of parts comprising a GLP-1 molecule and an anti-emetic drug, said kit of parts being suitable for separate, sequential or/and simultaneous administration to a subject, preferably a human being. Also provided are combinations of GLP-1 or a GLP-1 analog with one or more anti-emetic drugs, as well as uses of the combinations in the manufacture of medicaments.12-10-2009
20090203594Anticancer peptide - A polypeptide and methods of using the polypeptide for treating malignancy by administering to a subject a composition of the polypeptide. Pharmaceutical compositions of the polypeptide.08-13-2009
20090118191Anti-Antiogenic Fragments of Pigment Epithelium-Derived Factor (PEDF) - The present invention provides anti-angiogenic derived from pigment epithelium-derived factor (PEDF) pharmaceutical compositions comprising the peptides, and methods of preventing angiogenesis. Such methods are useful in treating angiogenesis-associated disorders and diseases.05-07-2009
20090312259LONG LASTING GLUCAGON-LIKE PEPTIDE 2 (GLP-2) FOR THE TREATMENT OF GASTROINTESTINAL DISEASES AND DISORDERS - This invention relates to glucagon-like peptide 2 (GLP-2) derivatives. In particular, this invention relates to GLP-2 peptide derivatives having an extended in vivo half-life, for the treatment or prevention of gastrointestinal disorders or diseases such as inflammatory bowel disease and other gastrointestinal functions, from any segment of the gastrointestinal tract, from the oesophagus to the anus.12-17-2009
20090111750KERATIN DERIVATIVES AND METHODS OF MAKING THE SAME - Soluble keratin derivatives are disclosed. The soluble keratin derivatives may include a soluble keratin protein having at least one substituted chemical group at a lysine group, terminal amine group and/or hydroxyl amino acid group of a soluble keratin protein. Soluble keratin derivatives may be formed by succinylation or quaternisation, or by reaction with fatty acid derivatives. The soluble keratin derivatives may be used in personal care formulations, and may also comprise mixtures of several different soluble keratin derivatives.04-30-2009
20080269118Use of Gpr100 receptor in diabetes and obesity regulation - We describe a method of identifying a molecule suitable for the treatment, prophylaxis or alleviation of a Gpr100 associated disease, in particular diabetes and obesity, the method comprising determining whether a candidate molecule is an agonist or antagonist of Gpr100 polypeptide, in which the Gpr100 polypeptide comprises the amino acid sequence shown in SEQ ID NO: 3 or SEQ ID NO: 5, or a sequence which is at least 90% identical thereto.10-30-2008
20090298757OXYNTOMODULIN ANALOGUES AND THEIR EFFECTS ON FEEDING BEHAVIOUR - Compounds of the invention are novel peptide analogues of oxyntomodulin (oxm) in which one or more amino acids of the oxm sequence have been changed. Changing amino acids 15-24 of oxm to either amino acids 968-977 of the α-latrotoxin peptide (and variations thereof) or amino acids 15-24 of exendin-4 (and variations thereof), or combinations of sequences from these sources, and/or changing amino acids 27-33 of oxm to amino acids 27-33 of exendin-4, and/or the addition of amino acids to the C-terminus of the peptide, results in a series of analogues of oxm that demonstrate the oxm like activity of reducing food intake, and with certain embodiments a greater ability to decrease food intake.12-03-2009
20100197580PARSTATIN PEPTIDES AND USES THEREOF - The invention provides parstatin peptides, particularly a mammalian parstatin peptide including amino acids 1-26 of full length mammalian parstatin, preferably a human parstatin. The invention provides parstatin peptides in appropriate pharmaceutical carriers and formulated for administration. The invention provides for the use of the peptide for example as a medicament or for the preparation of a medicament. The invention provides methods of use for parstatin peptides including for inhibition of angiogenesis, for example for inhibition of ocular angiogenesis, for methods of cardioprotection, and for methods of prevention and treatment of myocardial ischemia-reperfusion injury.08-05-2010
20100227809COMBINATION TREATMENT FOR METABOLIC DISORDERS - Various metabolic disorders, such as insulin resistance syndrome, diabetes, polycystic ovary syndrome, hyperlipidemia, fatty liver disease, cachexia, obesity, atherosclerosis and arteriosclerosis can be treated with a compound selected from an incretin mimetic and a dipeptidyl peptidase IV inhibitor in combination with a Compound of Formula, I or a pharmaceutically acceptable salt thereof, Formula (I) Three of R09-09-2010
20100210545PREVENTIVE/REMEDY FOR CANCER - The present invention provides identification of TRAIL signal activator sensitivity markers in cancer cells, and a method of diagnosing the sensitivity to TRAIL signal activator in a cancer patient using the markers. Tailor-made medical service of administering a TRAIL signal activator to a TRAIL signal activator sensitive cancer patient is provided.08-19-2010
20090258828INVESTIGATION OF MUCOSA DRYNESS CONDITIONS - The present invention relates to diagnosis and/or treatment of medical conditions. The present invention relates to new method of diagnosing dry mucosa condition in a subject. The condition may be dry eye. The present invention also provides a method to monitor the efficacy of a treatment of a dry mucosa condition, a method of treating a dry mucosa condition and/or a diagnostic kit for a dry mucosa condition.10-15-2009
20090042801Method for inhibiting infection and reproduction of influenza type A WSN virus - The present invention relates to a method for inhibiting infection and reproduction of influenza type A WSN virus, which comprises providing an effective amount of a pharmaceutical composition; and contacting said composition with said influenza type A WSN virus, wherein said pharmaceutical composition contains C-phycocyanin (C-PC), allophycocyanin (APC), and spirulina growth factor (SGF). The present invention also provides a method for extracting said pharmaceutical composition, comprising the steps of: (a) adding hypotonic buffer solution to organic blue-green algae powder and mixing thoroughly; (b) incubating the mixture below room temperature overnight; (c) separating and purifying the mixture by a centrifuge; (d) collecting the suspending supernatant and detecting it by a spectrometer to determine ingredients and content; and (e) spray drying the supernatant; characterized in which low-temperature extraction is employed to maintain the bioactivity and nutrients of the pharmaceutical composition.02-12-2009
20090275502METHODS AND COMPOSITIONS FOR ENHANCING DEVELOPMENTAL POTENTIAL OF OOCYTES AND PREIMPLANTATION EMBRYOS - The invention relates to compositions and methods for enhancing the developmental potential of oocytes or preimplantation embryos by modulating mitochondrial-associated proteins and/or genomic integrity modifier proteins in the oocytes or preimplantation embryos. In one aspect of the invention, the levels of one or more mitochondrial-associated proteins and/or genomic integrity modifier proteins are increased, in particular by introducing the mitochondrial-associated proteins and/or genomic integrity modifier proteins into the oocytes or preimplantation embryos. Oocytes may be fertilized to obtain a zygote with increased levels of one or more mitochondrial-associated proteins and/or genomic integrity modifier proteins. The methods and compositions may be used to improve in vitro fertilization and embryo transfer methods, and nuclear transfer techniques.11-05-2009
20090281034Microencapsulation and sustained release of biologically active polypeptides - The invention relates to compositions and methods for the sustained release of biologically active polypeptides. The sustained release compositions of this invention comprise a biocompatible polymer having dispersed therein a biologically active polypeptide, and a corticosteroid to modify the release profile and provide increased bioavailability.11-12-2009
20100125053Allosteric Modulation of the Dopamine Transporter Protein for the Treatment of HIV-1 Induced Neurologic Dysfunction - A method for increasing dopaminergic neurotransmission in a mammal in need of such treatment is provided. The method comprises disrupting Tat-DAT binding in the mammal.05-20-2010
20090291893Compositions for the prevention and treatment of neuroinjury and methods of use thereof - A method for preventing or ameliorating secondary neuronal injury and inflammation following traumatic brain injury (TBI) is disclosed. The method comprises the step of administering into a subject in need of such treatment an effective amount of a pharmaceutical composition containing a neuregulin (NRG), a variant of NRG, or an expression vector encoding a NRG or a variant of NRG.11-26-2009
20090286736ANTI-INFLAMMATORY COMPOUNDS AND USES THEREOF - The present invention provides anti-inflammatory compounds, pharmaceutical compositions thereof, and methods of use thereof for treating inflammatory disorders. The present invention also provides methods of identifying anti-inflammatory compounds and methods of inhibiting NF-κB-dependent target gene expression in a cell.11-19-2009
20090275516COMPOUNDS AND METHOD FOR MODULATING INFLAMMATORY REACTIONS - The present invention relates to compounds and methods for modulating, reducing or inhibiting, inflammatory reactions in a patient. Particularly, inflammatory reactions that are targeted by the present invention are cell migration, secretion of toxic products and proteolysis at a site of inflammation. Reduction of inflammation manifestations and reactions occurs by using an anti-S100 polynucleotide or polypeptide inhibitor or antagonist, which is essentially targeted against S100A8, S100A9 or S100A12, alone or in combination with other inhibitors of chemokines or immune modulating products.11-05-2009
20080249005Use of Dm43 and Its Fragments as Matrix Metalloproteinases Inhibitor - This invention is related to the use of DM43 protein as a metalloproteinases inhibitor. More specifically, this invention is related to the use of DM43 for the therapeutics of pathologies such as cancer and osteoarthritis, which are dependent on matrix metalloproteinases inhibition, based on the structure identity with SVMPs.10-09-2008
20090156496METHODS AND COMPOSITIONS FOR TREATING AND PREVENTING PERIPHERAL NERVE DAMAGE - Disclosed herein is a method for treating and/or preventing peripheral nerve damage in a subject comprising administering to the subject a therapeutically effective amount of oncomodulin. Preferably, the subject is a mammal, most preferably, a human. In preferred embodiments, the oncomodulin may be used in combination with mannose, a mannose derivative and/or inosine.06-18-2009
20090203614USE OF AGENTS THAT PREVENT THE GENERATION OF AMYLOID-LIKE PROTEINS AND/OR DRUSEN, AND/OR USE OF AGENTS THAT PROMOTE SEQUESTRATION AND/OR DEGRADATION OF, AND/OR PREVENT THE NEUROTOXIC EFFECTS OF SUCH PROTEINS IN THE TREATMENT OF MACULAR DEGENERATION - The present invention provides compositions and methods for treating age-related macular degeneration (AMD). More specifically, the methods of the invention target amyloid proteins and drusen that tend to accumulate in the eyes of those patients suffering from AMD. AMD is treated in the methods of the invention by providing agents that sequester and/or degrade such amyloid deposits and/or drusen such that a patient's vision is improved or restored.08-13-2009
20080312143Modified Cdna for High Expression Levels of Factor VIII and Its Derivatives - The present invention relates to modified DNA sequences coding for biologically active recombinant human factor VIII and its derivatives, recombinant expression vectors containing such DNA sequences, host cells transformed with such recombinant expression vectors, and processes for the manufacture of the recombinant human factor VIII and its derivatives. The invention also covers a transfer vector for use in human gene therapy which comprises such modified DNA sequences. The present invention relates to modified DNA sequences coding for biologically active recombinant human factor VIII and its derivatives, recombinant expression vectors containing such DNA sequences, host cells transformed with such recombinant expression vectors, and processes for the manufacture of the recombinant human factor VIII and its derivatives. The invention also covers a transfer vector for use in human gene therapy which comprises such modified DNA sequences.12-18-2008
20100234294IDENTIFICATION OF NEW ISOFORMS OF THE MHC-CLASS I SPECIFIC RECEPTOR CD160 AND USES THEREOF - The present invention concerns an isolated polypeptide comprising a sequence selected in the group comprising SEQ ID NO.7, its orthologs, and derivatives thereof; a polynucleotide comprising a nucleic acid sequence encoding for said polypeptide; a vector comprising said polynucleotide; a host cell genetically engineered with said polynucleotide or with said vector; a pharmaceutical composition comprising said polypeptide, a polynucleotide coding for said polypeptide or a vector comprising said polynucleotide, and optionally a pharmaceutically acceptable carrier; a method for screening for antagonists and/or agonists of said polypeptide; and uses of said polypeptide, a polynucleotide coding for said polypeptide or a vector comprising said polynucleotide, for the manufacture of a medicament.09-16-2010
20080234195THERAPEUTIC, NUTRACEUTICAL AND COSMETIC APPLICATIONS FOR EGGSHELL MEMBRANE AND PROCESSED EGGSHELL MEMBRANE PREPARATIONS - The present invention relates to therapeutic, cosmetic, and nutraceutical applications for eggshell membrane, processed eggshell membrane preparations and eggshell membrane isolates. The invention is directed to treating a mammal that will benefit from the administration of naturally occurring material found in eggshell membrane, processed eggshell membrane, eggshell membrane isolates and combinations thereof by administering to the mammal a composition containing eggshell membrane, processed eggshell membrane, eggshell membrane isolates and combinations thereof, alone or in combination with other active ingredients.09-25-2008
20090042784Purification of a Drug Substance of a Factor VII Polypeptide by Removal of DesGla-Factor VII Polypeptide Structures - The present invention relates to a purification process for drug substances of a Factor VII polypeptide having an impurity in the form of desGla-Factor VII polypeptide structures. The process utilizes an anion-exchange material and includes washing and/or elution with a buffer of a predetermined pH.02-12-2009
20080300187MUTATED HOXB4 PROTEINS WITH IMPROVED STABILITY, AND METHODS OF USE THEREOF - A polypeptide, the amino acid sequence of which comprises a sequence as set forth in SEQ ID NO:2, including at least one mutation within the degron domain of the polypeptide encompassed between positions 1 and 35 of the sequence, wherein said at least one mutation reduces the susceptibility of the polypeptide to ubiquitin-proteasome degradation.12-04-2008
20090291890Factor VII polypeptides that are modified and uses thereof - Modified factor VII polypeptides and uses thereof are provided. Such modified FVII polypeptides include Factor VIIa and other forms of Factor VII. Among modified FVII polypeptides provided are those that have altered activities, typically altered procoagulant activity, including increased procoagulant activities. Hence, such modified polypeptides are therapeutics.11-26-2009
20090137470METHODS OF TREATING CANCER USING NOTCH PATHWAY INHIBITORS - The present invention is based on the discovery that the Notch signaling pathway is associated with cancer. Accordingly, the invention provides methods and compositions for treating cancer. Also provided are methods of modulating the expression and/or activity of proteins in the Notch signaling pathway for use in diagnoses and treatment of cancer in a subject.05-28-2009
20090209463Hgf Precursor Protein Variant and Active Protein Thereof - An HGF precursor protein variant, in which a peptide structure comprises a sequence including a peptide chain X inserted between an α chain of HGF or a polypeptide where 1 to 20 amino-acid residues from the C-terminus of the α chain are deleted, and a β chain of HGF or a polypeptide where 1 to 20 amino-acid residues from the N-terminus of the β chain are deleted; wherein (i) the peptide chain X has an amino-acid sequence of at least two residues, (ii) the peptide chain X can be cleaved by a protease reaction or a chemical reaction, and (iii) a protein obtained by cleaving at least one site of the peptide chain X has HGF action.08-20-2009
20100222276 PROTEASE-SENSITIVE SITE IN APOLIPOPROTEIN A1, THERAPEUTIC AND DIAGNOSTIC IMPLICATIONS - The invention relates to the identification of a naturally occurring internal proteolytic cleavage site in the ApoA1 protein, which leads to inactivation of the mature protein. Specific modification of this cleavage site leads to a stabilised ApoA1 protein, which is beneficial for the reverse cholesterol transport. The invention therefore encompasses pharmaceutical compositions comprising a recombinant stabilised variant ApoA1 protein or rHDL particles comprising such a protein, for use in the treatment of patients having reduced HDL or hampered reverse cholesterol transport.09-02-2010
20100184652PEPTIDE INHIBITORS OF ABL KINASES - Provided are purified compounds comprising SEQ ID NO:1, where the tyrosine at residue (10) is phosphorylated. Also provided are purified compounds comprising SEQ ID NO:1, where the amino acid sequence of the compound is less than 400 amino acids. Additionally provided are methods of determining whether an agent is a candidate inhibitor of an Abl kinase. Further provided are methods of inhibiting an Abl kinase. Also provided are methods of treating a patient having a condition characterized by a mutant AbI kinase. Additionally provided are methods of treating a patient at risk for a condition characterized by a mutant AbI kinase. Methods of labeling an AbI kinase are also provided. Additionally, methods of isolating an Abl kinase from a tissue are provided.07-22-2010
20100190701GLUCAGON/GLP-1 RECEPTOR CO-AGONISTS - Modified glucagon peptides are disclosed having enhanced potency at the glucagon receptor relative to native glucagon. Further modification of the glucagon peptides by forming lactam bridges or the substitution of the terminal carboxylic acid with an amide group produces peptides exhibiting glucagon/GLP-1 receptor co-agonist activity. The solubility and stability of these high potency glucagon analogs can be further improved by modification of the polypeptides by pegylation, substitution of carboxy terminal amino acids, or the addition of a carboxy terminal peptide selected from the group consisting of SEQ ID NO: 26 (GPSSGAPPPS), SEQ ID NO: 27 (K-RNRNNIA) and SEQ ID NO: 28 (KRNR).07-29-2010
20100222262SUBSTITUTED 1, 3-CYCLOPENTADIONE ATTENUATED ENDOTHELIAL INFLAMMATION AND ENDOTHELIAL-MONOCYTE INTERACTIONS - Compositions and methods for reducing cardiovascular risk utilizing substituted 1,3-cyclopentadione compounds are described.09-02-2010
20090286733LONG-ACTING VETERINARY POLYPEPTIDES AND METHODS OF PRODUCING AND ADMINISTERING SAME - A polypeptide and polynucleotides comprising at least two carboxy-terminal peptides (CTP) of chorionic gonadotrophin attached to a non-human peptide-of-interest are disclosed. Pharmaceutical compositions comprising the non-human polypeptides and polynucleotides of the invention and methods of using both human and non-human polypeptides and polynucleotides are also disclosed.11-19-2009
20080274963Modulation of Granulosa Cell Apoptosis - The present invention relates to a method of modulating apoptosis of a granulosa cell. The method includes one or more of the following steps: (i) modulating the concentration and/or activity of BMP-15 and/or BMP-6 that the granulosa cell is exposed to; (ii) modulating activity of a BMP-15 dependent signalling pathway in the granulosa cell; and (iii) modulating activity of a BMP-6 dependent signalling pathway in a granulosa cell.11-06-2008
20090163406COMPOSITIONS AND METHODS FOR DIAGNOSING AND TREATING BRAIN CANCER AND IDENTIFYING NEURAL STEM CELLS - In one aspect, the invention provides composition and methods for the diagnosis, prognosis and treatment of tumors and cancers, e.g., brain cancers. In one aspect, the invention provides compositions and methods for inhibiting the growth, proliferation, differentiation and/or survival of a neural stem cell or a cancer cell, or progenitor stem cell thereof. In one aspect, the invention provides compositions and methods for identifying the genetic profile of a brain cancer cell or a self-renewing neural cancer stem cell. In one aspect, the invention provides methods employing these profiles to identify compounds that inhibit tumor growth.06-25-2009
20090181884Novel apolipoprotein gene involved in lipid metabolism - Methods and materials for studying the effects of a newly identified human gene, APOAV, and the corresponding mouse gene apoAV. The sequences of the genes are given, and transgenic animals which either contain the gene or have the endogenous gene knocked out are described. In addition, single nucleotide polymorphisms (SNPs) in the gene are described and characterized. It is demonstrated that certain SNPs are associated with diseases involving lipids and triglycerides and other metabolic diseases. These SNPs may be used alone or with SNPs from other genes to study individual risk factors. Methods for intervention in lipid diseases, including the screening of drugs to treat lipid-related or diabetic diseases are also disclosed.07-16-2009
20090176706MATERIALS AND METHODS FOR TREATMENT OF INFLAMMATORY AND CELL PROLIFERATION DISORDERS - The present invention pertains to methods for treatment of inflammatory and cell proliferation disorders, such as cancer, by administering an agent that reduces atrial natriuretic peptide receptor-A (NPR-A) activity. In one aspect, the invention concerns a method for treatment of inflammatory and cell proliferation disorders, such as cancer, by administration of an effective amount of natriuretic hormone peptide (NP), or a polynucleotide encoding NP and an operably-linked promoter sequence. In another aspect, the present invention includes a pharmaceutical composition comprising an agent that reduces the activity of atrial natriuretic peptide receptor-A (NPR-A), and an anti-cancer agent. In another aspect, the present invention further concerns a method for identifying an agent useful for treating an inflammatory or cell proliferation disorder, comprising determining whether the agent reduces the activity of atrial natriuretic peptide receptor-A (NPR-A).07-09-2009
20100035819METHOD OF PROMOTING SKIN COLLAGEN PRODUCTION - It is intended to provide a skin collagen production promoter, foods and drinks for promoting skin collagen production and cosmetics for promoting skin collagen production which are useful in preventing skin chapping, wrinkles, worsening in skin fitness, etc. Namely, a skin collagen production promoter, foods and drinks for promoting skin collagen production and cosmetics for promoting skin collagen production which contain as the active ingredient(s) a milk-origin basic protein fraction and/or a basic peptide fraction obtained by digesting the above-described basic protein fraction with a protein digesting enzyme such as pepsin or pancreatin. The above basic protein fraction and basic peptide fraction have an effect of increasing skin collagen level.02-11-2010
20100035815SKIN WOUND HEALING COMPOSITIONS AND METHODS OF USE THEREOF - A wound healing composition comprising an amount of heat shock protein effective to promote wound healing and a method thereof to apply the composition. A preferred heat shock protein is either full-length hsp90α or the middle domain plus the charged sequence of hsp90α. The composition is topically applied to skin wounds, covering the outer surface of the wound. The heat shock protein acts by promoting migration of both human epidermal keratinocyte and dermal fibroblasts to the wound in order to close, heal, and remodel the wound.02-11-2010
20100035813RECOMBINANT E-SELECTIN MADE IN INSECT CELLS - The inventive features include recombinant mammalian E-selectin peptides, nucleic acids encoding said peptides, vectors and cells having these nucleic acids, and methods of making the peptides. Further inventive features include methods of treating diseases and conditions associated with inflammation using recombinant mammalian E-selectin peptides to induce mucosal tolerance to E-selectin.02-11-2010
20100035812Modified Bovine G-CSF Polypeptides And Their Uses - Modified bovine G-CSF polypeptides and uses thereof are provided.02-11-2010
20100035802PARTICULAR SHORT-CHAIN PEPTIDE CANCER DRUG AND ITS TREATMENT - The invention relates to a particular short-chain peptide cancer drug and its treatment. The cancer drug includes a short-chain peptide composed of amino acids interlinked in a unique sequence. The treatment is based on a cancer angiogenesis targeted therapy model, proceeded by an arterial injection of the short-chain peptide cancer drug, so that the short-chain peptide can enter and be amassed in cavities of new blood vessels of cancerous tissues, further inducing apoptosis of cancer cells to death.02-11-2010
20100035810ADIPONECTIN PRODUCTION ENHANCER - The present invention relates to an adiponectin production enhancer comprising sericin as an active ingredient, and to a pharmaceutical composition and food and drink comprising sericin. These are effective in the prevention and/or amelioration of various diseases caused by reduction of blood adiponectin level such as arteriosclerosis, fatty liver and diabetes associated with obesity. The enhancer, the pharmaceutical composition and the food and drink according to the invention have excellent adiponectin production enhancing effects as well as high safety and are expected to be broadly applied to a variety of pharmaceutical preparations and food and drink.02-11-2010
20100035807COMPOSITION AND METHOD FOR TREATMENT OF TUMORS - The present invention relates to a composition which is useful in the treatment of a tumor, a method for making such a composition, and a method for using such a composition. The invention relates also to a method for assaying for inhibitors of the activity of Core 1 protein and/or other proteins of the respiratory complex III of mitochondria.02-11-2010
20100035805NON-AQUEOUS LIQUID FORMULATION FOR NASAL OR BUCCAL ADMINISTRATION - A formulation for administration to a nasal or buccal cavity of a subject which comprises a non-aqueous liquid environment, preferably an emollient oil base, and at least one active molecule, preferably a dopamine agonist and especially apomorphine, in solution or suspension therein, wherein in one embodiment the formulation has such a viscosity as to be delivered as a liquid jet from a spray pump which is capable of delivering an aerosol spray of an aqueous formulation.02-11-2010
20100035803Polypeptides and Polynucleotides Encoding the same - Provided herein are lactation-associated polypeptides and polynucleotides, expression vectors a host cells for expressing lactation-associated polypeptides and polynucleotides, and methods of producing said polypeptides and polynucleotides.02-11-2010
20100035808Methods and compositions for promoting organ development - Compositions and methods are provided for promoting organ development in warm blooded animals, and in particular in certain aspects a premature infant or fetus. Compositions and methods are also provided for the administration of at least one colony stimulating factor-1 protein (CSF-1), precursor, variant, analogue, derivative thereof, or combinations thereof, or otherwise, at least one nucleic acid molecule encoding colony stimulating factor-1 protein (CSF-1), precursor, variant, analogue, derivative thereof, or combinations thereof.02-11-2010
20090275512COMPOSITIONS AND METHODS FOR TREATING CARDIOVASCULAR DISEASE AND MYOCARDIAL INFARCTION WITH DIPEPTIDYL PEPTIDASE INHIBITORS OR B TYPE NATRIURETIC PEPTIDE ANALOGUES RESISTANT TO PROLYL-SPECIFIC DIPEPTIDYL DEGRADATION - The present invention describes compositions and methods for treating cardiovascular disease and myocardial infarction using dipeptidyl peptidase inhibitors. Also provided are methods for increasing natriuretic peptide function by administering one or more analogues of B type natriuretic peptide that provide increased stability in the presence of prolyl-specific dipeptidyl peptide.11-05-2009
20090318355COMPOSITIONS AND METHODS FOR PROMOTING TISSUE REPAIR AND WOUND HEALING - A method is described for using the Ea4-peptide of pro-IGF-I or human Eb-peptide of pro-IGF-I for enhancing the proliferation of fibroblasts and closure of wound. The peptide species can be homologous of trout Ea4-peptide, human Eb-peptide of pro-IGF-I or a fusion protein comprising the Ea4- or Eb-peptide of pro-IGF-I. It can be administered any wound in a pharmaceutically acceptable composition alone or in combination with other compounds.12-24-2009
20090221499Lipidating Sequences and Use thereof for Producing Lipidated Proteins in E. Coli - Production in 09-03-2009
200902755152-HYDROXY-2-PHENYLTHIOPHENYLPROPIONAMIDES AS ANDROGEN RECEPTOR MODULATORS - Compounds of structural formula (I) are modulators of the androgen receptor (AR) in a tissue selective manner. These compounds are useful in the enhancement of weakened muscle tone and the treatment of conditions caused by androgen deficiency or which can be ameliorated by androgen administration, including osteoporosis, osteopenia, glucocorticoid-induced osteoporosis, periodontal disease, bone fracture, bone damage following bone reconstructive surgery, sarcopenia, frailty, aging skin, male hypogonadism, postmenopausal symptoms in women, atherosclerosis, hypercholesterolemia, hyperlipidemia, obesity, aplastic anemia and other hematopoietic disorders, inflammatory arthritis and joint repair, HFV-wasting, prostate cancer, benign prostatic hyperplasia (BPH), abdominal adiposity, metabolic syndrome, type II diabetes, cancer cachexia, Alzheimer's disease, muscular dystrophies, cognitive decline, sexual dysfunction, sleep apnea, depression, premature ovarian failure, and autoimmune disease, alone or in combination with other active agents.11-05-2009
20090275507CONTRACEPTIVE COMPOSITION - The present invention relates to a contraceptive composition including an effective amount of a dendrimer compound including one or more naphthyl disulphonic acid surface groups, or a pharmaceutically acceptable salt or solvate of the dendrimer compound; and a pharmaceutically acceptable carrier, excipient and/or diluent therefor. The contraceptive composition may also exhibit antimicrobial activity. The invention also relates to a method of selectively reducing or preventing conception in a female animal, including a human, which method includes administering to the animal an effective amount of a contraceptive composition which composition includes an effective amount of a dendrimer compound including one or more naphthyl disulphonic acid surface groups, or a pharmaceutically acceptable salt or solvate of the dendrimer compound; and a pharmaceutically acceptable carrier, excipient and/or diluent therefor.11-05-2009
20090099087Human kunitz-type inhibitor with enhanced antifibrinolytic activity - A human Kunitz-type inhibitor polypeptide with enhanced antifibrinolytic activity, methods of making, and methods of use. The novel polypeptide is structurally similar to the KD1 domain of human tissue factor pathway inhibitor-2 (TFPI-2). In another aspect, methods of treating a subject afflicted with cancer or a precancerous condition are described. Generally, the method includes administering to a subject in need of treatment an effective amount of a polypeptide. In some embodiments, the polypeptide comprises a KD1 domain of human TFPI-2. In some embodiments, the polypeptide comprises human TFPI-2, itself. In certain embodiments, the polypeptide is administered in an amount effective to induce apoptosis in tumor cells.04-16-2009
20090099085Amylin Derivatives - The present invention relates to novel amylin derivatives having a protracted action profile, to pharmaceutical compositions comprising these derivatives and to the use of the derivatives for the treatment of diseases related to obesity, diabetes and other metabolic disorders.04-16-2009
20090099084Treatment - The invention provides use of a TSG-6 polypeptide, or a polynucleotide encoding an TSG-6 polypeptide, in the manufacture of a medicament for the treatment or prevention of a bone disease or condition associated with bone resorption by osteoclasts.04-16-2009
20090099070METHODS AND COMPOSITIONS FOR PREVENTING AND TREATING MALE ERECTILE DYSFUNCTION AND FEMALE SEXUAL AROUSAL DISORDER - The invention provides a method for preventing or treating male erectile dysfunction or female sexual arousal disorder by administering an effective amount of one or more factors from a group of factors including vascular endothelial growth factor, brain-derived neurotrophic factor, basic fibroblast growth factor, neurotrophin-3, neurotrophin-4, or angiopoietin-1, wherein the factor is a full length protein or a nucleic acid encoding the factor, or a functional derivative or fragment thereof, or an agent that enhances production and/or male erection or female sexual arousal stimulating function of the factor(s). Combinations, kits, and combinatorial methods are also provided.04-16-2009
20090099082PRODUCTION OF POLYURETHANE FOAMS - The invention relates to a process for producing polyurethane foams, by frothing and drying mixtures of specific polyurethane dispersions and crosslinkers.04-16-2009
20090099089METHODS AND COMPOSITIONS FOR HEALING AND REPAIR OF ARTICULAR CARTILAGE - Methods and compositions are provided for the treatment of articular cartilage defects and disease involving the combination of tissue, such as osteochondral grafts, with active growth factor. The active growth factor is preferably a composition containing at least one bone morphogenetic protein and a suitable carrier. The method results in the regeneration of functional repair of articular cartilage tissue.04-16-2009
20090099072Motif of the Beclin Protein Which Interacts with Anti-Apoptotic Members of the Bcl-2 Protein Family, and Uses - The invention relates to a method of identifying modulators of programmed cell death, comprising an interaction between a motif of Beclin protein and an anti-apoptotic member of the family of Bcl-2 proteins and the detection of said interaction be means of fluorescence polarisation. The modulators identified on the basis of said method are administered to cancer patients in order to induce apoptotic- and/or autophagic-type programmed cell death. The invention also relates to a motif of the Beclin protein which can interact with an anti-apoptic member of the family of Bcl-2 proteins and to the use thereof in order to induce programmed cell death in a cancer patient.04-16-2009
20090099074MODULATING FOOD INTAKE - The present disclosure relates to a conjugate comprising a PYY peptide or a functional derivative thereof which is coupled to a reactive group. Such a reactive group reacts with albumin so as to form a stable covalent bond therewith. The disclosure further provides methods of reducing water or food intake and reducing food intake between meals by administering such conjugates.04-16-2009
20090099081SYNTHETIC AXMI-004 DELTA-ENDOTOXIN GENES AND METHODS FOR THEIR USE - Compositions and methods for conferring pesticidal activity to bacteria, plants, plant cells, tissues and seeds are provided. Compositions comprising a coding sequence for a delta-endotoxin polypeptide are provided, particularly synthetically-derived coding sequences. The coding sequences can be used in DNA constructs or expression cassettes for transformation and expression in plants and bacteria. Compositions also comprise transformed bacteria, plants, plant cells, tissues, and seeds. In particular, isolated delta-endotoxin nucleic acid molecules are provided. Additionally, amino acid sequences corresponding to the polynucleotides are encompassed, and antibodies specifically binding to those amino acid sequences. In particular, the present invention provides for isolated nucleic acid molecules comprising nucleotide sequences encoding the amino acid sequence shown in SEQ ID NO:9, 11, 13, 15, or 18, or the nucleotide sequence set forth in SEQ ID NO:1, 2, 4, 6, 7, 8, 10, 12, 14, 16, or 17, as well as variants and fragments thereof.04-16-2009
20090099071SUGAR CHAIN-CONTAINING ALBUMIN, PRODUCTION METHOD THEREOF AND USE THEREOF - Glycosylated albumin as a drug carrier for a DDS targeting the liver (particularly kupffer's cell) can be provided by mutating a DNA encoding albumin to encode a mutant albumin containing a partial amino acid sequence permitting glycosylation modification by eukaryotic cell, preferably a consensus sequence of N-linked sugar chain, introducing an expression vector containing the mutant DNA into a host eukaryotic cell, preferably a host cell permitting addition of a high-mannose type sugar chain, culturing the obtained transformant, and recovering a glycosylated albumin protein from the obtained culture.04-16-2009
20090203606Systems for and Methods of use of Therapeutic Nutrition for the Management of Age-Associated and Age-Specific Health Conditions of the Elderly - Nutritional compositions which provide for improved taste profiles for the elderly while simultaneously providing nutrition specific to assist in the management of nutritional deficiencies that lead to age specific and age associated health conditions in the elderly. There are also provided products using these compositions and incorporating packaging design, volume delivery, and sensory attributes to improve nutritional regimen compliance in the elderly.08-13-2009
20090227506USE OF DEFENSINS AGAINST TUBERCULOSIS - The present invention relates to a method for killing or inhibiting cells of the genus 09-10-2009
20090221475Treatment of lung disorders - The invention features methods of treating a subject having a lung disorder such as lung inflammation and injury, by administering antithrombin III by inhalation. 09-03-2009
20090075892Synthetic pulmonary surfactant peptides - The present invention is directed to a reconstituted surfactant comprising a lipid carrier, a polypeptide analog of the native surfactant protein SP-C, and a polypeptide analog of the native surfactant protein SP-B. The invention is also directed to the pharmaceutical compositions thereof and to a use thereof in the treatment or prophylaxis of RDS and other respiratory disorders.03-19-2009
20090118175Compositions and Methods for Detection, Prognosis and Treatment of Breast Cancer - The present invention relates to methods of detection, prognosis and treatment of breast cancer using a plurality genes or gene products present in normal and neoplastic cells, tissues and bodily fluids. Gene products relate to compositions comprising the nucleic acids, polypeptides, antibodies, post translational modifications (PTMs), variants, derivatives, agonists and antagonists of the invention and methods for the use of these compositions. Additional uses include identifying, monitoring, staging, imaging and treating cancer and non-cancerous disease states in breast as well as determining the effectiveness of therapies alone or in combination for an individual. Therapies include gene therapy, therapeutic molecules including but not limited to antibodies, small molecules and antisense molecules.05-07-2009
20090209462REGULATION OF FUNCTION OF ANGIOPOIETIN - Pharmaceutical compositions that comprise a pharmaceutically acceptable carrier and either a therapeutically effective amount of an ECM-binding fragment of Ang-1 protein at comprises SEQ ID NO:1 and/or SEQ ID NO:2 or a homologous peptide thereof and pharmaceutical compositions that comprise a pharmaceutically acceptable carrier and a vector comprising a nucleic acid molecule that comprises the nucleotide sequence that encodes an ECM-binding fragment of Ang-1 protein that comprises SEQ ID NO:1 and/or SEQ ID NO:2 or a homologous peptide thereof are disclosed. Methods of using such compositions to treat individuals suspected of having coronary artery disease, vascular disease or a condition involving ischemia and to promote angiogenesis, endothelial survival and maintaining vascular integrity are disclosed. Methods to identify compounds that modulates binding of Ang-1 to ECM are disclosed. Pharmaceutical compositions which comprise a therapeutically effective amount of Ang-2 protein and/or a vector comprising a nucleic acid molecule that comprises the nucleotide coding sequence of Ang-2 and methods of using such compositions to treat individuals suspected of having cancer are disclosed.08-20-2009
20100113356CONTROL OF GROWTH AND REPAIR OF GASTRO-INTESTINAL TISSUES BY GASTROKINES AND INHIBITORS - A novel group of gastrokines called Gastric Antrum Mucosal Protein is characterized. A member of the group is designated AMP-18. AMP-18 genomic DNA, cDNA and the AMP-18 protein are sequenced for human, mouse and pig. The AMP-18 protein and active peptides derived from it are cellular growth factors. Surprisingly, peptides capable of inhibiting the effects of the complete protein, are also derived from the AMP-18 protein. Cytoprotection and control of mammalian gastro-intestinal tissue growth and repair (restitution) is facilitated by the use of the proteins, making the proteins candidates for therapies in inflammatory bowel disease, mucositis, and gastric ulcers.05-06-2010
20090203593Immunogenic Constructs - The present invention relates to molecules, which can be used to induce a therapeutic or prophylactic immune response against MAP. In particular, the present invention relates to polypeptides comprising an alipC polypeptide sequence, a gsd polypeptide sequence, a p12 polypeptide sequence and an mpa polypeptide sequence, wherein said ahpC polypeptide comprises the sequence of SEQ ID NO: 2, a variant thereof having more than 70% amino acid sequence identity to SEQ ID NO: 2 across the full length of SEQ ID NO: 2, or a fragment of at least 8 amino acids of SEQ ID NO: 2 which comprises an epitope; said gsd polypeptide comprises the sequence of SEQ ID NO: 6, a variant thereof having more than 70% amino acid sequence identity to SEQ ID NO: 6 across the full length of SEQ ID NO: 6, or a fragment of at least 8 amino acids of SEQ ID NO: 6 which comprises an epitope; said pi 2 polypeptide comprises the sequence of SEQ ID NO: 10, a variant thereof having more than 70% amino acid sequence identity to SEQ ID NO: 10 across the full length of SEQ ID NO: 10, or a fragment of at least 8 amino acids of SEQ ID NO: 10 which comprises an epitope; and said mpa polypeptide comprises the sequence of SEQ ID NO: 14, a variant thereof having more than 70% amino acid sequence identity to SEQ ID NO: 14 across the full length of SEQ ID NO: 14, or a fragment of at least 8 amino acids of SEQ ID NO: 14 which comprises an epitope. Preferably such a variant maintains the ability to generate an immune response against the unmodified polypeptide.08-13-2009
20090137463Treatment for Neurodegeneration - Polypeptides which are an N- and/or C-terminally truncated fragment of the human osteopontin (hOPN) sequence or species variant, and which minimally have a 15 amino acid sequence corresponding to amino acids 138 to 152 of hOPN, and polynucleotides encoding said polypeptide, are useful for treatment or prevention of neurodegeneration.05-28-2009
20090170760Anti-Cancer Agent Comprising Protein C Inhibitor - The present invention provides anti-cancer agents comprising protein C inhibitor (PCI) or derivatives thereof as an active ingredient. The anti-cancer agents of the present invention have activities of suppressing cancer cell growth, and cancer metastasis, infiltration, and angiogenesis. Further, the present invention has shown that derivatives containing a heparin-binding domain of PCI inhibit the growth, metastasis and angiogenesis of cancer cells. Therefore, according to the present invention, PCI or derivatives thereof are useful for inhibiting the growth, metastasis and angiogenesis of cancer.07-02-2009
20100113354THERAPEUTIC AGENT COMPRISING VASOHIBIN - A therapeutic agent containing Vasohibin for diabetic nephropathy, and a therapeutic agent containing Vasohibin for peritoneal sclerosis. Since the therapeutic agent containing Vasohibin of the present invention is a substance in which Vasohibin inhibits angiogenesis in an autocrine manner, the therapeutic agent is effective for inhibiting the progression of diabetic nephropathy and peritoneal sclerosis in which the inhibition in the angiogenesis or the production of cytokine is important, so that the therapeutic agent is suitably used in, for example, the treatment of a disease requiring an action for inhibiting the progression of diabetic nephropathy, and a disease requiring an inhibitory action for peritoneal sclerosis, or the like.05-06-2010
20090318341Methods of using OSK1 peptide analogs - Disclosed is a composition of matter comprising an OSK1 peptide analog, and in some embodiments, a pharmaceutically acceptable salt thereof. A pharmaceutical composition comprises the composition and a pharmaceutically acceptable carrier. Also disclosed are DNAs encoding the inventive composition of matter, an expression vector comprising the DNA, and host cells comprising the expression vector. Methods of treating an autoimmune disorder and of preventing or mitigating a relapse of a symptom of multiple sclerosis are also disclosed.12-24-2009
20100113365FACTOR VIII POLYMER CONJUGATES - The invention is a proteinaceous construct comprising a Factor VIII molecule which is conjugated to a water-soluble polymer via carbohydrate moieties of Factor VIII, and methods of preparing same.05-06-2010
20100081614LONG-ACTING GROWTH HORMONE AND METHODS OF PRODUCING SAME - A polypeptide and polynucleotides encoding same comprising one carboxy-terminal peptide (CTP) of chorionic gonadotrophin attached to an amino terminus of a growth hormone and two carboxy-terminal peptides (CTP) of chorionic gonadotrophin attached to a carboxy terminus of a growth hormone are disclosed. Pharmaceutical compositions comprising the polypeptide and polynucleotides of the invention and methods of using same are also disclosed.04-01-2010
20100113349EXTRACELLULAR MATRIX-BINDING PROTEINS FROM STAPHYLOCOCCUS AUREUS - An isolated extracellular matrix-binding protein, designated as SdrE and its corresponding amino acid and nucleic acid sequences and motifs are described. The proteins, peptides, fragments thereof or antigenic portions thereof are useful for the prevention, inhibition, treatment and diagnosis of 05-06-2010
20100113352RETINOL FORMULATIONS AND METHODS FOR THEIR USE - A composition for the treatment of skin comprises a non-emulsified, aqueous suspension of retinol. The composition may further include at least one protein species, and some proteins used in the composition include collagen and elastin. The composition may also include hyaluronic acid. The composition may also include one or more of tocopheryl acetate, propylene glycol, and linseed extract. Also disclosed are methods for making the composition and use of the composition for the treatment of skin.05-06-2010
20100113362METHODS FOR INHIBITING IMMUNE COMPLEX FORMATION IN A SUBJECT - Polypeptides and other compounds that can bind specifically to the C05-06-2010
20080280823Treatment of Non-Alcoholic Steatotic Hepatitis (Nash) - The present invention relates to a method for treating nonalcoholic steatotic hepatitis (NASH) in a subject by administering an effective amount of a lipoprotein lipase (LPL) therapeutic to the subject. The LPL therapeutic is advantageously a S447X protein or a derivative or variant thereof, or a nucleic acid encoding such a protein. The LPL therapeutic may be used in a gene therapy vector.11-13-2008
20090149385NEUREGULINS FOR PREVENTION AND TREATMENT OF DAMAGE FROM ACUTE ASSAULT ON VASCULAR AND NEURONAL TISSUE AND AS REGULATORS OF NEURONAL STEM CELL MIGRATION - Neuregulin, a known neuroprotein, has been found to ameliorate or prevent damage caused by mechanical or chemical assault to blood vessels and, when administered into the cerebral spinal fluid, can ameliorate damage to neuronal tissue caused by stroke or inflammation. Additionally, neuregulin has been found to be useful for enhancement of stem cell migration from the ventricle to the site of injury to the brain.06-11-2009
20090143287TISSUE REGENERATION SUBSTRATE - The present invention provides a tissue regeneration substrate that has the ability to release a basic fibroblast growth factor (bFGF) and like cell growth factors in a sustained manner, into which cells can easily enter, and that is suitably used for regeneration of tissues. Specifically, the present invention provides a tissue regeneration substrate that comprises a cell growth factor adsorbed in a bioabsorbable porous substrate that contains collagen and gelatin, and a method for producing the same.06-04-2009
20090143284Promoter of Regeneration of Pancreatic B Cell, and Promoter of Insulin Production in Pancreatic B Cell - A pharmaceutical for promoting neogenesis or regeneration of pancreatic β cells which produces and secretes insulin and for promoting insulin production in β cells, comprising ghrelin or a derivative thereof as an effective component.06-04-2009
20090149388DRIED BLOOD FACTOR COMPOSITION COMPRISING TREHALOSE - A method for preparing a stable dried composition of blood factor product containing a stabilizing amount of trehalose in the absence of a stabilizing amount of albumin is disclosed.06-11-2009
20090149374NEUROPEPTIDES - The present invention describes a polypeptide, comprising the amino acid sequence APAHRSSTFPKWVTKTERGRQPLRS (Seq. ID. No. 1) or a fragment thereof, said fragment comprising at least 7 consecutive amino acid residues of Seq. ID. No. 1.06-11-2009
20090149383COMPOSITIONS AND METHODS FOR FACILITATING HEME-IRON EXPORT FROM CELLS - The invention provides a high affinity heme-binding agent, which can be provided in the form of a pharmaceutical composition that includes, optionally, a pharmaceutically acceptable carrier. The heme-binding agent can be used in a method of facilitating heme-iron export from a cell. The method comprises contacting a cell with a high affinity heme-binding agent. Also provided is a method of treating a disorder associated with excess iron in cells in a subject. The method comprises administering to the subject an effective amount of the composition of the invention. The subject is typically a mammal, most typically a human or veterinary subject.06-11-2009
20090149381Methods of regulating angiogenesis through stabilization of PEDF - The invention provides methods of inhibiting angiogenesis within a tissue, promoting neuron protection within a tissue, and treating a disease in a mammal, wherein (a) a gene transfer vector encoding a protein of a serpin superfamily or a therapeutic fragment or variant thereof or (b) a protein of a serpin superfamily or a therapeutic fragment or variant thereof is administered with an inhibitor of matrix metalloprotease (MMP). Alternatively, the method comprises administration of (a) a protein of a serpin superfamily or therapeutic fragment or variant thereof or (b) a gene transfer vector encoding a protein of a serpin superfamily or a therapeutic fragment or variant thereof, wherein the protein or nucleic acid encoding the protein comprises at least one mutation which renders the protein of the serpin superfamily resistant to cleavage by an MMP.06-11-2009
20090149379NOVEL USE OF CYTOKINE INHIBITORS - The present invention relates to a method for prevention or reduction of scar tissue and/or adhesion formation wherein a therapeutically effective amount of a substance that inhibits a pro-inflammatory cytokine is administered to a patient in need of said treatment.06-11-2009
20090149375USE OF THE MST PROTEIN FOR THE TREATMENT OF A THROMBOEMBOLIC DISORDER - The present invention refers to the use of the Mst protein or a nucleotide sequence coding for the Mst protein for the treatment of a thromboembolic disorder and to a method of screening a modulator of the Mst protein or the nucleotide sequence coding for the Mst protein.06-11-2009
20090149373Use of survivin to treat kidney failure - The present invention relates generally to methods of for the prevention and treatment for renal disease. In particular, the invention relates to methods of prevention and treatment of mammals, including humans, which are at risk of developing renal failure. This is generally in the field of treatment or prevention of acute renal failure by administration of the anti-apoptotic molecule survivin. The invention also includes the treatment of kidney transplants (renal allografts) to prolong survival of the graft during cold ischemia and immediately after transplantation.06-11-2009
20090149377METHODS FOR REGULATION OF p53 TRANSLATION AND FUNCTION - The present invention relates to novel methods for modulating the activity of p53 tumor suppressor protein by affecting p53 translational regulation. More specifically, the invention relates to novel methods for modulating p53 mRNA translation in a cell by affecting a function of a p53 5′-untranslated region (5′UTR), including its interaction with proteins such as Ribosomal Protein L26 (RPL26), nucleolin, and p53. The invention also relates to the use of these methods for treating cancer, neurodegenerative disorders and minimizing the negative effects of cellular stresses.06-11-2009
20090054325Compositions and methods for suppressing axonal growth inhibition - The invention provides compositions and methods for interfering with Nogo-receptor mediated signaling and mediating axonal growth. The invention also provides methods for treating central nervous system diseases, disorders or injuries.02-26-2009
20090143290TUMOR-INHIBITING PROTEIN AND THE USE THEREOF - The invention has disclosed a new tumor suppressor protein HCRP1, the polynucleotide sequences encoding this polypeptides, and methods for production of the polypeptide using the recombinant technology. The tumor suppression protein, HCRP1, is obtained through the positional candidate cloning strategy. It locates in 8p22 region of human chromosome. The full length cDNA for HCRP1 is 1917bp, which encodes a protein of 397 amino acids. When introduced into liver cancer cells, HCRP1 can inhibit the malignant transformation of liver cancer cells.06-04-2009
20090023655Biased Ligands for Receptors Such as the PTH Receptor - Disclosed are compositions and methods for modulating the β-arrestin pathway selectively over the G protein pathway of a G protein couple receptor, such as parathyroid hormone receptor.01-22-2009
20100120690Polypeptides Having Antimicrobial Activity and Polynucleotides Encoding Same - The present invention relates to isolated polypeptides having antimicrobial activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.05-13-2010
20090005311LACTOBACILLUS ACIDOPHILUS NUCLEIC ACIDS ENCODING FRUCTO-OLIGOSACCHARIDE UTILIZATION COMPOUNDS AND USES THEREOF - Fructooligosaccharide (FOS)-related protein nucleic acid molecules and polypeptides and fragments and variants thereof are disclosed in the current invention. In addition, FOS-related fusion proteins, antigenic peptides, and anti-FOS-related antibodies are encompassed. The invention also provides recombinant expression vectors containing a nucleic acid molecule of the invention and host cells into which the expression vectors have been introduced. Methods for producing the polypeptides of the invention and methods for their use are further disclosed.01-01-2009
20090143293Peptide inhibitors of protein kinase C gamma for pain management - Peptide sequences derived from the V5 domain of isozymes of protein kinase C for use in pain management are described. Also described are compositions comprising the peptides for treating pain and/or inducing analgesia. Methods of pain treatment and methods of identifying compounds that mimic the activity of the peptides are also described.06-04-2009
20090105137RECOMBINANT BONE MORPHOGENETIC PROTEIN HETERODIMERS, COMPOSITIONS AND METHODS OF USE - The present invention relates to methods for producing recombinant heterodimeric BMP proteins useful in the field of treating bone defects, healing bone injury and in wound healing in general. The invention also relates to the recombinant heterodimers and compositions containing them.04-23-2009
20100144622METHODS FOR PRODUCTION OF RECOMBINANT PLASMINOGEN AND PLASMIN POLYPEPTIDES - Methods of producing properly refolded recombinant plasminogen and plasmin polypeptide are provided. Denatured recombinant plasminogen polypeptide is refolded by first solubilizing the polypeptide with a chaotroph and reducing and oxidizing agents at high pH, followed by refolding in the presence of reduced concentration of chaotroph and reducing and oxidizing agents and in the presence of arginine.06-10-2010
20100120687Modulating apoptosis - The use and screening of modulators of apoptosis is disclosed. The modulators may be, for example, modulator of NF-κB activity. The modulators may be used, for example, in the treatment of NF-κB-mediated diseases, conditions, and injuries.05-13-2010
20090082273Isolated human protease proteins, nucleic acid molecules encoding human protease proteins, and uses thereof - The present invention provides amino acid sequences of peptides that are encoded by genes within the human genome, the protease peptides of the present invention. The present invention specifically provides isolated peptide and nucleic acid molecules, methods of identifying orthologs and paralogs of the protease peptides, and methods of identifying modulators of the protease peptides.03-26-2009
20090082268Muteins of Placental Growth Factor Type I, Preparation Method And Application Thereof - The present invention relates to chemically stable muteins of type 1 Placental Growth Factor (PLGF-1) bearing the substitution or elimination of a cysteine residue from the wild type protein amino acid sequence, their preparation, their therapeutic and cosmetic uses, and pharmaceutical and cosmetic compositions containing said derivatives. The invention likewise relates to the production of antibodies for said derivatives and their use in the diagnosis and treatment of tumoral and non-tumoral pathologies.03-26-2009
20090082272ACTIVE PEPTIDE OF BONE MORPHOGENETIC PROTEIN-2, METHOD FOR MANUFACTURING THE SAME AND THE APPLICATION - A bone morphogenetic protein-2 active peptide is characterized in that the structure is S03-26-2009
20090082266CONJUGATE OF WATER-SOLUBLE HYALURONIC ACID MODIFICATION PRODUCT WITH GLP-A ANALOGUE - To provide a GLP-1 analogue long-acting prophylactic or therapeutic agent for diabetes, diabetic complications and/or obesity due to diabetes which provides an extended half-life of a GLP-1 analogue in the blood to prevent frequent administration, and is biodegradable and safe.03-26-2009
20090137473INHIBITION OF MICROTUBULE PROTRUSION IN CANCER CELLS - The present invention generally concerns microtubule protrusions in cancer cells, including detached cancer cells, and inhibition of the protrusions. In particular aspects, the inhibition of the protrusions interferes with attachment of the cell to a vessel wall, and in further aspects the cell is killed by forcing it to enter capillaries and be destroyed, for example by shearing. Inhibition by a variety of agents and methods is contemplated.05-28-2009
20090137472CHIMERIC MHC PROTEIN AND OLIGOMER THEREOF - The invention concerns a oligomeric MHC complex comprising at least two chimeric proteins, said chimeric proteins comprising a first section derived from an MHC peptide chain or a functional part thereof and a second section comprising an oligomerising domain derived from an oligomer-forming coiled-coil protein, wherein formation of the oligomeric MHC complex occurs by oligomerisation at the oligomerising domain of the chimeric proteins, and wherein at least two of the first sections are derived from the same MHC peptide chain. The invention also concerns a chimeric protein comprising a first section derived from an MHC peptide chain or a functional part thereof and a second section comprising an oligomerising domain derived from an oligomer-forming coiled-coil protein. The invention further concerns a method of labeling and/or detecting mammalian T cells according to the specificity of their antigen receptor, by combining an oligomeric MHC complex according to the invention and a suspension or biological sample comprising T cells, and detecting the presence of specific binding of said complex and the T cells. Finally the invention concerns primers consisting of DNA sequences for genetic engineering of the above chimeric protein.05-28-2009
20090137468CYTOTOXIC FACTORS FOR MODULATING CELL DEATH - Cytotoxic factors having use in modulating cell death, and their use in methods of treating necrosis or apoptosis-related conditions are disclosed. The invention also relates to methods for identifying active agents useful in treating conditions related to cell death. The present inventors have found that different pathogens produce different cytotoxic factor(s) having anticancer activity. The substantially pure cytotoxic factors can be used in a method of treating an infectious disease or a cancer.05-28-2009
20090137467Bipartite Inhibitors of Bacterial RNA Polymerase - The invention provides a compound having a structural formula (I): X-α-Y, wherein X is an moiety that binds to the Rif pocket of a bacterial RNA polymerase, Y is a moiety that binds to the secondary channel of a bacterial RNA polymerase, and α is a linker. The compound can act as an inhibitor of bacterial RNA polymerase. The invention has applications in control of bacterial gene expression, control of bacterial growth, antibacterial chemistry, and antibacterial therapy.05-28-2009
20090137464Therapeutic fibrin-derived peptides and uses thereof - The invention relates to peptides having the general formula (I), or a salt or amide thereof, wherein R05-28-2009
20100009911Osteogenic synergic composition - The invention relates to an osteogenic synergic composition comprising at least one osteogenic growth factor, and at least one growth factor having a chemoattractant and angiogenic capacity. It also relates to the method for the preparation thereof and to the use thereof for the preparation and production of pharmaceutical products for use in bone reconstruction and regeneration, in the form of topical compositions, for example implants, pastes or gels.01-14-2010
20090305978METHODS FOR INCREASING THE SIZE OF ANIMALS USING NEEDLELESS DELIVERY CONSTRUCTS - The present invention relates, in part, to methods for increasing the size of a subject by administering a delivery construct comprising growth hormone to a subject. In one aspect, the method for increasing the size of a subject by at least about 12% comprises contacting an apical surface of a polarized epithelial cell of the subject with an amount of a delivery construct comprising growth hormone that is effective to increase the size of the subject by at least about 12%.12-10-2009
20090082269AGENT FOR AMELIORATING HEAVY METAL-INDUCED DISORDERS, AND MEDICINAL COMPOSITION, FOOD AND COSMETIC CONTAINING THE SAME - It is intended to provide a drug for ameliorating symptoms or diseases caused by heavy metals (for example, Wilson's disease, heavy metal toxication, aging, fulminant hepatitis and so on) which has a high safety without any fear of side effect, can eliminate heavy metals such as copper ion accumulated in excess in the living body to prevent or lessen the accumulation of the heavy metals in the living body, thereby eliminating or relieving the effects of the heavy metals; and compositions such as a medicinal composition, a food and a cosmetic containing the same. The drug and compositions as described above are characterized by containing lactoferrin and/or an active derivative of the same as the active ingredient.03-26-2009
20100087374Methods for Treatment and Diagnosis of Pulmonary Diseases Based on the Expression of SERCA2 Protein - The present invention is directed to methods of treatment of cystic fibrosis. The invention includes a method for treatment of cystic fibrosis in a patient by increasing the activity of sarcoendoplasmic reticulum calcium ATPase (SERCA) in a patient. More specifically, the step of increasing SERCA activity can include but is not limited to, administration of SERCA protein or its homologues, gene therapy to restore or enhance SERCA activity, or the administration of compounds stimulating the activity of endogenous SERCA. Reference herein to SERCA, can include in preferred embodiments, the isoform SERCA2, which is the principal lung isoform of SERCA. The present invention is based on the finding that SERCA2 (a calcium pump) is deficient (not 100%) in the lung epithelial cells of cystic fibrosis samples.04-08-2010
20100087376CANCER RELATED ISOFORMS OF COMPONENTS OF TRANSCRIPTION FACTOR COMPLEXES AS BIOMARKERS AND DRUG TARGETS - The invention is related to isoforms of components of transcription factor complexes that are specifically expressed in cancer cells. These isoforms can be used as biomarkers for detection, diagnosis, prognosis and monitoring of treatments of cancer, and as drug targets of pharmaceutical compositions for the treatment of various cancers expressing the targeted isoforms. Methods, molecules, materials and kits for these uses are disclosed.04-08-2010
20090203612XENORHABDUS TC PROTEINS AND GENES FOR PEST CONTROL - The subject invention relates to novel 08-13-2009
20090312261Antifungal Paints and Coatings - Antifungal and antibacterial peptides, polypeptides and proteins as antifungal additives for paint and other coatings are disclosed, along with antifungal compositions, and coated surfaces with antifungal properties. Methods of using the coatings for treating and/or inhibiting growth of mold, mildew and other fungi and bacteria on objects such as building materials that are susceptible to such infestation are also disclosed.12-17-2009
20090298761Methods of treating cartilage defects using a soluble morphogenic protein complex - The present invention provides methods of repairing and regenerating cartilage tissue using a soluble morphogenic protein complex comprising (a) a morphogenic protein; and (b) a morphogenic protein pro region isolated from a morphogenic protein, or a conservative substitution variant or a fragment of said pro region, wherein said pro region or variant or fragment is noncovalently linked to the morphogenic protein, and wherein said complex is more soluble in an aqueous solvent than said morphogenic protein alone.12-03-2009
20100120693MEDICAMENT FOR IMPROVING PROGNOSTIC SURVIVAL IN THERAPY OF MALIGNANT TUMOR - A medicament for improving prognostic survival in therapy of malignant tumor is provided that may improve prognostic survival in DIC patients where the basal disease is malignant tumor, especially malignant tumor in hematopoietic organs. The medicament according to the invention comprises as a main active ingredient Activated Protein C, which is obtained from plasma or prepared by using the genetic recombination technique, and efficiently prolongs life-span of DIC patients where the basal disease is malignant tumor, especially malignant tumor in hematopoietic organs. In particular, the medicament may reduce adverse side effects of chemotherapeutics in chemotherapy of malignant tumor to enhance efficacy of said therapy and improve prognostic survival of patients suffering from malignant tumor.05-13-2010
20100120683Prame derived peptides and immunogenic compositions comprising these - The invention relates to a peptide having a length of no more than 100 amino acids and comprising at least 19 contiguous amino acids from the amino acid sequence of the human PRAME protein, wherein the peptide comprises at least one HLA class II epitope and at least one HLA class I epitope from the amino acid sequence of the human PRAME protein and to its use as such or in a composition as a medicament for the treatment and/or prevention of cancer.05-13-2010
20100120677ACTIVITY OF RECOMBINANT EQUINE FOLLICLE STIMULATING HORMONE - The present invention provides methods of producing biologically active recombinant eFSH analogs and methods of increasing reproduction in mammals, particularly equine, using recombinant eFSH analogs. Also provided are methods of producing biologically active single chain recombinant eFSH. The recombinant eFSH analogs of the present invention increase superovulation, follicular development, embryo development, and reproductive efficiency in horses, cattle and other ungulates.05-13-2010
20100120684MUTANTS OF INTERLEUKIN- 1 RECEPTOR ANTAGONIST AND USES THEREOF - The invention provides an isolated polypeptide comprising a variant amino acid sequence of SEQ ID NO: 1, or a fusion or derivative of said polypeptide, or a fusion of a said derivative thereof, wherein the polypeptide, fusion or derivative retains a biological activity of wild type IL-IRa. In one embodiment, the isolated polypeptide, fusion or derivative is or comprises a polypeptide variant of amino acid sequence SEQ ID NO: 1 comprising or consisting of substitutions at one or more of the following amino acid mutations of SEQ ID NO: 1: Q29K, P38Y, P38R, L42W, D47N, E52R, H54R, E90Y, Q129L, Q129N, M136N, M136D and Q149K. Also provided are pharmaceutical compositions of the above polypeptide, fusion or derivative, as well as uses of the same for treating a disease or condition capable of being treated by an agent which inhibits the function of IL-1 receptors.05-13-2010
20100120676COMPOSITION TO TREAT AND/OR PREVENT GASTROINTESTINAL INFECTION - The invention relates to a composition for the treatment and/or prevention of infection by gastrointestinal pathogens, in particular 05-13-2010
20100120674INSULIN RESISTANCE IMPROVING AGENTS - The invention provides an insulin resistance improving agent and a therapeutic agent for type 2 diabetes, which contain a C-terminal globular domain of adiponectin, adiponectin, or a gene for the domain or adiponectin. The invention also provides a method for improving insulin resistance and treating type 2 diabetes by administering the aforementioned agent(s).05-13-2010
20090054316AGENT FOR CONTROL OF FUNCTION OF ANTIGEN-PRESENTING CELL - The present invention provides an agent capable of controlling the function of antigen-presenting cell. The present invention provides an agent for controlling the function of antigen-presenting cell, comprising a substance capable of controlling an intracellular zinc ion concentration, particularly, a zinc ion, a zinc ion chelator, a substance for regulating the expression and/or function of a zinc ion-requiring protein, or a substance for regulating the expression and/or function of a zinc ion transporter, as an active ingredient.02-26-2009
20090054314Combined use of DPP-IV inhibitors and gastrin compounds - The invention relates to compositions, conjugates, and methods for the prevention and/or treatment of a condition and/or disease comprising a therapeutically effective amount of a DPP-IV inhibitor and a gastrin compound. The combination of a DPP-IV inhibitor and a gastrin compound provides beneficial effects, in particular sustained beneficial effects, in the prevention and/or treatment of conditions and/or diseases for which either a DPP-IV inhibitor or a gastrin compound have been demonstrated to have a therapeutic effect, including but not limited to diabetes, hypertension, chronic heart failure, fluid retentive states, obesity, metabolic syndrome and related diseases and disorders. Combinations of a DPP-IV inhibitor and a gastrin compound can be selected to provide unexpectedly additive effects or synergistic effects.02-26-2009
20080269130Methods and compositions for treating hypoglycemic disorders - This invention relates to methods of treating and ameliorating congenital and neonatal hyperinsulinism and post-prandial hypoglycemia, comprising the step of administering an antagonist of the Glucagon-Like Peptide-1 (GLP-1) receptor, e.g. a GLP-1 fragment or analogue thereof.10-30-2008
20080269129POLYPEPTIDE AND DNA THEREOF USEFUL AS A NEOVASCULAR MARKER - A marker for neovascularization, vascular disease, inflammatory disease, entoptic neovascular disease, reproductive system disease, central nervous system disease and cancer, the method of detection of the marker and a diagnosis kit of the diseases are provided. Additionally, therapeutic agents of the diseases are provided.10-30-2008
20090082267Prevention and Reduction of Blood Loss - Methods are described for preventing or reducing ischemia and/or systemic inflammatory response in a patient such as perioperative blood loss and/or systemic inflammatory response in a patient subjected to cardiothoracic surgery, e.g. coronary artery bypass grafting and other surgical procedures, especially when such procedures involve extra-corporeal circulation, such as cardiopulmonary bypass.03-26-2009
20090082263DRUG AND METHOD FOR IMPROVING BRAIN FUNCTION - It is intended to provide a novel remedy for improving the brain function or preventing the same from worsening and a novel administration method for the remedy. Namely, a composition for preventing the brain function from worsening or improving the brain function which contains a cell growth factor. It is preferred that this cell growth factor is one selected from the group consisting of vascular endothelial growth factors (VEGFs), fibroblast growth factors (FGFs) and hepatocyte growth factors (HGFs). A method for preventing the brain function from worsening or improving the brain function which comprises the step of administering a cell growth factor to a patient.03-26-2009
20090286725PEPTIDES AND DERIVATIVES THEREOF, THE MANUFACTURING THEREOF AS WELL AS THEIR USE FOR PREPARING A THERAPEUTICALLY AND/OR PREVENTIVELY ACTIVE PHARMACEUTICAL COMPOSITION - Peptides and peptide derivatives of the following general Formula I:11-19-2009
20100087373DETECTION AND THERAPY OF BACTERIAL INFECTION CAUSED BY ENTEROBACTERIACEAE - The present invention provides a method for the treatment and/or prevention of bacterial infection caused by Enterobacteriaceae bacteria in central nervous system and/or peripheral blood circulation in a mammal by administering effective amount of outer membrane protein A (OmpA) or its derivatives to a mammal. Also provided are a method for vaccinating a mammal to produce an antibody against bacterial infection caused by Enterobacteriaceae family in central nervous system and/or peripheral blood circulation and a method of detecting or diagnosing bacterial infections caused by Enterobacteriaceae family in central nervous system and/or peripheral blood circulation in a mammal. An antibody and a kit on the basis of the vaccinating method and detecting/diagnosing method are also provided.04-08-2010
20100087368TREATING ACUTE RENAL FAILURE WITH SOLUBLE THROMBOMODULIN VARIANTS - The present invention provides a method for preventing and/or treating subjects with acute renal failure caused by a variety of conditions. The method comprises administering to the subject soluble thrombomodulin which does not activate Protein C. In conjunction with standard of care, soluble thrombomodulin that does not activate Protein C will prevent or reduce acute kidney injury and subsequent morbidity and mortality.04-08-2010
20100099621DISODIUM SALTS, MONOHYDRATES, AND ETHANOL SOLVATES FOR DELIVERING ACTIVE AGENTS - The inventors have discovered that the disodium salt of certain delivery agents has surprisingly greater efficacy for delivering active agents than the corresponding monosodium salt. Furthermore, the inventors have discovered that the disodium salts of these delivery agents form solvates with ethanol and hydrates with water. The delivery agents have the formula04-22-2010
20100099618Interleukin-9 and Interleukin-4 Chimeric Antagonist Muteins and Methods of Using Same - Chimeric polypeptide antagonists that include an interleukin-4 (IL-4) mutein linked to an interleukin-9 (IL-9) mutein are provided, as are polynucleotides encoding the IL-4 and IL-9 chimeric mutein antagonists. Also provided are methods of using the chimeric mutein antagonists and encoding polypeptides to reduce or inhibit the responsiveness of a cell to a cytokine such as IL-4, IL-9 and/or interleukin-13. Methods using the compositions to treat disorders such as pulmonary disorders (e.g., asthma) also are provided.04-22-2010
20090062193COMPOSITIONS AND METHODS FOR THE CONTROL, PREVENTION AND TREATMENT OF OBESITY AND EATING DISORDERS - Compositions and methods for preventing, treating or controlling conditions or disorders associated with obesity, diet, and nutrition are provided. The methods provided generally involve the administration of an amylin or an amylin agonist to a subject in order to prevent, treat or controlling conditions or disorders associated with obesity, diet, and nutrition.03-05-2009
20090054322Polypeptides and compositions comprising same and methods of using same for treating cxcr4 associated medical conditions - An isolated polynucleotide is provided, comprising a nucleic acid sequence encoding a soluble polypeptide which comprises an amino acid sequence of an N-terminus domain of CXCR4 and devoid of a CXCR4 extracellular domain selected from the group consisting of ECL1, ECL2 and ECL3, the soluble polypeptide being capable of binding SDF-1. Also provided are methods of using such a nucleic acid sequence such as for the treatment of cancer.02-26-2009
20100081622Reduction of parathyroid hormone levels - A method of acutely reducing the plasma level of PTH of a patient having an elevated PTH comprising the administration of a pharmaceutical composition comprising a GLP-2, or a variant, an analogue, or derivative of GLP-2 having the ability to bind and activate a GLP-2 receptor such as GLP-2 1-34.04-01-2010
20100081612POLYPEPTIDE DERIVATIVES OF PARATHYROID HORMONE (PTH) - The present invention is related to novel parathyroid hormone polypeptide derivatives, and to pharmaceutical composition containing the polypeptides, as well as synthetic and recombinant methods for producing the polypeptides. Also disclosed are methods for treating mammalian conditions characterized by decreases in bone mass using therapeutically effective pharmaceutical compositions containing the polypeptides of the present invention. The present invention further provides diagnostic and therapeutic methods using the polypeptide derivatives.04-01-2010
20100081618Transporters Comprising Spaced Arginine Moieties - The present invention provides compositions and methods for enhancing transport of biologically active compounds across biological membranes and across and into animal epithelial or endothelial tissues. The composition includes a biologically active agent and a transport moiety. The transport moiety includes a structure selected from the group consisting of (ZYZ)04-01-2010
20100081623NOVEL TELLURIUM COMPOUNDS AND THEIR USE AS IMMUNOMODULATORS - Novel tellurium-containing compounds and uses thereof as immunomodulators are disclosed.04-01-2010
20100081621Crystal structure of the catalytic domain of the viral restriction factor APOBEC3G - The structure, function and methods associated with proteins from the APOBEC family, which are involved in diverse biological functions, is disclosed. In one embodiment, the structure of APOBEC-3G (Apo3G) is disclosed. In another embodiment, a method of using APOBEC-3G (Apo3G) and/or Apo3G-CD2 to restrict the replication of Human Immunodeficiency Virus (HIV) and Hepatitis B virus (HBV) via cytidine deamination on ssDNA or RNA binding is disclosed. In yet another embodiment, the high-resolution crystal structure of an enzymatically active APOBEC protein, the C-terminal deaminase domain of Apo3G (Apo3G-CD2) is disclosed.04-01-2010
20100081617THERAPEUTIC AGENT FOR SPINAL CORD INJURIES - Disclosed is a therapeutic agent effective for the fundamental treatment of a spinal cord injury and a demyelinating disease. Specifically disclosed are a therapeutic agent for a spinal cord injury and a therapeutic agent for a demyelinating disease, each of which comprises an HGF protein as an active ingredient.04-01-2010
20100081615CONTINUATION - SITE DIRECTED MODIFICATION OF FVIII - This invention relates to Factor VIII muteins that are covalently bound, at a predefined site that is not an N-terminal amine, to one or more biocompatible polymers such as polyethylene glycol. The mutein conjugates retain FVIII procoagulant activity and have improved pharmacokinetic properties.04-01-2010
20100081613METHODS AND COMPOSITIONS FOR ENHANCING MEMORY - The invention is directed to methods for enhancing memory by administering low doses of beta amyloid peptide. The invention also encompasses methods for increasing synaptic plasticity in a subject which comprises administering to the subject low doses of beta amyloid peptide.04-01-2010
20090258823COMPOSITION AND METHODS FOR THE PREVENTION AND TREATMENT OF GASTROINTESTINAL INFECTIONS - Methods for the prevention and treatment of gastrointestinal infections are described. Surfactant-associated protein-A (SP-A) or SP-D or an active fragment or derivative thereof is administered to mammals at risk of a gastrointestinal infection. Oral compositions of SP-A and/or SP-D are disclosed. Also disclosed is a method to prevent or treat a gastrointestinal infection in a mammal using a gene expression vector comprising the SP-A or SP-D structural gene is introduced into a mammalian cell. Also disclosed is a method to prevent or treat a gastrointestinal infection in a mammal by increasing the intestinal expression of endogenous SP-A or SP-D.10-15-2009
20080269128Albumin Fusion Proteins - The present invention encompasses albumin fusion proteins. Nucleic acid molecules encodings the albumin fusion proteins of the invention are also encompassed by the invention, as are vectors containing these nucleic acids, host cells transformed with these nucleic acids vectors, and methods of making the albumin fusion proteins of the intention and using these nucleic acids, vectors, and/or host cells. Additionally the present invention encompasses pharmaceutical compositions comprising albumin fusion proteins and methods of treating, preventing, or ameliorating diseases, disorders or conditions using albumin fusion proteins of the invention.10-30-2008
20090221478Novel galectin sequences and compositions and methods utilizing same for treating or diagnosing arthritis and other chronic inflammatory diseases - Isolated polynucleotides encoding novel galectin-8 variants polypeptides are provided. Also provided are methods and kits using same for diagnosing prognosing and treating rheumatoid arthritis (RA) and other joint/chronic inflammatory diseases.09-03-2009
20090176702USE OF LONG-ACTING RECOMBINANT HUMAN SOLUBLE TUMOR NECROSIS FACTOR ALPHA RECEPTOR IN MANUFACTURE OF A MEDICAMENT FOR THE TREATMENT AND/OR PROPHYLAXIS OF HEPATIC FAILURE - The present invention belongs to the field of the application of genetic engineering and gene function, and it is directed to a new medical use of the gene encoding the recombinant soluble tumor necrosis factor α receptor (HusTNFR). The present invention made intervention to fulminant hepatic failure in mice by use of the long-acting recombinant human soluble tumor necrosis factor α receptor and the classic animal models of acute and sub-acute hepatic failure. The results showed that the long-acting soluble tumor necrosis factor αreceptor of the present invention has a half-life extended more than 10 times, and it significantly decreased the mortality of model animals and has superior therapeutic effect for the treatment and/or prophylaxis of acute and sub-acute hepatic failure in model animals. These receptors have a noticeable therapeutic effect for the treatment and/or prophylaxis of acute and sub-acute hepatic failure in comparison with the non-long-acting HusTNFR.07-09-2009
20090170769CELL SURFACE RECEPTOR ISOFORMS AND METHODS OF IDENTIFYING AND USING THE SAME - Isoforms of cell surface receptors, including isoforms of receptor tyrosine kinases, and pharmaceutical compositions containing the isoforms are provided. Chimeras of and conjugates containing the cell surface receptors that contain a portion, such as an extracellular domain, from one cell surface receptor, and a second portion, particularly an intron-encoded portion, from a second cell surface protein also are provided. The isoforms modulate the activity of a cell surface receptor. Methods for identifying and preparing isoforms of cell surface receptors including receptor tyrosine kinases are provided. Also provided are methods of treatment with the cell surface receptor isoforms.07-02-2009
20090143298Broad-Spectrum Delta-Endotoxins and Method and Kit for Detecting Same and for Detecting Polynucleotides Encoding Same - Disclosed are novel synthetically-modified 06-04-2009
20100099620Protracted GLP-1 Compositions - Thixotropic compositions containing GLP-1 compounds have protracted action.04-22-2010
20100099610Transglutaminase Variants with Improved Specificity - Variants of transglutaminase from 04-22-2010
20100099616MODIFIED BLOOD FACTORS COMPRISING A LOW DEGREE OF WATER SOLUBLE POLYMER - The present invention relates, in general, to materials and methods for the preparation of modified blood factors which have low levels of water soluble polymer molecules conjugated to the blood factor but exhibit biological activity similar to or better than molecules having a higher number of water soluble polymer moieties.04-22-2010
20100099609eAPP AND DERIVATIVES FOR TREATMENT OF ALZHEIMER'S DISEASE - This invention provides methods of reducing levels of amyloid beta (Aβ) protein and/or netrin-1 in a mammal. In certain embodiments the methods involve administering to the mammal a fragment of an amyloid precursor protein, or a mutant amyloid precursor protein, in an amount sufficient to decrease circulating levels of free Aβ protein in said mammal, wherein said fragment is a fragment of the extracellular domain of APP or a mutant thereof that binds amyloid beta protein and/or netrin-1.04-22-2010
20100099611ANTI-ANGIOGENIC PEPTIDES - A purified polypeptide includes about 10 to about 40 amino acids and has an amino acid sequence corresponding to a portion of SEQ ID NO: 2. The polypeptide can inhibit binding of VEGF to VEGFR2 of cells that express VEGFR2.04-22-2010
20100099625Bio-security system - A method for preventing contamination of a teat during administration of a sealant comprises the steps of introducing/delivering a sterilising agent into the teat and subsequently delivering the sealant into the teat. A sealant injector 04-22-2010
20090062188Disease-Associated Protein - Disclosed are methods and compositions for early diagnosis, monitoring and treatment of retinal dystrophy, age-related macular degeneration, Bardet-Biedel syndrome, Bassen-kornzweig syndrome, best disease, choroidema, gyrate atrophy, congenital amourosis, refsun syndrome, stargardt disease and Usher syndrome. In particular, the invention relates to a protein, termed “Rdcvf1,” that is differentially transcribed and expressed in subjects suffering from retinal dystrophies and the like, such as retinal dystrophy and age-related macular degeneration compared with non-sufferers, antibodies which recognize this protein, and methods for diagnosing such conditions.03-05-2009
20090062198Maurotoxin, PI1 and HSTX1 derivatives - Derivatives of Maurotoxin (MTX) in which the native disulfide bridge pattern (Cys3-Cys24, Cys9-Cys29, Cys19, Cys31-Cys34) has been disrupted are useful for the treatment of pathologies associated with dysfunctioning and/or activation of Ca03-05-2009
20090062206Urodilatin Cancer Treatment - Urodilatin, a peptide formed in the kidney, has significant anticancer effects eliminating two-thirds of cancer cells within 24 hours.03-05-2009
20090281030Genes Associated with Macular Degeneration - Identification of variant genes correlated with age related macular degeneration, such as variant LOC387715, variant SYNPR and variant PDGFC; methods of identifying or aiding in identifying individuals at risk for developing age related macular degeneration.11-12-2009
20090258831TREATMENT USING NEUBLASTIN POLYPEPTIDES - The invention relates to treatments of neuropathic pain, including tactile allodynia, and to treatments for reducing loss of pain sensitivity associated with neuropathy. The present treatments involve the use of neublastin (NBN) polypeptides.10-15-2009
20090258829NEW FORMULATION FOR INCREASING BIOAVAILABILITY OF NEURTURIN - The present invention relates to formulations with protein growth factors, particularly neurturin as active ingredients and low molecular weight polyanionic excipients having increased bioavailability.10-15-2009
20090253629USE OF DEFENSINS AGAINST MENINGITIS - The present invention relates to methods for treating meningitis, such as bacterial meningitis, with defensin polypeptides.10-08-2009
20090170764COMPOSITIONS CONTAINING ANTI-HIV PEPTIDES AND METHODS FOR USE - Peptides representing sequences from region 45-74 of the human CD38 leukocyte surface antigen are provided which may be used to inhibit or prevent transmission or replication of the HIV virus. The peptides have from 13 to 30 amino acids and include the amino acid sequence GPGTTK (SEQ ID for topical application to inhibit or prevent transmission of the HIV virus.07-02-2009
20090170761SUSTAINED RELEASE PREPARATION OF PRO-INSULIN C-PEPTIDE - The present invention provides a pharmaceutical composition for the sustained release of C-peptide. The composition is in the form of a gel containing C-peptide. The gel formation is achieved by the adjustment of pH of the composition and/or by addition of divalent metal ions. The composition does not include any other gel-forming agents. Methods for producing the composition, medical uses of the composition and products containing two or more gel compositions as a combined preparation are also encompassed.07-02-2009
20090170775VASOACTIVE INTESTINAL POLYPEPTIDE COMPOSITIONS - Pharmaceutical compositions relating to vasoactive intestinal polypeptides and methods for the treatment of metabolic disorders, including diabetes, insulin resistance, metabolic acidosis and obesity are presented. Methods of using the vasoactive intestinal polypeptide compositions are also disclosed.07-02-2009
20090005313ACTIVATABLE CLOSTRIDIAL TOXINS - Compositions comprising activatable recombinant neurotoxins and polypeptides derived therefrom. The invention also comprises nucleic acids encoding such polypeptides, and methods of making such polypeptides and nucleic acids.01-01-2009
20100099619PANCREATIC POLYPEPTIDE FAMILY MOTIFS, POLYPEPTIDES AND METHODS COMPRISING THE SAME - The present invention provides novel Pancreatic Polypeptide Family (“PPF”) polypeptides and methods for their use.04-22-2010
20100099615PANCREATIC REGENERATING PROTEIN I IN CHRONIC PANCREATITIS AND AGING IMPLICATIONS FOR NEW THERAPEUTIC APPROACHES TO DIABETES - The present invention provides a method of treating diabetes, including administering to a mammal diagnosed with diabetes a purified recombinant reg I protein.04-22-2010
20090275508USE OF THYMOSIN ALPHA 1, ALONE OR IN COMBINATION WITH PTX3 OR GANCICLOVIR, FOR THE TREATMENT OF CYTOMEGALOVIRUS INFECTION - It is described the use of thymosin alpha 1 in combination with long pentraxin PTX3 or Ganciclovir, for the preparation of a medicament for the prevention or treatment of viral diseases and/or for inhibiting virus activation.11-05-2009
20090275510Compositions and Methods for Inducing or Inhibiting Activities of Selected Human Cells - Polynucleotides encoding a mutant human carboxylesterase enzyme and polypeptides encoded by the polynucleotides which are capable of metabolizing a prodrug and inactive metabolites thereof to active drug are provided. Compositions and methods for sensitizing cells to a prodrug agent, inhibiting cell growth, treating drug addiction, and facilitating the metabolism of an organophosphate with this enzyme are also provided. In addition, a screening assay for identification of drugs activated by this enzyme is described.11-05-2009
20090275505Compositions and Methods For Preventing or Treating Feline Chronic Renal Failure - The invention provides compositions for preventing chronic feline renal failure comprising from about 28 to about 35% protein and compositions for treating chronic renal failure in felines comprising from about 28 to about 30%, wherein the protein comprises at least about 75% vegetable protein and methods for using such compositions to prevent or treat chronic feline renal failure. The invention also provides methods for preparing the compositions, articles of manufacture comprising the compositions, and means for communicating information about the compositions, methods, and articles of manufacture.11-05-2009
20090143299NOVEL ANTIMICROBIAL PEPTIDES AND USE THEREOF - The invention relates to a molecule comprising at least the amino acid sequence X06-04-2009
20090143300Treatment of sepsis and septic shock using ghrelin and growth hormone - Methods are disclosed for treating sepsis and septic shock using a combination of ghrelin and growth hormone, and for using ghrelin to reduce organ and tissue injury and improve survival after combined radiation exposure and sepsis.06-04-2009
20090143291TUMOR ANTIGEN BASED ON PRODUCTS OF THE TUMOR SUPPRESSOR GENE WT1 - A tumor antigen that comprises, as an active ingredient, a product of the Wilms' tumor suppressor gene WT1 or a peptide composed of 7-30 contiguous amino acids containing an anchor amino acid for binding to major histocompatibility complex (MHC) class I in said amino acid sequence, and a vaccine comprising said antigen.06-04-2009
20090143285TARGET PROTEIN AND TARGET GENE FOR DRUG DISCOVERY AND SCREENING METHOD - The present invention provides target proteins and target genes for bioactive substances such as drugs, and means that enable the development of novel bioactive substances using the same. More specifically, the present invention provides target proteins and target genes for bioactive substances; screening methods for substances capable of regulating bioactivities; bioactivity regulators; a bioactive substance derivative production method; a complex comprising a bioactive substance and a target protein, and a method of producing the complex; and kits comprising a bioactive substance or a salt thereof; determination methods for the onset or risk of onset of a specified disease or condition, determination methods for susceptibility to a bioactive substance, and determination kits used for the determination methods, and the like.06-04-2009
20090105141INTRAVENTRICULAR PROTEIN DELIVERY FOR AMYOTROPHIC LATERAL SCLEROSIS - Amyotrophic Lateral Sclerosis can be successfully treated using intraventricular delivery of a neurotrophic growth factor, IGF-1. The administration can be performed slowly to achieve maximum effect. Effects are seen on both sides of the blood-brain barrier, making this a delivery means for Amyotrophic Lateral Sclerosis which affects both brain and skeletal muscle.04-23-2009
20090281036FUSION PEPTIDE FOR INHIBITING INTERACTION OF NEURONAL NMDA RECEPTOR (NMDAR) AND NMDAR INTERACTING PROTEINS - The present invention provides a fusion peptide comprising at least a component (I), wherein component (I) comprises a transporter peptide, and a component (II), selected from a peptide inhibiting interaction of neuronal N-methyl-D-aspartate receptor (NMDAR) with NMDAR interacting proteins, wherein component (II) entirely consists of D-enantiomeric amino acids. The present invention furthermore provides an inventive pharmaceutical composition, comprising the inventive fusion peptide and methods for administering the same as well as kits and uses employing the inventive fusion peptide.11-12-2009
20080274962Voltage Dependent Anion Channel (Vdac1) Compositions and Methods of Use Thereof for Regulating Apoptosis - The present invention relates generally to the mitochondrial protein, voltage-dependent anion channel (VDAC)5 polynucleotides encoding same and variants thereof, as well as peptide fragments, peptide derivatives and analogs. In particular, the present invention is directed to VDAC1 and specific amino acid and polynucleotide sequences thereof useful in inducing or regulating apoptosis and to pharmaceutical compositions comprising same useful in the treatment of diseases associated with aberrant apoptosis.11-06-2008
20090088376DENDRIMER BASED COMPOSITIONS AND METHODS OF USING THE SAME - The present invention relates to novel therapeutic and diagnostic dendrimers. In particular, the present invention is directed to dendrimer based compositions and systems for use in disease diagnosis and therapy (e.g., cancer diagnosis and therapy). The compositions and systems comprise one or more components for targeting, imaging, sensing, and/or providing a therapeutic or diagnostic material and monitoring the response to therapy of a cell or tissue (e.g., a tumor).04-02-2009
20090088374NOVEL USE - The present invention relates generally to the use of PA126 polypeptides and polynucleotides for healing various wounds arising from different causes.04-02-2009
20090088378LONG LASTING INHIBITORS OF VIRAL INFECTION - This invention relates to C34 peptide derivatives that are inhibitors of viral infection and/or exhibit antifusogenic properties. In particular, this invention relates to C34 derivatives having inhibiting activity against human immunodeficiency virus (HIV), respiratory synctial virus (RSV), human parainfluenza virus (HPV), measles virus (MeV), and simian immunodeficiency virus (SIV) with long duration of action for the treatment of the respective viral infections.04-02-2009
20090088384Therapeutic Fibrin-Derived Peptides And Uses Thereof - The invention relates to peptides having the general formula (I), or a salt or amide thereof, wherein R04-02-2009
20090088383GH SECRETAGOGUES AND USES THEREOF - The invention relates to use of a GH secretagogue (e.g. GRF or an analog thereof) for (1) altering a lipid parameter in a subject; (2) altering a body composition parameter in a subject, (3) treating a condition characterized by deficient or decreased bone formation in a subject (4) improving daytime vigilance and/or cognitive function in a subject, (5) improving a metabolic condition in a subject, (6) improving anabolism in a catabolic condition in a subject, and/or (7) improving and/or reconstituting immune function in a subject.04-02-2009
20090088381COMPOSITIONS CONTAINING ANTI-HIV PEPTIDES AND METHODS FOR USE - Peptides representing sequences from region 45-74 of the human CD38 leukocyte surface antigen (SEQ ID NO:1) are provided which may be used to inhibit or prevent transmission or replication of the HIV virus. The peptides have from 13 to 30 amino acids and include the amino acid sequence GPGTTK (SEQ ID NO:18) for topical application to inhibit or prevent transmission of the HIV virus.04-02-2009
20090088375Human prolactin antagonist-angiogenesis inhibitor fusion proteins - A novel fusion protein, comprising a receptor-antagonizing domain and an angiogenesis inhibiting domain, characterized, for example, by its ability to block apoptosis and/or inhibit endocrine response, is useful in treating cancer. For example, a human prolactin antagonist-endostatin fusion protein combines apoptosis induction and angiogenesis inhibition to combat cancer.04-02-2009
20090291897METHODS FOR TREATING UNWANTED WEIGHT LOSS OR EATING DISORDERS BY ADMINISTERING A TRKB AGONIST - This invention relates to methods for treating unwanted body weight loss (such as cachexia), eating disorders (such as anorexia nervosa), or opioid-induced emesis by peripheral administration of a trkB agonist. The invention also relates to compositions and kits comprising a trkB agonist.11-26-2009
20090291896GENES ENCODING NOVEL PROTEINS WITH PESTICIDAL ACTIVITY AGAINST COLEOPTERANS - The invention provides nucleic acids, and variants and fragments thereof, obtained from strains of 11-26-2009
20090291894METHODS FOR TREATING PROGRESSIVE COGNITIVE DISORDERS RELATED TO NEUROFIBRILLARY TANGLES - The described invention provides methods for treating or preventing progression of a progressive cognitive disease, disorder or condition, and methods for improving resilience of cognitive function in a subject in need thereof.11-26-2009
20090291888MODULATORS OF TNF RECEPTOR ASSOCIATED FACTOR (TRAF), THEIR PREPARATION AND USE - A DNA sequence encoding a protein capable of binding to a tumor necrosis factor receptor-associated factor (TRAF) molecule, TRAF-binding proteins, their isoforms, analogs, fragments and derivatives encoded by the DNA sequence, their methods for the production of the DNA sequences and proteins, and the uses for the DNA sequence and proteins.11-26-2009
20090124540Anti-adhesion composites and methods of use thereof - Described herein are composites that inhibit or reduce adhesion between two or more tissues. Also described herein are methods of using the composites.05-14-2009
20080207517SELECTIVE INHIBITION OF NF-kappaB ACTIVIATION BY PEPTIDES DESIGNED TO DISRUPT NEMO OLIGOMERIZATION - The present invention relates to polypeptides that inhibit the NF-κB signaling pathway and polynucleotides encoding the same. The present invention further provides methods for the modulation of and/or treatment of inflammatory responses, oncogenesis, viral infection; the regulation of cell proliferation and apoptosis; and regulation of B or T lymphocytes in antigenic stimulation, by administering the polypeptides of the present invention to a subject in need thereof. Finally, the present invention provides a method of identifying polypeptides that modulate oligomerization of NEMO.08-28-2008
20080207504SECRETED FRIZZLED RELATED PROTEIN, sFRP, FRAGMENTS AND METHODS OF USE THEREOF - The invention stems from the discovery that sFRP and fragments thereof can bind to members of the Wnt family of proteins and cause an increase in Wnt biological activity. Furthermore, fragments of sFRP that do not contain the CRD domain are shown to bind to Wnt proteins and modulate Wnt biological activity. Accordingly, the invention provides these sFRP fragments and variants of these fragments, as well as vectors and host cells containing nucleic acid sequences encoding the sFRP fragments and variants.08-28-2008
20080207512Methods for Treating Obesity and Obesity Related and Disorders - Methods for treating obesity or obesity related disorders are disclosed. These methods include the use of anti-obesity agents directed to the forebrain in combination with anti-obesity agents directed to the hindbrain.08-28-2008
20080207501Amylin Family Polypeptide-6 (Afp-6) Analogs and Methods of Making and Using Them - The present invention relates to Amylin Family Polypeptide-6 (AFP-6) analogs, which include derivatives and fragments, related nucleic acids, expression constructs, host cells, and processes for recombinant production of the AFP-6 analogs. The AFP-6 analogs of the invention include one or more amino acid sequence modifications. In addition, methods and compositions are disclosed to treat and prevent conditions such as metabolic and cardiovascular disorders, e.g., obesity, diabetes, metabolic syndrome, myocardial ischemia, and increased cardiovascular risk.08-28-2008
20080207507Extended Glp-1 Compounds - Protracted GLP-1 compounds and therapeutic uses thereof.08-28-2008
20080207503Composition and Treatment Methods for Coronary Artery Disease - The present disclosure demonstrates that cholesterol-free discoidal reconstituted HDL (R-HDL), phosphatidyl-choline (PC) and PC liposomes effectively released cholesterol from ICP. Native HDL and its apolipoproteins were not able to release cholesterol from ICP. The release of ICP cholesterol by R-HDL was dose-dependent and accompanied by the transfer of >8× more PC in the reverse direction (i.e., from R-HDL to ICP), resulting in a marked enrichment of ICP with PC. The enrichment of ICP with PC resulted in the dissolution of cholesterol crystals on ICP and allowed the removal of ICP cholesterol by apo HDL and plasma. The present disclosure provides a method of treatment for removal of cholesterol from ICP in vivo and compositions for use in such method of treatment. Such methods may be used in the treatment and/or prevention of atherosclerosis, coronary artery disease, and related disease states and conditions.08-28-2008
20080207513Compositions For Buccal Delivery of Human Growth Hormone - The present invention provides pharmaceutical compositions for buccal delivery of human growth hormone (hGH) comprising a delivery agent and hGH. The compositions of the present invention provide improved delivery of hGH compared to comparable oral compositions, resulting in increased serum concentrations of hGH. The present invention further provides for methods of stimulating tissue growth in an animal by buccally co-administering hGH and a delivery agent.08-28-2008
20080207511COMPOSITIONS AND METHODS FOR THE THERAPY AND DIAGNOSIS OF BREAST CANCER - Compositions and methods for the therapy and diagnosis of cancer, particularly breast cancer, are disclosed. Illustrative compositions comprise one or more breast tumor polypeptides, immunogenic portions thereof, polynucleotides that encode such polypeptides, antigen presenting cell that expresses such polypeptides, and T cells that are specific for cells expressing such polypeptides. The disclosed compositions are useful, for example, in the diagnosis, prevention and/or treatment of diseases, particularly breast cancer.08-28-2008
20080207515Promotion of Epithelial Regeneration - The invention relates to the use of TGF-β3, or agents having TGF-β3 activity, to promote epithelial regeneration. Methods of manufacturing medicaments, and methods of promoting epithelial regeneration are both provided. In particular, the medicaments and methods of treatment of the invention are applicable to the promotion of epithelial regeneration in healthy patients, and/or in acute wounds.08-28-2008
20080207508Treatment of Fungal and/or Protist Infections - The present invention relates to the use of a polypeptides, comprising repeats of a peptide derived from a Heparan Sulphate Proteoglycan (HSPG) receptor binding region of an apolipoprotein, for treating or preventing a fungal and/or protist infection. The invention further relates to the use of such peptides for treating or preventing the contamination of surfaces or objects with such peptides.08-28-2008
20080207499Rage-related methods for treating and preventing diabetic retinopathy - This invention provides a method for treating diabetic retinopathy in a subject afflicted therewith, comprising administering to the subject's eyes a therapeutically effective amount of soluble RAGE or a derivative thereof, thereby treating diabetic retinopathy in the subject. This invention further provides a method for inhibiting the onset of diabetic retinopathy in a subject afflicted therewith, comprising administering a prophylactically effective amount of soluble RAGE or a derivative thereof to the subject's eyes, thereby inhibiting the onset of diabetic retinopathy in the subject.08-28-2008
20090118173TREATMENT AND PREVENTION OF INFLAMMATORY BOWEL DISEASES - The present invention relates to the use of heat shock proteins, or fragments thereof, for the treatment and/or prevention of Inflammatory Bowel Diseases. Preferably bacterial and/or mammalian heat shock proteins belonging to the HSP70 families are used.05-07-2009
20090118174Novel peptides and methods for the treatment of inflammatory disorders - Novel peptides, nucleic acids encoding them, and derivatives of the peptides are described. The peptides and nucleic acids are of use in modulating β2 integrin function and in treating β2 integrin-mediated inflammatory disorders.05-07-2009
20100120673BACTERIOPHAGE LYSINS FOR BACILLUS ANTHRACIS - The present disclosure relates to methods, compositions and articles of manufacture useful for the treatment of 05-13-2010
20090275517G-CSF POLYPEPTIDES AND USES THEREOF - The present invention relates to G-CSF polypeptides and their uses, particularly for therapeutic or prophylactic treatment in human subjects. The invention also relates to nucleic acids encoding said polypeptides, vectors comprising such nucleic acids and recombinant cells containing the same. The invention further discloses methods of producing such polypeptides, as well as methods and tools for detecting or dosing these polypeptides in any sample.11-05-2009
20090275511ANALOGS OF GHRELIN SUBSTITUTED AT THE N-TERMINAL - The invention comprises peptidyl analogs of ghrelin having greater stability which are active at the GHS receptor according to formulae depicted below:11-05-2009
20090275506LONG LASTING NATRIURETIC PEPTIDE DERIVATIVES - This invention relates to long lasting natriuretic peptide (NP) derivatives. The NP derivative has a NP peptide and a reactive entity coupled to the NP peptide. The reactive entity is able to covalently bond with a functionality on a blood component. In particular, this invention relates to NP derivatives having an extended in vivo half-life, and method for the treatment of cardiovascular diseases and disorders such as acute decompensated congestive heart failure (CHF) and chronic CHF.11-05-2009
20090275503DIASTEREOMERIC PEPTIDES FOR MODULATING T CELL IMMUNITY - The present invention provides diastereomeric peptides derived from the T Cell Receptor alpha Transmembrane Domain, and lipophilic conjugates thereof, which peptides and conjugates are effective in preventing or treating T cell mediated inflammatory diseases. The invention provides pharmaceutical compositions comprising these diastereomeric peptides and conjugates, and uses thereof for therapy of inflammatory diseases, autoimmunity and graft rejection.11-05-2009
20090275513COMPOSITION AND METHOD FOR PREPARING PLASMINOGEN - Disclosed is both a method for preparing a plasminogen and a method for preparing a reversibly inactive acidified plasmin by activating the plasminogen. The prepared plasminogen is typically purified from a fraction obtained in the separation of immunoglobulin from Fraction II+III chromatographic process and eluted at a low pH. The prepared plasmin is isolated and stored with a low pH-buffering capacity agent to provide a substantially stable formulation. The reversibly inactive acidified plasmin may be used in the administration of a thrombolytic therapy.11-05-2009
20090281039SATIETY INDUCING PRODUCTS AND A METHOD OF THEIR PRODUCTION - The invention relates to a food product inducing satiety with the aim of contributing to weight management. The product contains as its essential ingredients viscous soluble dietary fibre or other thickening agent and fat or fatty acids. A preferred component contained in the product is a barley or oat bran concentrate rich in β-glucan. The product may have a pasty consistency, or it may have a particulate consistency and can be turned to a paste by addition of water.11-12-2009
20090281037Method of Reducing Injury to Mammalian Cells - A method of inhibiting the binding between N-methyl-D-aspartate receptors and neuronal proteins in a neuron is disclosed. The method comprises administering to the neuron an effective inhibiting amount of a peptide replacement agent for the NMDA receptor or neuronal protein interaction domain that effect said inhibition of the NMDA receptor-neuronal protein interaction. The method is of value in reducing the damaging effect of injury to mammalian cells. Postsynaptic density-95 protein (PSD-95) couples neuronal N-methyl-D-aspartate receptors (NMDARS) to pathways mediating excitotoxicity, ischemic and traumatic brain damage. This coupling was disrupted by transducing neurons with peptides that bind to modular domains on either side of the PSD-95/NMDAR interaction complex. This treatment attenuated downstream NMDAR signaling without blocking NMDAR activity, protected cultured cortical neurons from excitotoxic insults, dramatically reduced cerebral infarction volume in rats subjected to transient focal cerebral ischemia, and traumatic brain injury (TBI) in rats.11-12-2009
20090281028OSK1 peptide analogs and pharmaceutical compositions - Disclosed is a composition of matter comprising an OSK1 peptide analog, and in some embodiments, a pharmaceutically acceptable salt thereof. A pharmaceutical composition comprises the composition and a pharmaceutically acceptable carrier. Also disclosed are DNAs encoding the inventive composition of matter, an expression vector comprising the DNA, and host cells comprising the expression vector. Methods of treating an autoimmune disorder and of preventing or mitigating a relapse of a symptom of multiple sclerosis are also disclosed.11-12-2009
20090281040Methods For Treating Endoplasmic Reticulum (ER) Stress Disorders - The present invention provides methods for treating ER stress disorders and for identifying compounds for treating ER stress disorders.11-12-2009
20090281038Phylloplanins Inhibition of Microbial Growth on Organic Materials - The present invention relates to plant proteins produced by a plant's epidermal layer that contribute to the innate pest/disease resistance of the plant (“phylloplanins’), compositions comprising the phylloplanins and methods of using the them. In particular the methods relate to inhibiting or prevent microbial, e.g., fungal or bacterial, growth on a subject, organism or surface, particularly inhibiting or preventing spoilage of food products due to microbial infection and growth. The invention also relates to transformed host cells that produce the phylloplanins, and to transgenic plants producing phylloplanins conferring increased resistance to microbial infections/growth.11-12-2009
20090281035Soluble Heterodimeric Receptors and Uses Thereof - Soluble versions of heterodimeric receptors, e.g., CD94/NKG2 receptors, and methods of producing and using such constructs, are described. The constructs comprise soluble fragments of, each receptor monomer, and some constructs further comprise at least one immunoglobulin Fc domain. Exemplary constructs are those wherein (1) each soluble fragment is linked to an immunoglobulin Fc domain, which are then allowed to dimerize, (2) each soluble fragment is linked to an immunoglobulin Fc domain mutated to promote forced dimerization with the correct counterpart, and (3) single-chain constructs where the monomeric receptor fragments are linked, and the C-terminal fragment is linked to an Fc domain.11-12-2009
20090281025INHIBITION OF TUMOR GROWTH AND METASTASIS BY ATF2-DERIVED PEPTIDES - The present invention relates to novel therapies for cancer and, in particular, to therapies that are particularly suited to tumor cells resistant to other types of therapies, such as radiation therapy, chemotherapy, or a combinations thereof. The invention provides methods for identifying and implementing strategies to inhibit a transcription factor involved in promoting resistance and inhibition of apoptosis. The invention provides a compound that alters ATF2 activity, specifically amino-terminal fragments of ATF2 that retain the JNK binding domain. The invention provides methods for inhibiting tumor cell growth and for sensitizing tumor cells to apoptosis with such peptides.11-12-2009
20080293624Stabilized FGF formulations containing reducing agents - Stabilized FGF compositions are provided. The compositions comprise FGF or variant thereof and at least one reducing agent in an amount sufficient to inhibit FGF oxidation. Methods for increasing stability of FGF or variant thereof in a liquid or lyophilized composition and for increasing storage stability of such a composition are also provided.11-27-2008
20090286735METHOD FOR ADMINISTERING GLP-1 MOLECULES - The invention relates to formulations that demonstrate the feasibility of oral absorption comprising glucose-like peptide-1 compounds and specified delivery agents, and to methods of stimulating GLP-1 receptor in a subject in need of such stimulation, by administration of the formulation of the present invention.11-19-2009
20090286723Hybrid Polypeptides with Selectable Properties - The present invention relates generally to novel, selectable hybrid polypeptides useful as agents for the treatment and prevention of metabolic diseases and disorders which can be alleviated by control plasma glucose levels, insulin levels, and/or insulin secretion, such as diabetes and diabetes-related conditions. Such conditions and disorders include, but are not limited to, hypertension, dyslipidemia, cardiovascular disease, eating disorders, insulin-resistance, obesity, and diabetes mellitus of any kind, including type 1, type 2, and gestational diabetes.11-19-2009
20090291895Methods and Compositions for the Treatment of Inflammatory Diseases - Compositions and methods for treating inflammatory disorders are provided.11-26-2009
20090291886TRANSMUCOSAL DELIVERY OF PEPTIDES AND PROTEINS - Provided are methods and compositions for enhancing the transmucosal absorption of bioactive peptides and proteins. More particularly, the invention provides compositions for enhancing the transmucosal absorption of bioactive peptides and proteins, such as exendin-4, PYY, PYY11-26-2009
20090291884Proteins for use in diagnosing and treating infection and disease - The present invention describes a composition comprised on cystatin A and at least one histone used in diagnostic tools and for the treatment of diseases associated with reduced T helper cell counts such as HIV-1 infection, AIDS, ARC, multiple sclerosis, chronic fatigue syndrome, heumatoid arthritis, Alzheimer's disease, dermatitis, type 1 diabetes mellitus, colitis, inflammatory bowel disease / irritable bowel syndrome, Crohn's disease, Psoriasis, Chronic obstructive pulmonary disease, System lupus erythematosus, transplant rejection and cancer.11-26-2009
20090291885Conjugated toxin peptide therapeutic agents - Disclosed is a composition of matter comprising an OSK1 peptide analog, and in some embodiments, a pharmaceutically acceptable salt thereof. A pharmaceutical composition comprises the composition and a pharmaceutically acceptable carrier. Also disclosed are DNAs encoding the inventive composition of matter, an expression vector comprising the DNA, and host cells comprising the expression vector. Methods of treating an autoimmune disorder and of preventing or mitigating a relapse of a symptom of multiple sclerosis are also disclosed.11-26-2009
20100249031Nutritional Composition Comprising Curcuminoids and Methods of Manufacture - Disclosed are nutritional compositions and methods for preparing the compositions, comprising fat, protein, and carbohydrate, including a combination of curcumin, demethoxycurcumin, and bisdemethoxycurcumin, which combination is solubilized in a polar oil having an HLB value of from about 0.7 to about 14 wherein the weight ratio of the bisdemethoxycurcumin to the curcumin is from about 1:1 to about 1:7 and the weight ratio of the bisdemethoxycurcumin to the demethoxycurcumin is from about 1:1 to about 1:2.5. The composition provides a selected ratio of curcuminoids having improved biological activity, bioavailability, and reduced color impact.09-30-2010
20100249030ANTI-MITOTIC AGENT AND AURORA KINASE INHIBITOR COMBINATION AS ANTI-CANCER TREATMENT - The present invention relates to a method of treating cancer by pretreatment with anti-mitotic agents followed by at least one aurora kinase inhibitor. Extensive illustrations are provided for the antimitotic agents and aurora kinase inhibitors that are useful in the inventive treatment.09-30-2010
20100249029Peptides with high affinity for the prolactin receptor - The invention relates to variants of prolactin, which variants have high affinity for the prolactin receptor.09-30-2010
20100249028ORAL COMPOSITION - An object of the present invention is to provide an oral composition useful for promoting collagen synthesis and the like. The present invention can provide an oral composition containing collagen or gelatin or a degradation product thereof, and hydroxyproline or a salt thereof. The weight ratio of alanine and hydroxyproline contained in the amino acids obtained by hydrolyzing the oral composition is preferably 1:1.5-150.09-30-2010
20100120692NEUREGULINS FOR PREVENTION AND TREATMENT OF DAMAGE FROM ACUTE ASSAULT ON VASCULAR AND NEURONAL TISSUE AND AS REGULATORS OF NEURONAL STEM CELL MIGRATION - Neuregulin, a known neuroprotein, has been found to ameliorate or prevent damage caused by mechanical or chemical assault to blood vessels and, when administered into the cerebral spinal fluid, can ameliorate damage to neuronal tissue caused by stroke or inflammation. Additionally, neuregulin has been found to be useful for enhancement of stem cell migration from the ventricle to the site of injury to the brain.05-13-2010
20100120689POLYMER FACTOR VIII MOIETY CONJUGATES - Conjugates of a Factor VIII moiety and one or more water-soluble polymers are provided. Typically, the water-soluble polymer is poly(ethylene glycol) or a derivative thereof. Also provided are compositions comprising the conjugates, methods of making the conjugates, and methods of administering compositions comprising the conjugates to a patient.05-13-2010
20100113357Platelet-derived growth factor-responsive neural precursor cells and progeny thereof - This invention provides platelet-derived growth factor-responsive neural precursor (PRP) cells and methods of producing such cells in vivo or in vitro. These cells can further be used to generate neurons, oligodendrocytes and/or astrocytes.05-06-2010
20100113359DIMETHYLPHENOXY MODULATORS OF VIRAL PROTEASE ACTIVITY AND/OR PARASITIC ENZYME ACTIVITY - The present invention relates to new dimethylphenoxy inhibitors of viral protease or parasitic enzymes, pharmaceutical compositions thereof, and methods of use thereof.05-06-2010
20100113351Therapeuting Compositions Comprising an RNAi Agent and a Neurotrophic Factor and Methods of Use Thereof - The invention provides novel combination therapies for treating Huntington's disease which comprise a) BDNF or suitable fragments thereof and b) agents capable of causing inhibition of a gene responsible for the neurodegenerative disease. The invention provides nucleic acid sequences, methods, and systems suitable for applications of these combination therapies.05-06-2010
20100113344Method Of Detection Of Nucleic Acids With A Specific Sequence Composition - This invention is a novel method for detecting and localizing specific nucleic acid sequences in a sample with a high degree of sensitivity and specificity. The method and novel compositions used in the method involve the use of Probe Nucleic Acids, the production of nucleic acid binding regions and the use of nucleic acid Target Binding Assemblies to detect and localize specific Target Nucleic Acids. The detection and localization of the Target Nucleic Acid is accomplished even in the presence of nucleic acids which have similar sequences. The method provides for a high degree of amplification of the signal produced by each specific binding event. In particular, methods and compositions are presented for the detection of HIV and HPV nucleic acid in samples. These methods and compositions find use in diagnosis of disease, genetic monitoring, forensics, and analysis of nucleic acid mixtures. Some of the novel compositions used in the detection method are useful in preventing or treating pathogenic conditions.05-06-2010
20080269135Method of treatment for early stage cancer - This patent describes a method and materials to treat cancer diagnosed at an early stage, particularly breast cancer. It considers that metastatic breast cancer growth includes periods of dormancy, that surgery to remove a primary tumor can induce metastatic growth, and that women with Down Syndrome rarely get breast cancer. It elevates the level of an antiangiogenic drug produced by chromosome 21 preferably Endostatin in plasma preferably at least one day prior to surgery and kept at that high level preferably indefinitely. The therapy specifically excludes drugs that significantly inhibit the VEGF pathway since that is important for wound healing. This method will prevent results of surgery from stimulating tumor growth and angiogenesis of micrometastatic disease that is much easier to prevent than control after the fact. This can be done indefinitely since there is no acquired resistance that develops, as happens in most cancer therapies.10-30-2008
20100173839STABILIZED INSULIN-LIKE GROWTH FACTOR POLYPEPTIDES - The invention relates to stabilized polypeptides having an IGF-1 or IGF-2 sequence and an E-peptide sequence, where the natural physiological cleavage of the E-peptide from the IGF is prevented.07-08-2010
20100216710METHODS FOR STIMULATING NERVOUS SYSTEM REGENERATION AND REPAIR BY REGULATING ARGINASE I AND POLYAMINE SYNTHESIS - This invention relates to the novel identification of arginase as an enzymatic activity which can reverse inhibition of neuronal regeneration in the central and peripheral nervous system. Assays to monitor the effects of various agents on arginase expression and thus on neuronal regeneration and repair and to identify agents which will block or promote the inhibitory effects on neuronal outgrowth are provided. This invention also relates to compositions and methods using agents that can reverse the inhibitory effects of myelin on neural regeneration by affecting arginase activity or putrescine and derivative polyamine levels in a neuron. Methods for regulating and for promoting (or repressing) neuronal growth or regeneration in the nervous system, methods for treating injuries or damage to nervous tissue or neurons, and methods for treating neural degeneration associated with conditions, disorders or diseases, comprising the step of administering at least one of the compositions according to this invention, are provided.08-26-2010
20100144630Compositions, methods and uses for inhibition and/or treatment of influenza infection - Embodiments of the present invention illustrate methods and compositions for treating medical disorders. In certain embodiments, compositions and methods relate to reducing or inhibiting onset, transmission or development of a viral disorder.06-10-2010
20100144621Use of Exendins and Exendin Agonists and GLP-1 Receptor Agonists for Altering the Concentration of Fibrinogen - The present invention relates to altering the concentration of fibrinogen, specifically, for example, by decreasing fibrinogen concentration. The present invention also relates to methods for improving the cardiovascular risk profile of a subject by decreasing fibrinogen concentration.06-10-2010
20100137216AXMI-027, AXMI-036 AND AXMI-038, A FAMILY OF DELTA-ENDOTOXIN GENES AND METHODS FOR THEIR USE - Compositions and methods for conferring pesticidal activity to bacteria, plants, plant cells, tissues and seeds are provided. Compositions comprising a coding sequence for a delta-endotoxin polypeptide are provided. The coding sequences can be used in DNA constructs or expression cassettes for transformation and expression in plants and bacteria. Compositions also comprise transformed bacteria, plants, plant cells, tissues, and seeds. In particular, isolated delta-endotoxin nucleic acid molecules are provided. Additionally, amino acid sequences corresponding to the polynucleotides are encompassed. In particular, the present invention provides for isolated nucleic acid molecules comprising nucleotide sequences encoding the amino acid sequence shown in SEQ ID NOS:2, 11 and 13, or the nucleotide sequences set forth in SEQ ID NOS:1, 10 and 12, as well as variants and fragments thereof.06-03-2010
20080274955Novel Use of a Polypeptide Comprising Fas-1 Domain - The present invention relates to the novel use of a polypeptide comprising a fas-1 domain. More particularly, the invention relates to a method for the inhibition of the adhesion, migration and/or proliferation of endothelial cells, and/or for the inhibition of angiogenesis, using the polypeptide comprising the fas-1 domain, or functional equivalents thereof. Furthermore, the invention provides a method for treating or preventing angiogenesis-related diseases, using the polypeptide.11-06-2008
20080274956Fusion Protein Comprising a Bh3-Domain of a Bh3-Only Protein - This invention relates to a fusion protein comprising at least one first portion (I) comprising a trafficking sequence and at least one second portion (II) comprising a full-length or partial BH3-domain sequence of a BH3-only protein, said fusion protein comprising D-enantiomeric amino acids in retro-inverso order in its portion (I). Furthermore, the invention relates to pharmaceutical compositions containing said fusion protein as well as to the use of said fusion protein.11-06-2008
20080274974PROCESS FOR REMOVING VIRUSES IN FIBRINOGEN SOLUTIONS AND FIBRINOGEN OBTAINED BY SAID PROCESS - A process for removing viruses in fibrinogen solutions and fibrinogen obtained thereof wherein the process starts with an adjusted purified fibrinogen solution, the adjusted purified solution is frozen and then thawed at a temperature between 5 and 20° C., the undissolved materials associated with the fibrinogen are subsequently separated, the temperature is adjusted and the resultant solution is finally subjected to nanofiltration using filters having a pore size smaller than 35 nm.11-06-2008
20080274971Use of ACRP30 Globular Head to Promote Increases in Muscle Mass and Muscle Differentiation - The present invention relates to the field of muscle research, in particular to the discovery of a compound effective for increasing muscle mass, muscle cell differentiation, and oxidation of free fatty acids in muscle, useful in methods of treating muscle-related diseases and disorders as well as for augmenting muscle mass in general. The muscle-related diseases or disorders envisaged to be treated by the methods of the invention include, but are not limited to, muscular dystrophy, and other conditions resulting in muscle atrophy or muscle wasting.11-06-2008
20080274968IN VITRO METHODS FOR DETECTING RENAL CANCER - The present invention refers to an in vitro method for detecting the presence of renal cancer in an individual, for determining the stage, malignancy or severity of said carcinoma in the individual or for monitoring the effect of the therapy administered to an individual having said cancer; to the search, identification, development and assessment of the efficacy of compounds for therapy for said cancer in an attempt to develop new drugs; as well as to agents inducing Plexin-131 protein expression and/or activity, or to agents inhibiting the effects of Plexin-B1 protein expression and/or activity repression.11-06-2008
20080274967Variants of Pigment Epithelium Derived Factor and Uses Thereof - The present invention relates to anti-angiogenic variants of pigment epithelium derived factor (PEDF) comprising a plurality of altered phosphorylation sites, polynucleotides encoding same and uses thereof. In particular, the PEDF variants of the present invention provide superior anti-angiogenic activity and high neurotrophic activity and are useful in treating diseases associated with neovascularization and with neurodegenerative conditions.11-06-2008
20080274966Biglycan and related therapeutics and methods of use - The invention provides compositions and methods for treating, preventing, and diagnosing diseases or conditions associated with an abnormal level or activity of biglycan; disorders associated with an unstable cytoplasmic membrane, due, e.g., to an unstable dystrophin associated protein complex (DAPC); disorders associated with abnormal synapses or neuromuscular junctions, including those resulting from an abnormal MuSK activation or acetylcholine receptor (AChR) aggregation. Examples of diseases include muscular dystrophies, such as Duchenne's Muscular Dystrophy, Becker's Muscular Dystrophy, neuromuscular disorders and neurological disorders.11-06-2008
20080274964Human Spasmolytic Polypeptide in Glycosylated Form - Human spasmolytic polypeptide (HSP) which has the amino acid sequence11-06-2008
20080274958GLYCOSYLATION OF PEPTIDES VIA O-LINKED GLYCOSYLATION SEQUENCES - The present invention provides sequon polypeptides with an amino acid sequence including one or more exogenous O-linked glycosylation sequence of the invention. In addition, the present invention provides methods of making polypeptide conjugates as well as methods of using such conjugates and their pharmaceutical compositions. The invention further provides libraries of sequon polypeptides, wherein each member of such library includes at least one exogenous O-linked glycosylation sequence of the invention. Also provided are methods of making and using such libraries.11-06-2008
20080274957RGD-ENRICHED GELATINE-LIKE PROTEINS WITH ENHANCED CELL BINDING - The invention concerns a cell support comprising an RGD-enriched gelatine that has a more even distribution of RGD sequences than occurring in a natural gelatine and with a minimum level of RGD sequences. More precise the percentage of RGD sequences related to the total number of amino acids is at least 0.4 and if the RGD-enriched gelatine comprises 350 amino acids or more, each stretch of 350 amino acids contains at least one RGD motif. Preferably the RGD-enriched gelatines are prepared by recombinant technology, and have a sequence that is derived from a human gelatine or collagen amino acid sequence. The invention also relates to RGD-enriched gelatines that are used for attachment to integrins. In particular The RGD-enriched gelatines of the invention are suitable for coating a cell culture support for growing anchor-dependant cell types. Further, the RGD-enriched gelatines of the invention may find use in medical applications, in particular as a coating on implant or transplant material or as a component of drug delivery systems.11-06-2008
20080274952Amylin Family Peptides And Methods For Making And Using Them - The present invention relates to obesity related polypeptides (ORPs), related nucleic acids, expression constructs, host cells, and processes production of the obesity related polypeptides. The ORPs of the invention include one or more amino acid sequence modifications. In addition, methods and compositions are disclosed to treat and prevent metabolic disorders such as obesity, diabetes, and increased cardiovascular risk.11-06-2008
20090099083COMPOSITIONS FOR ELICITING AN IMMUNE RESPONSE AGAINST MYCOBACTERIUM AVIUM SUBSPECIES PARATUBERCULOSIS - Provided are compositions and methods for stimulating an immune response against 04-16-2009
20100137215NOVEL TETRAHYDRO-1H-PYRIDO[4,3-B]INDOLES - This invention relates to novel tetrahydro-1H-pyrido[4,3-b]indoles, their derivatives and pharmaceutically acceptable salts thereof. This invention also provides compositions comprising a compound of this invention and the use of such compositions in methods of treating diseases and conditions that are beneficially treated by NMDA antagonists, acetylcholinesterase inhibitors, 5-HT6 antagonists, other neuroprotectors, antihistamines and agents that delay age-related pathologies and conditions.06-03-2010
20090062204COMPOSITIONS AND METHODS FOR TREATING AND PREVENTING GASTROENTERIC DISEASES - A model system to study extracellular enteric bacterial pathogen (e.g., 03-05-2009
20090005297Aprotinin Variants - The present invention relates to the field of proteins that inhibit serine protease activity. The invention also relates to the field of nucleic acid constructs, vectors and host cells for producing serine protease inhibiting proteins, pharmaceutical compositions containing such proteins, and methods for their use.01-01-2009
20090170773NOVEL USE OF G-PROTEIN-CONJUGATED RECEPTOR AND LIGAND THEREOF - The present invention provides a screening method for a substance that alters the bindability of RAIG2 or RAIG3 and glucose or 1,5-anhydroglucitol, including using RAIG2 or RAIG3 and glucose or 1,5-anhydroglucitol, and a regulator of sugar/lipid metabolism, a regulator of pancreas/pituitary function, a regulator of insulin secretion/blood glucose and ACTH secretion, and a prophylactic/therapeutic agent for a disease involved by an abnormality thereof, containing an RAIG2 or RAIG3 agonist or antagonist.07-02-2009
20090170778PYY Agonists and Uses Thereof - The invention provides PYY07-02-2009
20090170762Treatment of Diabetes Related Obesity - Peptide analogues and uses are provided for treating and preventing obesity and for treating, preventing and reversing weight gain and related metabolic disease, and promoting weight loss and weight maintenance, by administering a medicament comprising an antagonist of GIP receptor, which is a peptide analogue of GIP.07-02-2009
20090170774COMPOSITIONS AND METHODS FOR ENHANCING FERTILITY - Methods of promoting reproductive health in an animal by administering an effective amount of a composition containing at least one transfer factor are provided.07-02-2009
20090170776ANGIOGENICALLY EFFECTIVE UNIT DOSE OF FGF AND METHOD OF ADMINISTERING - The present invention has multiple aspects. In particular, in one aspect, the present invention is directed to a unit dose comprising 0.2 μg/kg to 36 μg/kg of a recombinant FGF or an angiogenically active fragment or mutein thereof. In another aspect, the present invention is directed to a pharmaceutical composition comprising an angiogenically effective dose of an FGF or an angiogenically active fragment or mutein thereof, and a pharmaceutically acceptable carrier. Typically, the angiogenically effective dose comprises 0.2 μg/kg to 36 μg/kg of an FGF of any one of SEQ ID NOS:1-3, 5, 8-10, or 12-14 or an angiogenically active fragment or mutein thereof. In yet another aspect, the present invention is directed to a method for treating a human patient for coronary artery disease, comprising administering into at least one coronary vessel of a human patient in need of treatment for coronary artery disease a safe and angiogenically effective dose of a recombinant FGF of any one of SEQ ID NOS:1-3, 5, 8-10, or 12-14, or an angiogenically active fragment or mutein thereof.07-02-2009
20090170767Soluble Endoglin Compounds for the Treatment and Prevention of Cancer - Disclosed herein are soluble endoglin compounds and kits, pharmaceutical compositions, and articles of manufacture containing soluble endoglin compounds. Also disclosed herein are methods for treating an angiogenesis disorder, such as cancer, using soluble endoglin compounds, provided alone or in combination with a chemotherapeutic agent, an angiogenesis inhibitor, or an antiproliferative compound.07-02-2009
20090170765PEPTIDE FOR INHIBITION OF CALCINEURIN - The present invention relates to a method for diagnosing susceptibility for a myocardial and/or immunological disorder, a kit and a therapeutic agent comprising a peptide of SEQ ID NO: 1 or 2 and uses thereof.07-02-2009
20090170759NEUROPROTECTIVE PEPTIDES - Methods of treating diseases of the nervous system by administration of compositions having the neurological therapeutic activity of human erythropoietin are disclosed. These compositions include therapeutic agents such as peptides, peptide dimers, polypeptides, and proteins that have the full range of biological activity of human erythropoietin or only certain biological activities of erythropoietin. Improved therapeutic regimens where the erythropoietin is administered at concentrations below those required to stimulate hematopoiesis are also provided.07-02-2009
20080280828Compositions Comprising Igbpma and Uses Thereof - The present invention relates generally to methods and materials for treating conditions associated with IgE activation in humans and animals, and to agents capable of modulating the activation. The agents of the invention comprise or are related to IGBPMA polypeptides from ticks.11-13-2008
20080280825Protective complement proteins and age-related macular degenration - Methods for identifying a subject at risk for developing AMD are disclosed. The methods include identifying specific protective or risk polymorphisms or genotypes from the subject's genetic material. Therapeutic compositions and methods are also provided for delaying the progression or onset of the development of AMD in a subject, including treating a subject having signs and/or symptoms of AMD or who has been diagnosed with AMD.11-13-2008
20080280822Nucleic acid and corresponding protein entitled 161P5C5 useful in treatment and detection of cancer - A novel gene (designated 161P5C5) and its encoded protein, and variants thereof, are described wherein 161P5C5 exhibits tissue specific expression in normal adult tissue, and is aberrantly expressed in the cancers listed in Table 1. Consequently, 161P5C5 provides a diagnostic, prognostic, prophylactic and/or therapeutic target for cancer. The 161P5C5 gene or fragment thereof, or its encoded protein, or variants thereof, or a fragment thereof, can be used to elicit a humoral or cellular immune response; antibodies or T cells reactive with 161P5C5 can be used in active or passive immunization.11-13-2008
20080287365DRUG AND METHOD FOR PROLIFERATING NATURAL KILLER CELLS - Natural Killer (NK) cells are obtained by administering a Toll-like receptor ligand such as polyinosinic-polycytidylic acid into the peritoneal cavity of an animal to which lactoferrin has been administered to proliferate NK cells in the peritoneal cavity and collecting NK cells from the peritoneal cavity.11-20-2008
20080287351Nfkb Transcriptional Activity Inhibitory Agent and Anti-Inflammatory Agent and a Steroid Action Enhancing Agent - It is intended to surely and effectively inhibit the transcriptional activity of NFκB and to obtain a more effective anti-inflammatory effect. Further, it is intended to obtain an equivalent effect even if the amount used of a steroid agent is reduced.11-20-2008
20080287355Amylin and Amylin Agonists For Treating Psychiatric Diseases and Disorders - Methods and compositions for treating psychiatric diseases and disorders are disclosed. The methods provided generally involve the administration of an amylin or an amylin agonist to a subject in order to treat psychiatric diseases and disorders, and conditions associated with psychiatric diseases and disorders.11-20-2008
20080287350Aequorin-Containing Compositions and Methods of Using Same - Compositions containing aequorin and methods for their use in preventing and/or alleviating symptoms and disorders related to calcium imbalance are provided by the present invention.11-20-2008
20080287352Anti-Histone H1 Monoclonal Antibody and Hybridoma for the Production Thereof - The present invention discloses anti-histone H1 monoclonal antibodies, hybridomas for the production thereof, and polypeptides, which are useful for suppressing, predicting, or diagnosing transplant rejection in organ transplantation.11-20-2008
20080287359CADHERIN-11-MEDIATED MODULATION OF HAIR GROWTH - The present invention provides for methods of inhibiting hair growth, comprising decreasing the level of CAD1 1 mRNA and/or protein in hair follicle cells of a subject. The present invention further provides for methods of promoting hair growth, comprising increasing the level of CADI 1 mKNA and/or protein in hair follicle cells of a subject. The invention also provides for transgenic animals with aberrancies in CADI 1 expression, and for assay systems (including transgenic animals and cell-based systems) that may be used to identify agents that decrease or increase CADI 1 expression.11-20-2008
20080287362Compositions and Methods for the Detection of Trypanosoma Cruzi Infection - Compositions comprising fusion polypeptides of 11-20-2008
20080287360COMPOSITIONS AND METHODS FOR TREATING MALARIA WITH CUPREDOXIN AND CYTOCHROME - The present invention relates to cupredoxin and cytochrome and their use, separately or together, to inhibit the spread of parasitemia in mammalian red blood cells and other tissues infected by the malaria parasite, and in particular the parasitemia of human red blood cells by 11-20-2008
20080287356Chimeric Proteins, Their Preparation and Pharmaceutical Compositions Containing Them - The present invention relates to a chimeric protein comprising a cell-targeting agent and a 11-20-2008
20080287358Regulatory T Cell Mediator Proteins and Uses Thereof - The present invention relates to novel regulatory T cell proteins. One protein, designated PD-L3, resembles members of the PD-L1 family, and co-stimulates αCD3 proliferation of T cells in vitro. A second, TNF-like, protein has also been identified as being upregulated upon αCD3/αGITR stimulation. This protein has been designated T11-20-2008
20080287357Conjugate Comprising P21 Protein for the Treatment of Cancer - The P21 protein is used as a medicament in the treatment of cancer. A conjugate comprises a first region comprising the P21 protein, or a homologue or functional fragment thereof; and a second region comprising a translocation factor.11-20-2008
20080287353Peptides and proteins for early liver development and antibodies thereto - Early developing stage-specific liver proteins and the genes coding for them that have been isolated and sequenced are provided, and these genes and proteins can be utilized to diagnose and/or treat a wide variety of liver disorders and other ailments. Since the early developing liver proteins of the invention arise during embryogenesis when the liver and other organs are in transition from an undifferentiated state to a differentiated one, these proteins are involved in tissue differentiation and thus can be utilized in methods of diagnosing and treating a variety of liver diseases and other disorders including those relating to oncogenesis and tissue repair. Antibodies recognizing early developing liver proteins and peptides are also provided.11-20-2008
20080287349Fibroblast growth factor 20 and methods of use thereof - The present invention relates to compositions and methods for preventing and treating a disease (e.g., a joint disease, ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning, or neurodegenerative diseases). More particularly, the present invention provides methods for preventing and/or treating a disease (e.g., a joint disease, ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning, or neurodegenerative diseases) by using compositions comprising FGF-20, a fragment, a derivative, a variant, a homolog, or an analog thereof.11-20-2008
20080293634C-MET RECEPTOR REGULATION BY ANGIOTENSIN IV (AT4) RECEPTOR LIGANDS - The cell surface c-Met receptor, through which hepatocyte growth factor (HGF) signals are mediated, has now been identified as the Angiotensin-IV receptor (AT(4)R) in processes that include HGF-regulated cell motility, angiogenesis, cancer metastasis, adipogenesis and others. Disclosed are angiotensin-like factor compositions and methods for using them to diagnose, prevent and/or treat conditions associated with c-Met dysregulation, including cancer, obesity and conditions associated with obesity, and other disorders, for example, by altering hepatocyte growth factor activity or c-Met receptor activity by administering an angiotensin-like factor that specifically binds to a cell surface c-Met receptor.11-27-2008
20080293631Treatment for Autoimmune and Inflammatory Conditions - The present invention provides methods for preventing the elevation of blood glucose levels, for preventing or delaying the onset of autoimmune and inflammatory diseases or glucose-associated conditions, and for preventing or reducing inflammation in individuals suffering from an autoimmune or inflammatory diseases, the methods comprising administering to subjects in need thereof an effective amount of activated Protein C or precursor Protein C.11-27-2008
20080293626Pigment epithelium-derived factor as a therapeutic agent for vascular leakage - The present invention relates to method of treating a patient with a condition involving increased vascular permeability or increased angiogenesis comprising administering to the patient a therapeutically effective amount of PEDF, PEDF 44 AA peptide, a homolog of the PEDF 44 AA peptide, a homolog of the PEDF 44 AA peptide wherein amino acid residues glutamate the (101) amino acid position, isoleucine at the (103) amino acid position, leucine at the (112) and serine at the (115) amino acid position are unchanged, or an agent that activates the PEDF receptor. Conditions for treatment include, but are not limited to, sepsis acute respiratory distress syndrome, nephrotic syndrome, diabetic neuropathy, preproliferative diabetic retinopathy, cancer or proliferative diabetic retinopathy.11-27-2008
20080305995Royal Jelly Peptide and Composition Containing the Same - A royal jelly peptide which has a function as a queen bee's attraction cofactor and can enhance the biological defense system of an animal (an immunopotentiating effect); and a composition containing the same.12-11-2008
20080306003Novel Compositions and Methods for Promoting, Inhibiting and Detecting Protein Entry Into Cells - The invention features methods for identifying compounds that inhibit cell death, and methods for identifying compounds that promote cell death, by blocking or accelerating, respectively, the translocation of the catalytic domain of toxins or transcription factors through the endosomal membrane into the cytosol of a cell. Also featured are methods for inhibiting cell death that include the administration of polypeptides that include a toxin consensus sequence recognized by one or more components of the cytosolic translocation factor complex.12-11-2008
20080305996Novel tumor necrosis factor receptor homologs and nucleic acids encoding the same - The present invention is directed to novel polypeptides having homology to members of the tumor necrosis factor receptor family and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid sequences, chimeric polypeptide molecules comprising the polypeptides of the present invention fused to heterologous polypeptide sequences, antibodies which bind to the polypeptides of the present invention and to methods for producing the polypeptides of the present invention.12-11-2008
20080306001TRANSCRIPTIONAL MODULATION OF EXTRACELLULAR MATRIX (ECM) OF DERMAL FIBROBLASTS - The present invention includes peptides, compositions as well as their use for the prevention or treatment of various age related or pathological conditions of skin or other tissues including skin wrinkles, wounds, different types of fibrosis and methods of reconstructing different tissues such as techniques used in regenerative medicine. The invention further includes peptide mimetics and methods of use including interfering with transcriptional complexes characteristic of fibroblasts of aged skin and stimulating synthesis of structural components of extracellular matrix.12-11-2008
20080305999Therapeutic use of growth factor, and delivery device, especially for the treatment of intimal hyperplasia - Vascular endothelial growth factor (VEGF) has utility in the treatment of intimal hyperplasia, hypertension and atherosclerosis, and of conditions susceptible to treatment with agents that produce nitric oxide or prostacyclin. Instead of VEGF, an equivalent agent such as an agonist of VEGF receptors may be given, as may nucleic acid encoding such an agonist. The agent may successfully be administered via the adventitial surface of a blood vessel, e.g. using a device which defines a reservoir between the body wall and the vessel's adventitial surface, the reservoir being at least part-filled by a pharmaceutical formulation containing the agent to be delivered.12-11-2008
20080305997Modulation Of Cd4+ T Cell Responses By A Tick Saliva Protein, Salp15 And Polypeptides Derived Therefrom - Salp15, biologically functional equivalents and fragments thereof, and nucleic acid molecules encoding the same are disclosed. Recombinant host cells, recombinant nucleic acids and recombinant proteins are also disclosed. Salp15 gene products and Salp15 polypeptide fragments have biological activity in modulating CD4+ T cell activation through specific binding to CD4. Thus, therapeutic methods involving modulating T cell activation using Salp15 and biologically active polypeptide fragments thereof are also disclosed. The specific binding of Salp15 and fragment peptides thereof to CD4 can inhibit HIV infection of T cells, and thus methods of using Salp15 for inhibiting HIV infection are also disclosed. Screening methods for selecting substances having an ability to modulate activation of T cells are also disclosed.12-11-2008
20080306002Combination Therapy for Preventing Angiogenesis - The present invention is directed to a combination therapy for inhibiting angiogenesis in a subject having, or at risk of having, an angiogenic disease/disorder. The method comprises both administering to the mammal an inhibitor of HIF-I and administering a second compound or agent that inhibits angiogenesis such as an inhibitor of IL-8, VEGF, angiopoietins, EGF, FGF, TGF, G-CSF, or PDGF. Administration of an inhibitor of hypoxia inducible factor-1 (HIF-I) in combination with an inhibitor of interleukin 8 (IL-8) is particularly useful for treatment of colon cancer, lung cancer, pancreatic cancer, and breast cancer.12-11-2008
20100016232Treatment Of Inflammatory Diseases With Mammal Beta Defensins - The present invention relates to suppression of TNF-alpha activity with mammal beta defensins, which has utility in the treatment of pathological conditions associated with tumor necrosis factor alpha.01-21-2010
20080312151COMPOSITIONS AND METHODS INCLUDING EXPRESSION AND BIOACTIVITY OF BOVINE FOLLICLE STIMULATING HORMONE - The present invention provides methods of producing biologically active recombinant bFSH and methods of increasing reproduction in mammals, particularly bovine, using recombinant bFSH. Also provided are methods of producing single chain recombinant bFSH. The recombinant bFSH of the present invention increases superovulation, embryo development, and reproductive efficiency in cattle and other ungulates.12-18-2008
20080312149Health Food and Pharmaceutical Composition for Amelioration of Disease Induced by Metabolic Disorder in Cartilage - The invention relates to a health food and a pharmaceutical preparation, containing a composition for treating rheumatoid arthritis. The health food and pharmaceutical preparation in which glucosamine, a collagen and an isoflavone aglycone act synergically, which are useful for relieving symptoms or treatment of diseases related to abnormal cartilage metabolism, especially rheumatoid arthritis.12-18-2008
20080312148RECOMBINANT HUMAN INTERFERON-LIKE PROTEINS - This application relates to recombinant human interferon-like proteins. In one embodiment a recombinant protein created by gene shuffling technology is described having enhanced anti-viral and anti-proliferative activities in comparison to naturally occurring human interferon alpha 2b (HuIFN-α2b). The invention encompasses a polynucleotide encoding the protein and recombinant vectors and host cells comprising the polynucleotide. Preferably the polynucleotide is selected from the group of polynucleotides each having a sequence at least 93% identical to SEQ ID: No. 1 and the protein is selected from the group of proteins each having an amino acid sequence at least 85% identical to SEQ ID No: 2. The proteins and compositions comprising the proteins can be used for treatment of conditions responsive to interferon therapy, such as viral diseases and cancer.12-18-2008
20080312146METH1 and METH2 Polynucleotides and Polypeptides - The present invention relates to novel anti-angiogenic proteins, related to thrombospondin. More specifically, isolated nucleic acid molecules are provided encoding human METH1 and METH2. METH1 and METH2 polypeptides are also provided, as are vectors, host cells and recombinant methods for producing the same. Also provided are diagnostic methods for the prognosis of cancer and therapeutic methods for treating individuals in need of an increased amount of METH1 or METH2. Also provided are methods for inhibiting angiogenesis using METH1 or METH2.12-18-2008
20080312147Compositions and Methods for the Regulation of Hair Growth - A novel hair loss prevention and hair restoration composition, is applied topically to the scalp. The composition and methods of application stimulate the hair follicle, encourage angiogenesis, and improve blood circulation throughout the area where the composition is applied. Moreover, formation of di-hydroxytestosterone is inhibited using copper peptides that interfere with 5-α-reductase activity that would otherwise convert testosterone to di-hydroxytestosterone.12-18-2008
20080312144Peptides for the Treatment of Herpes Virus Infections - The present invention relates to the use of a peptide having the amino acid sequence12-18-2008
20080227711Cxc-Chemokine Antagonists - A novel CXC-chemokine binding protein is cloned from the salivary glands of 09-18-2008
20080214452METHOD FOR EFFECTING LOCALIZED, NON-SYSTEMIC AND SYSTEMIC, IMMUNOGENIC TREATMENT OF CANCER USING CRT TRANSLOCATION - Anthracyclines-treated tumor cells are particularly effective in eliciting an anti-cancer immune response, where the rDNA-damaging agents, such as etoposide and mitomycin C do not induce immunogenic cell death. Anthracyclines induce the rapid, pre-apoptotic translocation of calreticulin (CRT) to the cell surface. Blockade or knock down of CRT suppressed the phagocytosis of anthracyclines-treated tumor cells by dendritic cells and abolished their immunogenicity in mammals, such as mice. The anthracyclines-induced CRT translocation was mimicked by inhibition of the protein phosphatase1/GADD34 complex. Administration of recombinant CRT or inhibitors of protein phosphatase1/GADD34 restored the immunogenicity of cell death elicited by etoposide and mitomycin C, and enhanced their antitumor effects in vivo. These data identify CRT as a key feature determining anti-cancer immune responses and delineate a possible strategy for immunogenic chemotherapy.09-04-2008
20080207500Medicament - Analysis of a goat serum product with many therapeutic effects is described. The product is identified as containing proopiomelanocortin (POMC) and Corticotropin releasing factor (CRF) peptides, as well as breakdown products of these peptides. We describe methods of treatment of diseases including cancers, multiple sclerosis, and neural disorders using these peptides and their products, as well as medicaments including such peptides and methods of producing the peptides.08-28-2008
20080249018Exendin Analog Formulations - Novel formulations containing exendins, exendin agonists and/or exendin analogs are provided10-09-2008
20080261877Albumin Fusion Proteins - The present invention encompasses albumin fusion proteins. Nucleic acid molecules encodings the albumin fusion proteins of the invention are also encompassed by the invention, as are vectors containing these nucleic acids, host cells transformed with these nucleic acids vectors, and methods of making the albumin fusion proteins of the intention and using these nucleic acids, vectors, and/or host cells. Additionally the present invention encompasses pharmaceutical compositions comprising albumin fusion proteins and methods of treating, preventing, or ameliorating diseases, disorders or conditions using albumin fusion proteins of the invention.10-23-2008
20080274972T-CELL EPITOPE PEPTIDES - The T-cell epitope site on a Japanese cypress (hinoki) pollen allergen molecule has been identified by stimulating a T-cell line established from a patient suffering from Japanese cypress pollen allergy with an overlap peptide covering the primary structure of the Japanese cypress pollen allergen. The peptide is useful in peptide-based immunotherapy for patients with spring tree pollinosis including patients with Japanese cypress pollinosis having cross reactivity with Japanese cypress pollen. The peptide is also useful for diagnosing spring tree pollinosis.11-06-2008
20080269115Immunogenic Sars Domain - Potentially antigenic, conserved and specific SARS-CoV peptides are disclosed. The disclosed polypeptides may be used in a variety of diagnostic and treatment methods for SARS infection.10-30-2008
20090018071EPIDIDYMIS-SPECIFIC RECEPTOR PROTEIN - The present invention relates to a novel transmembrane receptor protein which is specific to the mammalian epididymis, DNA sequences which code for the protein and specific ligands and to the use thereof for the preparation of agents for diagnosis of male infertility and for controlling maturation of spermatozoa.01-15-2009
20080214455Novel Chemical Compounds - This invention relates to newly identified compounds for inhibiting hYAK3 proteins and methods for treating diseases associated with hYAK3 activity.09-04-2008
20090005295Syndecans and angiogenesis - The invention provides methods and materials related to modulating syndecan levels and angiogenesis in an animal. The invention provides syndecan polypeptides and nucleic acids encoding syndecan polypeptides, including dominant negative syndecan polypeptides. The invention also provides polynucleotides and polynucleotide analogues for modulating angiogenesis, as well as cells and embryos containing the polynucleotides and polynucleotide analogues. The invention further provides methods for identifying syndecan- and angiogenesis-modulating agents.01-01-2009
20080318854Method for regulating neurite growth - This invention relates to a method of inhibiting neuronal cell death, including protecting neronal cells from cell death and the effects of stress, such as high or low pH, comprising administering to the cells an effective amount of Teneurin C-terminal Associated Peptide (TCAP). The invention provides the use of TCAP to prevent and/or treat a number of brain conditions, such as hypoxiaischemia and brain alkalosis or various brain or spinal cord injuries due to physical or physiological stresse. In one aspect the invention provides a use of TCAP to increase β-tubulin, β-actin levels in neuronal cells and/or to increase fasciculation among neuronal cells, in culture or in tissue. In another aspect, the invention provides a method of treating various pH induced neuronal conditions.12-25-2008
20080274960Fibrosis Inhibitor for Implanted Organ - A pharmaceutical preparation comprising a hepatocyte growth factor or a DNA molecule encoding the same and the like according to the present invention can suppress the fibrosis of a transplanted organ after organ transplantation. The present invention is useful in the fields of organ transplantation and regeneration therapy.11-06-2008
20080242604Human Nodal and Lefty Homologues - The present invention relates to novel Nodal and Lefty proteins which are members of the TGF-β family. In particular, isolated nucleic acid molecules are provided encoding the human Nodal and Lefty proteins. Nodal and Lefty polypeptides are also provided as are vectors, host cells and recombinant methods for producing the same. The invention further relates to screening methods for identifying agonists and antagonists of Nodal and Lefty activity. Also provided are diagnostic methods for detecting cell growth and differentiation-related disorders and therapeutic methods for treating cell growth and differentiation-related disorders.10-02-2008
20080287354Prosaposin as a neurotrophic factor - Prosaposin, saposin C and various peptide fragments of saposin C stimulate neurite outgrowth in vitro. In addition, prosaposin and saposin C promote increased myelination ex vivo. Prosaposin is present in large neurons of the brain, including both upper and lower motor neurons.11-20-2008
20080249009Lipoprotein-Regulating Medicaments - Methods and pharmaceutical compositions useful for treating obesity-related disorders using ApM-1 and related proteins.10-09-2008
20080207497CYTOTOXIC T-LYMPHOCYTE-INDUCING IMMUNOGENS FOR PREVENTION, TREATMENT, AND DIAGNOSIS OF CANCER - The present invention relates to compositions and methods for the prevention, treatment, and diagnosis of cancer, especially carcinomas, such as ovarian carcinoma. The invention discloses peptides, polypeptides, and polynucleotides that can be used to stimulate a CTL response against cancer.08-28-2008
20080274969Albumin-Fused Kunitz Domain Peptides - The invention relates to proteins comprising serine protease inhibiting peptides, such as Kunitz domain peptides (including, but not limited to, fragments and variants thereof) fused to albumin, or fragments or variants thereof. These fusion proteins are herein collectively referred to as “albumin fusion proteins of the invention.” These fusion proteins exhibit extended shelf-life and/or extended or therapeutic activity in solution. The invention encompasses therapeutic albumin fusion proteins, compositions, pharmaceutical compositions, formulations and kits. The invention also encompasses nucleic acid molecules and vectors encoding the albumin fusion proteins of the invention, host cells transformed with these nucleic acids and vectors, and methods of making the albumin fusion proteins of the invention using these nucleic acids, vectors, and/or host cells. The invention also relates to compositions and methods for inhibiting neutrophil elastase, kallikrein, and plasmin. The invention further relates to compositions and methods for treating cystic fibrosis and cancer.11-06-2008
20080214458SYNAPSE-SPECIFIC PROTEINS IN GLOMERULI - The present invention identifies that glomeruli express many neuron-specific and especially synapse-specific protein similarities. In particular, the present invention identifies Rab3A expression, including the expression of altered forms, as well as expression of other synapse-specific proteins including neurotransmitter receptors. The invention further identifies that modulation of the activity of these synapse-specific proteins results in modulation of podocytes.09-04-2008
20080287361Compositions and methods of using CRMP-1 and its fragments for treating cancer - The present invention discloses a method for treating cancer by using hCRMP1 and/or active fragments thereof, as well as the active fragments of hCRMP1 that are capable of inhibiting cell proliferation, invasive activity, and metastasis of cancer. The method can also be used prior to, or in combination with, the administration a chemotherapy agent. A vector capable of expressing an hCRMP1, a variant of hCRMP1, a fragment of hCRMP1 or a variant of a fragment of hCRMP1 is also disclosed.11-20-2008
20080269122Antimicrobial Peptide Biocides - The present invention relates to retroviral constructs that encode novel monoclonal antibodies, novel fusion proteins, and chimeric monoclonal antibodies and to methods of using and producing the same. In particular, the present invention relates to methods of producing a fusion protein comprising a microorganism targeting molecule (e.g., immunoglobulin or innate immune system receptor molecule) and a biocide (e.g., bactericidal enzymes) in transgenic animals (e.g., bovines) and in cell cultures. The present invention also relates to therapeutic and prophylactic methods of using a fusion protein comprising a microorganism targeting molecule and a biocide in health care (e.g., human and veterinary), agriculture (e.g., animal and plant production), and food processing (e.g., beef carcass processing). The present invention also relates to methods of using a fusion protein comprising a microorganism targeting molecule and a biocide in various diagnostic applications in number of diverse fields such as agriculture, medicine, and national defense.10-30-2008
20080280832Novel Fsh Glycosylation Variant D3n - FSH mutant with increased glycosylation and longer half-life is described. The use of this FSH mutant for inducing folliculogenesis in human patients is also described.11-13-2008
20080269113P53 BINDING T CELL RECEPTOR MOLECULES - The invention provides T-cell receptor (TCR) molecules comprising a Vα chain and a Vβ chain that bind peptides derived from the p53 protein, preferably, the human p53 protein. The TCR molecules include both heterodimeric molecules and single chain molecules which specifically bind a sequence preferably spanning about amino acid positions 264-272 of the p53 protein displayed in the context of an HLA molecule, preferably, HLA-A2.1. Also disclosed are methods for making and using such TCR molecules. The invention has a wide spectrum of useful application including therapeutic uses and use in the detection of cells expressing p53 protein.10-30-2008
20080287363Novel Cc-Chemokine Antagonists - A novel CC-chemokine binding protein is isolated from the saliva of 11-20-2008
20080207505Bna Conjugates and Methods of Use - Modified natriuretic compounds and conjugates thereof are disclosed in the present invention. In particular, conjugated forms of hBNP are provided that include at least one modifying moiety attached thereto. The modified natriuretic compound conjugates retain activity for stimulating cGMP production, binding to NPR-A receptor, decreasing arterial blood pressure and in some embodiments an improved half-life in circulation as compared to unmodified counterpart natriuretic compounds. Oral, parenteral, enteral, subcutaneous, pulmonary, and intravenous forms of the compounds and conjugates may be prepared as treatments and/or therapies for heart conditions particularly congestive heart failure. Modifying moieties comprising oligomeric structures having a variety of lengths and configurations are also disclosed. Analogs of the hBNP compound are also disclosed, having an amino acid sequence that is other than the native sequence.08-28-2008
20080274965ENCAPSULATED AMYLOID-BETA PEPTIDES - The present invention relates to the field of polymer chemistry and more particularly to encapsulated peptides and uses thereof.11-06-2008
20100144627METHODS FOR MODULATING SET AND USES THEREOF - The present invention provides methods for modulating SET activity by contacting SET with a binding agent such as an ApoE peptide derivative. In one embodiment of the invention, a pharmaceutical composition capable of modulating SET activity is administered to a patient for the treatment of an inflammatory or neurological condition. In another embodiment of the invention, compounds efficacious for the treatment of inflammatory and neurological conditions are identified by screening for a binding agent capable of competing with or inhibiting the binding of an ApoE derivative to SET.06-10-2010
20100144618Compositions containing an intestinal trefoil peptide and a mucoadhesive - The invention features compositions containing an intestinal trefoil peptide and a mucoadhesive excipient. Such compounds are useful, e.g., for the treatment or prevention of lesions. Compositions containing an intestinal trefoil peptide and a mucoadhesive excipient may be formulated in combination with one or more additional therapeutic agents.06-10-2010
20100144626Treatment of Multi-Drug Resistant Bacterial Infections - There is described an imidazole for the treatment of an infection caused or contributed to by microorganisms resistant to antibiotics. There is also described a method of treating a patient suffering from an infection caused or contributed to by microorganisms resistant to antibiotics, said method comprising the step of administering an effective amount of an imidazole.06-10-2010
20100144620COMPLEMENTATION OF FACTOR XI DEFICEINCY BY FACTOR V MUTANTS - Described are methods for preventing and/or treating bleeding in a subject with Factor XI deficiency, such as hemophilia C, which methods comprise administering to the subject APC-resistant Factor V.06-10-2010
20100184679USE OF A COMBINATION OF CART PEPTIDES AS A THERAPEUTIC AGENT - The present invention is directed to the use of the combination of the Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-OH and Val-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH as a therapeutic combination for prophylaxis and/or treatment of cancer, a heart and vascular disease, an infectious disease, a fibrotic disease, an inflammatory disease, a neurodegenerative disease, or an autoimmune disease.07-22-2010
20080269134DISODIUM SALTS, MONOHYDRATES, AND ETHANOL SOLVATES FOR DELIVERING ACTIVE AGENTS - The inventors have discovered that the disodium salt of certain delivery agents has surprisingly greater efficacy for delivering active agents than the corresponding monosodium salt. Furthermore, the inventors have discovered that the disodium salts of these delivery agents form solvates with ethanol and hydrates with water. The delivery agents have the formula10-30-2008
20080269133COMPOSITIONS AND METHODS OF USE OF EPB1, AND ERBB3 BINDING PROTEIN - Inhibition of the proliferation of hormone refractory prostate cancer cells is achieved by administering EPB1, an ErbB3 binding protein, in combination with another anti-proliferation therapy such as administration of antiandrogens, other anticancer agents, radiation therapy, or surgery. Administration of EPB1 reverses the phenotype of hormone-resistant prostate cancer cells to hormone-sensitive prostate cancer cells.10-30-2008
20080269127Albumin Fusion Proteins - The present invention encompasses albumin fusion proteins. Nucleic acid molecules encodings the albumin fusion proteins of the invention are also encompassed by the invention, as are vectors containing these nucleic acids, host cells transformed with these nucleic acids vectors, and methods of making the albumin fusion proteins of the intention and using these nucleic acids, vectors, and/or host cells. Additionally the present invention encompasses pharmaceutical compositions comprising albumin fusion proteins and methods of treating, preventing, or ameliorating diseases, disorders or conditions using albumin fusion proteins of the invention.10-30-2008
20080269126Albumin Fusion Proteins - The present invention encompasses albumin fusion proteins. Nucleic acid molecules encoding the albumin fusion proteins of the invention are also encompassed by the invention, as are vectors containing these nucleic acids, host cells transformed with these nucleic acids vectors, and methods of making the albumin fusion proteins of the invention and using these nucleic acids, vectors, and/or host cells. Additionally the present invention encompasses pharmaceutical compositions comprising albumin fusion proteins and methods of treating, preventing, or ameliorating diseases, disorders or conditions using albumin fusion proteins of the invention.10-30-2008
20080269119Ophthalmic Device and Related Methods and Compositions - Devices, methods, and compositions for improving vision or treating diseases, disorders or injury of the eye are described. Ophthalmic devices, such as corneal onlays, corneal inlays, and full-thickness corneal implants, are made of a material that is effective in facilitating nerve growth through or over the device. The material may include an amount of collagen greater than 1% (w/w), such as between about 10% (w/w) and about 30% (w/w). The material may include collagen polymers and/or a second biopolymer or water-soluble synthetic polymer cross-linked using EDC/NHS chemistry. The material may additionally comprise a synthetic polymer. The devices are placed into an eye to correct or improve the vision of an individual or to treat a disease, disorder or injury of an eye of an individual.10-30-2008
20080269117Preparation for Use of Aspartate for Regulating Glucose Levels in Blood - The invention relates to the use of specific protein and/or peptide fractions having a high aspartate content for regulating plasma glucose concentrations and increasing insulin sensitivity in a mammal. The invention relates to a complete food fortified with aspartate equivalents as well as a supplement rich in aspartate equivalents that is given simultaneously with or even minutes up to an hour prior to the consumption of a meal comprising glucose. The nutritional or pharmaceutical composition contains at least one protein having a high aspartate content, preferably of soy or dairy origin, which is further enriched with aspartate equivalents from another protein and/or free aspartate equivalents. The protein fraction comprises glutamate equivalents in a weight ratio of aspartate equivalents to glutamate equivalents (asp:glu) between 0.41:1 and 5:1.10-30-2008
20080269114Y4 Selective Receptor Agonists For Thereapeutic Interventions - Y4 receptor agonists selective for the Y4 receptor over the Y1 and Y2 receptors are useful for treatment of conditions responsive to activation of Y4 receptors. The Y4 selective agonists (a) are PP-fold peptide or PP-fold peptide mimics which have C— and N-terminal sequence features as specified in the description or (b) have an covalent intramolecular link, or (c) comprise two covalently linked C-terminal Y4 receptor-recognition amino acid sequences each of which comprises the last four residues of a C-terminal receptor recognition sequence of the type (a) agonists.10-30-2008
20080269121Methods and Compositions Involving A1c Subunit of L-Type Calcium Channels in Smooth Muscle Cells - The present invention concerns methods and composition for modulating the level of gene expression of the α10-30-2008
20080269132USE OF LOW TEMPERATURE AND/OR LOW PH IN CELL CULTURE - The present invention provides a novel method of reducing protein misfolding and aggregation in the cell culture by growing the cell culture at a reduced temperature and/or reduced pH. As a result, the quality of the protein produced in the cell culture is greatly improved. Thus, the present invention facilitates improvements in the efficacy of therapeutic proteins produced in cell culture.10-30-2008
20080269124Stabilizer Molecule-Enriched Albumin Solution - The invention concerns a method for producing an aqueous albumin solution from a starting albumin solution which contains stabilizer molecules which are capable of occupying binding sites of the albumin, wherein in a method for increasing the albumin binding capacity (ABiC) for other molecules, at least a portion of the stabilizer molecules is removed from the albumin of the starting albumin solution and separated from the starting albumin solution. To carry out such a method, by means of which a stabilized commercial starting albumin solution can be prepared in a manner which is simpler, faster, cheaper and in a manner which is gently on the albumin by removing the majority of the stabilizers and increasing the albumin binding capacity, the method comprises steps in which the starting albumin solution is brought into contact with a solid adsorption material the affinity of which for at least a portion, preferably all of the stabilizer molecules is higher than the affinity of the albumin for the corresponding stabilizer molecules, and the albumin is separated from the adsorption material; wherein the method is carried out at a pH of >3.10-30-2008
20080269116Methods of Inhibiting Proinflammatory Cytokine Expression Using Ghrelin - The present invention provides a method of inhibiting proinflammatory cytokine expression using ghrelin.10-30-2008
20090156501IDENTIFICATION OF LIGANDS BY SELECTIVE AMPLIFICATION OF CELLS TRANSFECTED WITH RECEPTORS - The invention is directed to a method for identifying substances acting as ligands for transfected receptors by using transfected markers to measure receptor/ligand interactions. The present invention also relates to a method of identifying compounds which act as inverse agonists of the 5-HT2A receptor, the method comprising contacting a constitutively active 5-HT2A receptor with at least one test compound and determining any decrease in the amount of basal activity of the receptor so as to identify a test compound which is an inverse agonist of the 5-HT2A receptor. Such inverse agonists may be used in the treatment of schizophrenia and related psychoses.06-18-2009
20090156484Use of Transferrins for Treating Destructive Inflammation of Mucous Membrane - Use of at least one transferrin, preferably lactoferrin, for preventing and/or treating destructive inflammation affecting mucous membranes, optionally associated with states of hypoferremia and/or anemia and/or acute and chronic infections. The destructive inflammation is caused, for example, by pathological conditions during pregnancy and by infections sustained by intracellular or adhered or biofilm-protected pathogens. The action of the transferrins described here is achieved by means of their topical and/or oral administration. A combined preparation for simultaneous, sequential or separate use is also described which comprises, as active components, a first composition for topical administration of at least one transferrin and a second composition for oral administration of at least one transferrin.06-18-2009
20090156479Methods and Means for Controlling the Endocytosis and Subsequent Degradation of a Cell Surface Protein - The invention relates to the field of regulating metabolic processes, for example to regulate the presence and/or activity of a receptor at the surface of a cell. The invention provides a method for controlling the presence of a receptor at the surface of a cell comprising interfering with the interaction of an F-box protein with a ubiquitin/proteasome binding site of said receptor, wherein said ubiquitin/proteasome binding site comprises the amino acid sequence motif xDSWxEFIxxD or a sequence essentially corresponding thereto. The invention further provides a method for controlling the presence of a growth hormone receptor (GHR) at the surface of a cell comprising interfering with the interaction of an F-box protein with a ubiquitin/proteasome binding site of said GHR.06-18-2009
20090305989COMPOSITION AND METHOD FOR POTENTIATING DRUGS - A method of potentiating the activity of a drug which affects the central nervous system (CNS) comprising systemically administrating to a subject said drug together with an effective amount of a compound which stimulates peripheral chemoreceptors of vagal afferents and, optionally, with an effective amount of a stimulator of peripheral osmoreceptors of vagal afferents. Also disclosed are pharmaceutical compositions for systemic administration comprising a CNS drug together with the aforementioned compounds.12-10-2009
20090305988MODIFIED PEPTIDE OF HUMAN ACIDIC FIBROBLAST GROWTH FACTOR - An modified peptide of human acidic fibroblast growth factor (aFGF), comprising a native human aFGF shortened by a deletion of a deletion of 20 amino acids from N-terminal of the native human aFGF, and an addition of alanine (Ala) before the shortened native aFGF is provided.12-10-2009
20100137214CHIMERIC HIRUDIN PROTEINS - The present invention relates to a chimeric hirudin protein comprising a carrier attached to the N-terminus of hirudin, with an intervening plasmin cleavage site. The chimeric hirudin protein contains a relatively inactive form of hirudin. However, when such chimeric hirudin protein being cleaved by plasmin in the vicinity of a clot and, ultimately causing the release of active hirudin and the reduction of the size of the clot. The chimeric hirudin protein exhibited much slower clearance in mice than unfused wild-type hirudin.06-03-2010
20090264368COMPOSITIONS FOR DELIVERING PARATHYROID HORMONE AND CALCITONIN - The present invention relates to a composition comprising a delivery agent, parathyroid hormone, and calcitonin. This composition exhibits increased delivery of parathyroid hormone and/or calcitonin and is useful for the treatment of osteoporosis. The composition also permits simultaneous oral delivery of parathyroid hormone and calcitonin. The composition of the present invention may be formulated into a dosage unit form, such as an oral dosage unit form. The invention also provides a method for administering parathyroid hormone and calcitonin to an animal in need thereof by administering the composition of the present invention.10-22-2009
200902643675-CNAC AS ORAL DELIVERY AGENT FOR PARATHYROID HORMONE FRAGMENTS - Pharmaceutical compositions for the effective oral delivery of a parathyroid hormone, PTH, as well as methods for administration of the compositions are provided. Additionally, methods for stimulating new bone formation and treating and/or preventing osteoporosis are also provided.10-22-2009
20090305984Engineered CXCL 12 alpha locked dimer polypeptide - The present invention provides a novel CXCL12-α12-10-2009
20090264360Cloning and expression of gonadotropin-releasing hormone (GnRH) receptors - An isolated and purified GnRH protein receptor protein including an amino acid sequence selected from the group and an isolated and purified DNA which comprises a nucleotide sequence coding for the GnRH protein receptor protein. Also, a vector comprising the DNA of the GnRH protein receptor protein, a transformant carrying the vector comprising the DNA of the GnRH protein receptor protein, a process for producing a GnRH protein receptor protein or a salt thereof including culturing the transformant carrying the vector comprising the DNA of the GnRH protein receptor protein under sufficient conditions and for appropriate time to express the GnRH protein receptor protein, and a method of screening for a ligand to the GnRH protein receptor protein including contacting the GnRH protein receptor protein or a salt thereof with a sample to be tested. A screening method for a compound capable of inhibiting binding of the GnRH protein receptor protein with a ligand. Also, a kit for screening a compound capable of inhibiting binding of the GnRH protein receptor protein with a ligand including the GnRH protein receptor protein or a salt.10-22-2009
20090264365CONFORMATIONALLY CONSTRAINED PARATHYROID HORMONE (PTH) ANALOGS - The present invention relates to conformationally constrained parathyroid hormone (PTH) analogs, and methods of preparing and using the PTH analogs. The invention provides novel PTH polypeptide derivatives containing amino acid substitutions at selected positions in the polypeptides. The invention provides derivatives of PTH(1-34), PTH(1-21), PTH(1-20), PTH(1-19), PTH(1-18), PTH(1-17), PTH(1-16), PTH(1-15), PTH(1-14), PTH(1-13), PTH(1-12), PTH(1-11), and PTH(1-10) polypeptides, wherein at least one residue in each polypeptide is a helix, preferably an α-helix, stabilizing residue. The invention also provides methods of making such peptides. Further, the invention encompasses compositions and methods for use in limiting undesired bone loss in a vertebrate at risk of such bone loss, in treating conditions that are characterized by undesired bone loss or by the need for bone growth, e.g., in treating fractures or cartilage disorders and for raising cAMP levels in cells where deemed necessary.10-22-2009
20090264364GENES IMPLICATED IN THE REGULATION OF ANGIOGENESIS, PHARMACEUTICAL PREPARATIONS CONTAINING THEM AND THEIR APPLICATIONS - Therapeutic compositions used in the field of angiogenesis include nucleotide sequences of genes, the involvement of the genes in the angiogenesis mechanism having been demonstrated by the Applicant, and including the complementary sequences thereof, the antisense sequences of same, polypeptide sequences coded by the coding parts of the aforementioned genes and antibodies that are directed against the polypeptide sequences and also relate to genetically-modified cells that underexpress or overexpress the above-mentioned genes and to therapeutic compositions containing the cells, which are used to treat angiogenic disorders, and, moreover, relate to methods of diagnosing and/or prognosticating antigenic disorders and to novel methods of screening active compounds in the treatment of the disorders.10-22-2009
20090264363Leucine-Rich Peptide Compositions and Methods for Isolation - Disclosed are compositions comprising isolated peptides having a leucine content of from about 12 to about 40 weight percent. Also disclosed is a method for isolating leucine-rich peptides from protein sources such as bovine whey and methods of use for these peptides to provide beneficial effects in a human and/or animal such as increasing blood flow, decreasing blood pressure, increasing muscle mass, improving cognitive function, improving cardiovascular function, etc.10-22-2009
20090264362Influenza virus inhibiting peptides - The present invention provides a pharmaceutical composition for the treatment or prevention of an influenza infection. The composition comprises an isolated polypeptide including a sequence of at least 8 contiguous amino acid residues of the fusion initiation region (FIR) of an influenza hemagglutinin 2 protein or a peptide analog of the sequence. The FIR is a segment of the full length hemagglutinin 2 protein which is bounded by an amino-terminal region within the amino-terminal alpha-helix thereof and a carboxy terminus within the carboxy-terminal alpha-helix thereof, with a cysteine loop therebetween. The amino-terminal region of the FIR comprises a portion of the final 10 to 20 amino acid residues of the amino-terminal alpha-helix of the hemagglutinin 2 protein, and includes 3 or 4 hydrophobic amino acid residues, a positively-charged amino acid residue, a negatively-charged amino acid residue, and an aromatic amino acid residue. The carboxy terminus of the FIR is the carboxy terminus of the first peptide sequence of the hemagglutinin 2 protein beyond the amino terminal helix, which exhibits a positive Wimley-White interfacial hydrophobicity.10-22-2009
20090264361Identification of a family of secreted proteins in vascular endothelium - The invention relates to SCUBE molecules and generally to gene expression in vascular endothelial cells. The invention specifically relates to the discovery of a novel gene family containing the genes and proteins referred to herein as SCUBE1, SCUBE2 and SCUBE3 which can be expressed in endothelial cells. SCUBE proteins may be involved in the development of cardiovascular disease, hemostasis, thrombosis, inflammatory disease, bone metabolism disorders, urinary bladder disorders and breast disorders.10-22-2009
20090264359FPLR-1 INHIBITORS FOR USE IN DISEASES INVOLVING AMYLOID-INDUCED INFLAMMATORY EVENTS (FLIPR AND FLIPR-LIKE) AND IMMUNECOMPLEX-MEDIATED DISEASES - The present invention relates to a FPLR-1 inhibitor selected from the group consisting of FLIPr having the amino acid sequence MKKNITKTIIASTVIAAGLLTQTN10-22-2009
20090264357NOVEL AGENT THAT INHIBITS ANGIOGENESIS AND METASTASIS TARGETING mTOR SIGNALING PATHWAY - The present invention relates to a novel function of Msx1 protein for inhibiting tumor angiogenesis and metastasis by targeting mTOR (mammalian target of rapamycin) signaling pathway, and for treating a cancer in a subject. Particularly, Msx1 suppresses mTOR through a direct interaction with mTOR, resulting in the inhibition of angiogenesis. The Msx1 significantly suppresses tumor angiogenesis that is necessary for the growth, invasion, and metastasis of solid tumors. Ad-Msx1 can be used to effectively inhibit tumor metastasis by suppressing angiogenesis, tumor cell invasion, and migration.10-22-2009
20090264356Adenovirus 36 E4 orf 1 Gene and Protein and Their Uses - Expression of the E4 orf 1 gene of Ad-36 alone has been discovered to be responsible for the increased insulin sensitivity observed in Ad-36 infected animals, including increased adipogenesis. Ad-36 E4 orf 1 protein can be used to increase insulin sensitivity and ameliorate diabetes. Additionally, drugs that mimic the action of Ad-36 E4 orf 1 protein could be found. Ad-36 E4 orf 1 could also be used to increase fat cells in lipodystrophy. We have also discovered that Ad-36 infection in human skeletal muscle cells increased differentiation and insulin independent glucose uptake. It is expected that infection with Ad-36 E4 orf 1 gene will also cause these effects.10-22-2009
20090264353Splice Switching Oligomers for TNF Superfamily Receptors and their Use in Treatment of Disease - The present invention relates to compositions and methods for preparing splice variants of TNFalpha receptor (TNFR) in vivo or in vitro, and the resulting TNFR protein variants. Such variants may be prepared by controlling the splicing of pre-mRNA molecules and regulating protein expression with splice switching oligonucleotides or splice switching oligomers (SSOs). The preferred SSOs according to the invention target exon 7 or 8 of TNFR1 (TNFRSF1A) or TNFR2 (TNFRSF1A) pre-mRNA, typically resulting in the production of TNFR variants which comprise a deletion in part or the entire exon 7 or 8 respectfully. SSOs targeting exon 7 are found to result in a soluble form of the TNFR, which has therapeutic benefit for treatment of inflammatory diseases. The SSO's are characterized in that they are substantially incapable or incapable of recruiting RNaseH.10-22-2009
20090264354Penumbra Nucleic Acid Molecules, Proteins and Uses Thereof - The present invention relates to murine and human Penumbra (for proerythroblast nu[new] Membrane) nucleic acid molecules, proteins and the uses thereof. The invention further relates to the use of Penumbra molecules for the detection of 7q31q32-related deletions, including such deletions associated with myeloid malignancies, particularly detection by hybridization using Penumbra-based probes.10-22-2009
20090264350Kallikrein inhibitors and anti-thrombolytic agents and uses thereof - Methods, kits and compositions are described that include a non-naturally occurring kallikrein inhibitor and an anti-thrombolytic agent, e.g., an anti-fibrinolytic agent, for preventing or reducing blood loss and/or ischemia, e.g., ischemia associated with perioperative blood loss and cerebral ischemia, the onset of systemic inflammatory response, and/or reperfusion injury, e.g., reperfusion injury associated with cerebral ischemia or a focal brain ischemia, e.g., in patients subjected to invasive surgical procedures, especially procedures requiring cardiopulmonary bypass.10-22-2009
20090264352USE OF GLP-1 AND AGONISTS THEREOF TO PREVENT CARDIAC MYOCYTE APOPTOSIS - The present invention relates generally to the novel use of GLP-1, including analogs, and agonists, to prevent cardiac myocyte apoptosis. The present invention relates to methods for using GLP-1 for the treatment of conditions associated with cardiac myocyte apoptosis. The present invention further relates to improving the efficiency of cardiac myocytes and also to improving cardiac contractility.10-22-2009
20090264351ANTIFUNGAL POLYPEPTIDES - Compositions and methods for protecting a plant from a pathogen, particularly a fungal pathogen, are provided. Compositions include novel amino acid sequences, and variants and fragments thereof, for antipathogenic polypeptides that were isolated from microbial fermentation broths. Nucleic acid molecules comprising nucleotide sequences that encode the antipathogenic polypeptides of the invention are also provided. A method for inducing pathogen resistance in a plant using the nucleotide sequences disclosed herein is further provided. The method comprises introducing into a plant an expression cassette comprising a promoter operably linked to a nucleotide sequence that encodes an antipathogenic polypeptide of the invention. Compositions comprising an antipathogenic polypeptide or a transformed microorganism comprising a nucleic acid of the invention in combination with a carrier and methods of using these compositions to protect a plant from a pathogen are further provided. Transformed plants, plant cells, seeds, and microorganisms comprising a nucleotide sequence that encodes an antipathogenic polypeptide of the invention, or variant or fragment thereof, are also disclosed.10-22-2009
20100137210Gastrointestinal proliferative foctor and uses thereof - The invention relates to pharmaceutical compositions comprising gastrointestinal proliferative factor (GIPF) polynucleotides and polypeptides. The invention further relates to the therapeutic use of GIPF to prevent or treat conditions or disorders associated with the degeneration of the epithelial mucosa.06-03-2010
20100137211METHODS AND COMPOSITIONS FOR INTRA-ARTICULAR COAGULATION PROTEINS - The present invention provides methods and compositions for treating blood clotting factor disorders and/or reducing bleeding-associated joint damage by treatments delivered to the joint in a subject.06-03-2010
20100137202COMPOSITIONS FOR REPROGRAMMING A CELL AND USES THEREFOR - The present invention generally provides therapeutic compositions and methods for treating a disease, disorder, or injury characterized by a deficiency in the number or biological activity of a cell of interest. The method provides compositions for generating reprogrammed cells or for increasing regeneration in a cell, tissue, or organ of interest. Such methods are useful for treating subjects having a deficiency in a particular cell type or in a polypeptide produced by that cell type. In particular, the invention provides prophylactic and therapeutic methods and compositions for ameliorating or preventing hyperglycemia associated with type I and type II diabetes and related complications.06-03-2010
20100137200METHODS FOR TREATMENT OF GROWTH DISORDERS - The present invention provides methods and compositions for increasing the growth rates, alleviating the symptoms, or improving the metabolism of human patients having an endocrine disorder characterized by partial endogenous growth hormone activity or signaling. The invention provides a method comprising administering to a patient suffering from an endocrine disorder characterized by partial endogenous growth hormone activity or signaling an amount of insulin-like growth factor-1 (IGF-1) effective to improve metabolism in the patient, where the patient receives IGF-1 in a single daily administration. The invention also provides a method comprising administering to a patient suffering from an endocrine disorder characterized by partial endogenous growth hormone activity or signaling an amount of insulin-like growth factor-1 (IGF-1) and an amount of growth hormone (GH) that in combination are effective to improve growth or metabolism in the patient, where the patient receives IGF-1 in a single daily administration and receives GH in a single daily administration, and where the single IGF-1 administration and the single GH ad-ministration are administered to the patient substantially contemporaneously each day.06-03-2010
20100137209MODIFIED PLASMINOGEN ACTIVATOR INHIBITOR TYPE-1 AND METHODS BASED THEREON - The present invention is based upon the discovery that modified plasminogen activator inhibitor type-I (PAI-1) in which two or more amino acid residues that do not contain a sulfhydryl group have been replaced with amino acid residues that contain a sulfhydryl group and, therefore, forms intramolecular disulfide bonds, have increased in vivo half-life. Also disclosed are the modified PAI-1 proteins, derivatives and analogs thereof, specific antibodies, nucleic acid molecules and host cells. Methods for producing modified PAI-1, derivatives and analogs are also provided. The invention further relates to Therapeutics, pharmaceutical compositions and method of using the composition for treatment. The invention may be used to inhibit angiogenesis in a subject, thereby treating diseases or conditions associated with undesired angiogenesis and cell proliferation. Such conditions include psoriasis, chronic inflammation, tumor invasion and metastasis and conditions in which angiogenesis is pathogenic. The modified PAI-1 molecules of the present invention are useful for the treatment, prophylaxis, management and amelioration of cardiovascular diseases such as, but not limited to those that are related to hyperfibrinolysis, hemophilia, and vessel leakage syndrome.06-03-2010
20100137201MEDICAMENTS - There is provided the use of WNT5A, or a therapeutically effective fragment or derivative thereof, in the preparation of a medicament for use in the prevention, reduction or inhibition of scarring. There is also provided the use of WNT5A, or a therapeutically effective fragment or derivative thereof, in the preparation of a medicament for use in the prevention and/or treatment of a fibrotic disorder. Further aspects relate to methods by which scarring may be prevented, reduced or inhibited, and by which fibrotic disorders may be prevented and/or treated. Therapeutically effective amounts of WNT5A, or its fragments or derivatives, that may be used in the medicaments or methods of the invention are also provided.06-03-2010
20100137206NOVEL LIGAND GUIDED BLOCK COPOLYMERS FOR TARGETED DRUG DELIVERY - This application relates to micelle-forming poly(ethylene oxide)-block-poly(ester) block copolymers having reactive groups on both the poly(ethylene oxide) block and the poly(ester) block therein. The biodegradability of these copolymers and their biocompatibilities with a large number of bioactive agents make them suitable as carriers for various bioactive agents. The bioactive agent, such as DNA, RNA, oligonucleotide, protein, peptide, drug and the like, can be coupled to the reactive groups on the polyester block of the copolymer. A variety of targeting moieties can be coupled to the reactive group on the poly(ethylene oxide) block for targeting the bioactive agent to a particular tissue. The application also relates to a composition and method of use thereof for delivering bioactive agents.06-03-2010
20100137213FORMULATIONS OF SINGLE DOMAIN ANTIGEN BINDING MOLECULES - The invention relates to formulations of single domain antigen binding molecules, e.g., nanobody molecules, in particular formulations of TNF-binding nanobody molecules. The single domain antigen binding molecules can include one or more single binding domains that interact with, e.g., bind to, one or more target proteins. The formulations are useful, e.g., as pharmaceutical formulations. Method of preparing, and using the formulations described herein, to treat, e.g., TNF-associated disorders, are also disclosed.06-03-2010
20090054341Methods of Treatment Using Exendin Peptides or GLP-1 Peptides - Methods for increasing urine flow are disclosed, comprising administration of an effective amount of GLP-1, an exendin, or an exendin or GLP-1 agonist. Methods for increasing urinary sodium excretion and decreasing urinary potassium concentration are also disclosed. The methods are useful for treating conditions or disorders associated with toxic hypervolemia, such as renal failure, congestive heart failure, nephrotic syndrome, cirrhosis, pulmonary edema, and hypertension. The present invention also relates to methods for inducing an inotropic response comprising administration of an effective amount of GLP-1, an exendin, or an exendin or GLP-1 agonist. These methods are useful for treating conditions or disorders that can be alleviated by an increase in cardiac contractility such as congestive heart failure. Pharmaceutical compositions for use in the methods of the invention are also disclosed.02-26-2009
20100144639USE OF INHIBITORS OF THE EGFR-MEDIATED SIGNAL TRANSDUCTION FOR THE TREATMENT OF BENIGN PROSTATIC HYPERPLASIA (BPH) / PROSTATIC HYPERTROPHY - The present invention relates to the use of specific EGF-receptor antagonists for preparing a pharmaceutical composition for the prevention and/or treatment of benign prostatic hyperplasia and/or prostatic hypertrophy, a method for the treatment or prevention of benign prostatic hyperplasia/prostatic hypertrophy comprising administering an EGF-receptor antagonist of groups (A), (B) or (C), described herein optionally in combination with known compounds for the treatment of benign prostatic hyperplasia/prostatic hypertrophy, as well as associated pharmaceutical compositions.06-10-2010
20100144631Concentrated Protein Preparations of Bone Morphogenetic Proteins and Methods of Use Thereof - Disclosed herein are heretofore undescribed preparations of highly concentrated, solubilized proteins, such as but not limited to, Bone Morphogenetic Proteins. Such protein preparations can be formulated in an aqueous carrier at protein concentrations in excess of 10 mg/ml when using the methods of manufacture taught herein. Such methods yield stable protein preparations in either solubilized or lyophilized form. The protein preparations of the present invention are particularly beneficial when administered either locally or systemically, in part, because low administration volumes can be accomplished. This is especially important for local treatment of certain anatomic locations such as, for example, the synovial fluid of a joint when treating osteoarthritis with BMP-7 or the intradiscal space when treating degenerative disc disease with BMP-7.06-10-2010
20090124547COMPOUNDS FOR INTRACELLULAR DELIVERY OF THERAPEUTIC MOIETIES TO NERVE CELLS - A compound for delivering a non-cytotoxic therapeutic moiety into nerve cells, the compound having the general formula:05-14-2009
20090181886Method for Determining the Concentration of the Adipocytic Form of the Fatty Acid Binding Protein (A-FABP, FABP4, P2) - The invention relates to products and methods for the research, diagnosis, risk assessment, course monitoring, treatment and prophylaxis of various metabolic disorders and their early forms, concomitant diseases and secondary diseases. Metabolic diseases in the aforementioned sense include, among others, metabolic syndrome, non-insulin-dependent diabetes, (type II diabetes), insulin resistance, obesity (adiposis), in addition to diseases that are associated with disorders of the fatty acid metabolism. The inventive methods can be used, among other things, for determining the concentration of the adipocytic form of the fatty acid binding protein (A-FABP, FABP 4, P2) in various bodily fluids.07-16-2009
20090082271AGENTS THAT REDUCE APOE-INDUCED IMPAIRMENT OF MITOCHONDRIA AND METHODS OF USE THEREOF - The present invention provides isolated cells comprising a nucleic acid encoding a toxic form of apoE. The present invention further provides screening methods for identifying compounds that reduce apoE-induced impairment of mitochondrial integrity and/or function. The present invention further provides kits for use in carrying out a subject screening method. The present invention provides agents that reduce apoE-induced impairment of mitochondrial integrity and/or function; and use of such agents in the treatment of apoE-related disorders.03-26-2009
20090029911Liquid Human Growth Hormone Formulation Containing Polyethylene Glycol - A stable pharmaceutically acceptable aqueous formulation containing human growth hormone, a buffer, polyethylene glycol, a tonicifier such as a sugar alcohol, and optionally, an antimicrobial agent and optionally, a chelating agent. Also disclosed are associated means and methods for preparing, storing and using such formulations.01-29-2009
20090181889COMPOSITIONS AND METHODS FOR DETECTION AND TREATMENT OF HUMAN HERPESVIRUS (HHV)-6 - Disclosed herein are compositions and methods for detection and treatment of human herpesvirus (HHV)-6.07-16-2009
20090163422THREE-DIMENSIONAL STRUCTURE OF THE APOBEC 2 STRUCTURE, USES THEREOF, AND METHODS FOR TREATING CHRONIC AND INFECTIOUS DISEASES - Three-dimensional structure of APOBEC-2 and other structure models of APOBEC proteins obtained by computer modeling that bear similarity with a root-mean-square deviation (RMSD) of 2.0 with the APOBEC-2 monomer, dimer or tetramer. Uses of the three-dimensional structure of APOBEC-2 and models of APOBEC proteins particularly for structure-based drug design of compounds, peptides or mutant APOBEC proteins designed to treat Hyper-IgM-2 Syndrome, B cell lymphomas and lentivirus infections, particularly the human immunodeficiency virus (HIV) infection. Methods for identifying a compound that binds to any fragment of an APOBEC protein. The method includes obtaining the three dimensional structure of the APOBEC-2 monomer, dimer or tetramer and identifying or designing one or more compounds that bind, mimic, enhance, disrupt, or compete with interactions of APOBEC family proteins with themselves, their nucleic acid substrates and other cellular or viral proteins based on the three dimensional structure of the APOBEC-2 protein.06-25-2009
20090163414IN-VITRO METHOD FOR SCREENING ACCESSIBLE BIOLOGICAL MARKERS IN PATHOLOGICAL TISSUES - The present invention refers to an in vitro method for screening specific disease biological markers which are accessible from the extracellular space in pathologic tissues comprising the steps of: immersing a native pathologic tissue sample in a solution containing a labelling reagent for labelling proteins, wherein accessible proteins are labelled by the labelling reagent; purifying the labelled proteins; analyzing the labelled proteins or fragments thereof; determining the differential expression pattern of the labelled proteins in the native pathologic tissue samples compared to normal tissue samples; and judging that the labelled protein(s) having higher expression in the native pathologic tissue sample compared to normal tissue samples or being expressed more frequently in respective native pathologic tissue samples compared to normal tissue samples is/are biological marker(s) for pathologic tissue, which are accessible for high-affinity ligands from the extracellular space.06-25-2009
20090163416Use of a ghrelin agonist to improve the catabolic effects of glucocorticoid treatment - A method and pharmaceutical composition for inhibiting the effect of glucocorticoids, particularly dexamethasone, which suppress growth hormone secretion, by administering ghrelin or a ghrelin analogue, for example, [Aib06-25-2009
20100144632TRUNCATED 24kDa BASIC FIBROBLAST GROWTH FACTOR - The invention relates to fragments of an amino acid sequence of mature, full length 24 kDa fibroblast growth factor-2 or an analog thereof. The fragments have an activity that inhibits the migration of cultured cells as well as inhibiting angiogenesis, tumor growth, or any other processes that involve the migration of cells in vivo. This fragment does not stimulate the proliferation of cells which is in contrast to activity shown by the mature, full-length 24 kDa fibroblast growth factor-2. The present invention also relates to a DNA molecule encoding the fragment, an expression vector and a transformed host containing the DNA molecule, and a method of producing the protein by culturing the transformed host. Moreover, the present invention relates to a therapeutic composition the 24 kDa fibroblast growth factor fragment and a pharmaceutically acceptable carrier.06-10-2010
20100144634Compositions and Methods for Modulation of ADAMTS13 Activity - Compositions and methods are provided for the diagnosis and treatment of thrombotic thrombocytopenic purpura (TTP), stroke and myocardial infarction.06-10-2010
20100144636PEPTIDES DERIVED FROM RAS-P21 AND USES THEREFOR - A method of treating ras-transformed and ras-related cancer, including: administering to a plurality cells, including ras-transformed cancer cells and normal cells, a peptide material having a membrane resident peptide and a ras-p21 component, the membrane resident peptide attached to the carboxyl or amino terminal end of the ras-p21 component.06-10-2010
20100144619Antimicrobial Protein Specific to Staphylococcus Aureus - The present invention relates to a novel bacteriophage-originated protein having antimicrobial activity, more precisely an antimicrobial protein originated from lytic bacteriophage having killing activity specific to 06-10-2010
20100144623C-Terminal Domain Truncation of mGluR1a By Calpain and Uses Thereof - A composition comprising a peptide or a peptidomimetic thereof that inhibits the C-terminal domain truncation of mGluR1α by calpain, wherein the peptide is 10-30 amino acids in length and contains a sequence that is at least 70% homologous to VIKPLTKSYQGSGK. Also disclosed are methods of detecting the C-terminal domain truncation of mGluR1α by calpain, methods of inhibiting the C-terminal domain truncation of mGluR1α in a neuron, and methods of identifying a compound that inhibits the C-terminal domain truncation of mGluR1α.06-10-2010
20090181890Amylin and Amylin Agonists for Treating Psychiatric Diseases and Disorders - Methods and compositions for treating psychiatric diseases and disorders are disclosed. The methods provided generally involve the administration of an amylin or an amylin agonist to a subject in order to treat psychiatric diseases and disorders, and conditions associated with psychiatric diseases and disorders.07-16-2009
20090298762CONJUGATES OF BIOLOGICALLY ACTIVE PROTEINS HAVING A MODIFIED IN VIVO HALF-LIFE - Disclosed are biologically active protein conjugates that comprise a biologically active polypeptide coupled via a peptide bond to a polypeptide comprising from 2 to about 500 units of a repeating peptide motif, wherein the biologically active protein conjugate exhibits a modified plasma half-life compared to the intrinsic half-life of the unconjugated biologically active polypeptide or protein. Also disclosed are methods of making and using the conjugated proteins, as well as methods for determining whether a given conjugate exhibits a modified half life relative to the intrinsic half life of the unconjugated polypeptide.12-03-2009
20090181885NOVEL COMPOUNDS AND THEIR EFFECTS ON FEEDING BEHAVIOUR - The invention provides a peptide comprising the amino acid sequence given below, together with uses of the peptide and methods associated therewith. The peptide finds particular use as an appetite suppressant and in the treatment of obesity.07-16-2009
20090181892METHODS AND KITS FOR TREATING JOINTS AND SOFT TISSUES - Methods to treat and provide pain relief for damaged and degenerated tissues of a musculoskeletal joint are disclosed. These methods include introducing into, around and/or on the musculoskeletal joint an effective amount of biocompatible matrix or biocompatible polymeric compound to reduce pain associated with the damaged and degenerated tissues of a musculoskeletal joint, wherein at least a portion of it is activated and polymerized in situ. Examples of the musculoskeletal joints include intervertebral joints and synovial joints.07-16-2009
20090298760Modified Coagulation Factor VIIa With Extended Half-Life - The present invention relates to the fields of Factor VII (FVII) and Factor VIIa (FVIIa) albumin linked polypeptides. More specifically, the invention relates to cDNA sequences coding for human Factor VII and Factor VIIa and derivatives genetically fused to a cDNA coding for human serum albumin which may be linked by oligonucleotides which code for intervening peptidic linkers such encoded derivatives exhibiting improved stability and extended functional plasma half-life, recombinant expression vectors containing such cDNA sequences, host cells transformed with such recombinant expression vectors, recombinant polypeptides and derivatives which do have biological activities of the unmodified wild type protein but having improved stability and prolonged shelf-life and processes for the manufacture of such recombinant proteins and their derivatives. The invention also covers a transfer vector for use in human gene therapy, which comprises such modified DNA sequences.12-03-2009
20090298755Novel Chimeric Analgesic Peptides - The present invention provides a novel chimeric peptide containing an opioid peptide moiety and a nociceptive peptide moiety for producing analgesia.12-03-2009
20090298754Hai-1 and hai-2 in cancer therapy - The invention relates to a novel therapeutic composition for treating cancer, and particularly prostrate and breast cancer, the composition comprises mixture of two hepatocyte growth factor activator inhibitors HAI-1 and HAI-2.12-03-2009
20090137480TRANSDERMAL DELIVERY SYSTEM FOR DRIED PARTICULATE OR LYOPHILIZED MEDICATIONS - The present invention provides a system for transdermal delivery of dried or lyophilized pharmaceutical compositions and methods using thereof. The system comprises an apparatus for facilitating transdermal delivery of an agent that generates hydrophilic micro-channels, and a patch comprising a therapeutically active agent. The present invention is useful for transdermal delivery of hydrophilic agents, particularly of high molecular weight proteins.05-28-2009
20080306005TREATMENT OF BONE DISORDERS WITH SKELETAL ANABOLIC DRUGS - Disclosed herein are methods for the prevention and treatment of a variety of mammalian conditions manifested by loss of bone mass, including osteoporosis. The present invention provides methods of using PTHrP, or analogs thereof, for the treatment of metabolic bone disorders that are both effective and have an increased safety.12-11-2008
20090137466Use of GLP-1, Exendin and Agonists Thereof To Delay or Prevent Cardiac Remodeling - The present invention relates generally to the novel use of cardioprotective incretin compounds (CICs) such as GLP-1 and exendin and agonists thereof, including analogs and derivatives to prevent, delay, attenuate, or ameliorate cardiac remodeling. The present invention relates to methods for using CICs for the treatment of conditions associated with cardiac remodeling. The present invention further relates to methods for using CICs for the reduction of the risk or severity of congestive heart failure.05-28-2009
20090163419Human growth hormone aqueous formulation - A stable pharmaceutically acceptable aqueous formulation containing human growth hormone, a buffer, a non-ionic surfactant, and, optionally, a neutral salt, mannitol, or, a preservative, is disclosed. Also disclosed are associated means and methods for preparing, storing, and using such formulations.06-25-2009
20090163418Resuscitation fluid - A method for treating conditions related to lack of blood supply with a lipid based resuscitation fluid is disclosed. The resuscitation fluid contains a lipid component and an aqueous carrier. The lipid component forms an emulsion with the aqueous carrier. The resuscitation fluid can be used to increase the blood pressure and to carry oxygen to tissues. The resuscitation fluid can also be used for preserving the biological integrity of donor organs for transplantation.06-25-2009
20090163413DENTAL PRODUCTS COMPRISING BONE GROWTH ENHANCING PEPTIDE - Dental products such as toothpastes, mouthwash and dental floss are disclosed which products are enhanced by having dissolved, dispersed or coated thereon a compound which promotes bone growth. Preferred compounds are peptide sequences comprising 10 to 50 amino acids are disclosed. The sequences are characterized by containing an integrin binding motif such as RGD sequence and the remainder of amino acids contiguous with the RGD sequence in matrix extracellular phosphoglycoprotein. The sequences may be formulated for dispersed in toothpaste or a mouthwash and administered to enhance bone/tooth growth. When the dental products are used repeatedly over time they enhance good dental health.06-25-2009
20090163423Exendins and Exendin Agonist Analogs to Regulate Gastrointestinal Motility - Methods for reducing gastric motility and delaying gastric emptying for therapeutic and diagnostic purposes are disclosed which comprise administration of an effective amount of an exendin or an exendin agonist. Methods for treating conditions associated with elevated, inappropriate, or undesired post-prandial blood glucose levels are disclosed which comprise administration of an effective amount of an exendin or an exendin agonist alone or in conjunction with other anti-gastric emptying agents.06-25-2009
20090163410Novel Peptides and the Biological Use Thereof - The invention relates to novel purified insulated peptides, which exhibit, in particular, Nef protein-binding properties and are characterised in that they contain an amino acid sequence of a formula SEQ ID No 1: W-P-a-W-L-P, wherein a is selected from W, A, S or D.06-25-2009
20090163408SALICYLANILIDES ENHANCE ORAL DELIVERY OF THERAPEUTIC PEPTIDES - This invention pertains to the surprising discovery that salicylanilides, e.g., niclosamide and/or niclosamide analogues when orally administered in conjunction with a peptide pharmaceutical (e.g., a class A amphipathic helical peptide as described herein) significantly increases the bioavailability of that peptide. Methods of peptide delivery using such “delivery agents” and pharmaceutical formulations are provided.06-25-2009
20090163411LONG ACTING VEGF INHIBITORS AND METHODS OF USE - Disclosed are polymer sFlt-1 conjugates, variants of sFlt-1, compositions comprising such conjugates and variants, including cysteine variants of sFlt-1. Also disclosed is the use of such conjugates, variants and compositions in methods to inhibit the activity of VEGF, to inhibit angiogenesis, and to treat or reduce at least one symptom of diseases and conditions in which it is desirable to inhibit VEGF activity and/or angiogenesis.06-25-2009
20090163421Room Temperature Stable, Lyophilized Natriuretic Peptide Formulations - Lyophilized pharmaceutical compositions comprise a natriuretic peptide, a buffer and a bulking agent that are stable at room temperature. Preferably, for a fill volume of 1 mL (pre-lyophilization), the total cake mass, post-lyophilization, is 30-175 mg. Preferably, the natriuretic peptide is ularitide or a pharmaceutically acceptable salt thereof. Various embodiments of the compositions may further comprise at least one of an acid and a base. In some embodiments, the pH of the compositions is between 4.0 and 6.0. In addition, various embodiments of the compositions may further comprise a stabilizing agent. In some embodiments, the compositions are isotonic. Preferably, the compositions are used for the treatment of cardiac conditions. The invention also relates to methods for preparing such compositions.06-25-2009
20090163415NT-proBNP, proBNP AND BNP IMMUNOASSAYS, ANTIBODIES AND STABLE STANDARD - The present invention provides antibodies against glycosylated proBNP and NT-proBNP. The antibodies are suitable for precise immunodetection of both of the proteins in human blood. The glycosylated forms of proBNP and NT-proBNP may be utilized as an antigen for antibody generation as well as a calibrator or immunological standard in different types of immunoassays. The invention thus also relates to a stable standard or calibrator pro-Brain Natriuretic Peptide (proBNP) preparation for use in a method for detecting BNP immunoreactivity in a sample, the preparation comprising glycosylated proBNP or a fragment thereof. In addition, the present invention is directed to an assay for precisely detecting the NT-proBNP circulating in a patient's blood, wherein the level of glycosylation of the proBNP molecule is exploited. Therapeutic applications are also contemplated.06-25-2009
20090186815IDENTIFICATION OF JAK/STAT PATHWAY MODULATING GENES BY GENOME WIDE RNAI SCREENING - The present invention relates to a method for identifying a compound capable of modulating the activity of the JAK/STAT pathway and to the use of different JAK/STAT pathway components as a target for the modulation of the activity of the JAK/STAT pathway. Moreover, the present invention is concerned with a method for modulating the activity of the JAK/STAT pathway. Furthermore, the present invention pertains to a pharmaceutical composition and to the use of different JAK/STAT pathway components and/or effector molecules thereof for the manufacture of such composition for the diagnosis, prevention or treatment of a JAK/STAT pathway associated disorder.07-23-2009
20100137203METHOD FOR PREPARING A CELL-DERIVED EXTRACELLULAR MATRIX MEMBRANE - The present invention relates to a method for preparing a cell-derived extracellular matrix membrane, more particularly, to a method for preparing a chondrocyte-derived ECM membrane, the method comprising the steps of forming a suitable thickness of ECM membrane by culturing chondrocytes derived from animal cartilage at a high concentration in vitro, and drying it after decellularization process. The cell-derived ECM membrane scaffold according to the present invention is composed of extracellular matrix secreted by chondrocytes so that the membrane has excellent biocompatibility as well as an immune-previlage effect specific to cartilage. Since the membrane also has a suitable compressive strength, it can be used to replace periosteum for cartilage regeneration or artificial collagen membrane and used as dura mater transplant material, a natural ECM membrane for treating skin loss, materials for cell transplantation and a growth factor delivery vehicle.06-03-2010
20100004178Albumin-based colloid composition and method of use in treating hypovolemia and multiorgan dysfunction - A composition comprising an albumin-based colloid and its use in treating hypovolemic conditions such as capillary leak syndrome and shock are disclosed.01-07-2010
20100004176AXMI-115, AXMI-113, AXMI-005, AXMI-163 AND AXMI-184: INSECTICIDAL PROTEINS AND METHODS FOR THEIR USE - Compositions and methods for conferring insecticidal activity to host cells are provided. Compositions comprising a coding sequence for a delta-endotoxin polypeptide are provided. The coding sequences can be used in DNA constructs or expression cassettes for transformation and expression in host cells. Compositions also comprise transformed host cells. In particular, isolated delta-endotoxin nucleic acid molecules are provided. Additionally, amino acid sequences corresponding to the polynucleotides are encompassed, and antibodies specifically binding to those amino acid sequences. In particular, the present invention provides for isolated nucleic acid molecules comprising nucleotide sequences encoding the amino acid sequence shown in SEQ ID NO:4, 5, 6, 13, or 14, or the nucleotide sequence set forth in SEQ ID NO:1, 2, 3, 11, or 12, as well as variants and fragments thereof.01-07-2010
20100004174USE OF THYMOSIN ALPHA 1 FOR THE PREPARATION OF A MEDICAMENT FOR THE PREVENTION AND TREATMENT OF AUTOIMMUNE DISEASES - The invention concerns the use of thymosin alpha 1 for the preparation of a medicament for the prevention and treatment of autoimmune diseases such as multiple sclerosis, and inflammatory bowel diseases such as Crohn's disease or ulcerative colitis.01-07-2010
20090186812Apo-2 ligand - A novel cytokine, designated Apo-2 ligand, which induces mammalian cell apoptosis is provided. The Apo-2 ligand is believed to be a member of the TNF cytokine family. Compositions including Apo-2 ligand chimeras, nucleic acid encoding Apo-2 ligand, and antibodies to Apo-2 ligand are also provided. Methods of using Apo-2 ligand to induce apoptosis and to treat pathological conditions such as cancer, are further provided.07-23-2009
20090137465NOVEL USE - The present invention relates generally to the use of PA131 polypeptides and polynucleotides for healing various wounds arising from different causes.05-28-2009
20090286731METHODS AND COMPOSITIONS FOR THE TREATMENT OF XEROSTOMIA - Methods for the treatment of xerostomia are described, hi particular, the present invention takes advantage of the inventors' observation that xerostomia is caused by induction of apoptosis, and can be inhibited by interfering with the cellular processes that trigger apoptosis in cells receiving chemo- and/or radiotherapy.11-19-2009
20090137471NGF VARIANTS - NGF variants which have trkC-binding activity and trkC-signal inducing activity are provided. The variants optionally have trkA or trkB binding and signal induction activity. The NGF variants of the present invention are useful in the treatment of neuronal disorders. Nucleic acids and expression vectors encoding the NGF variant neurotrophins are also provided.05-28-2009
20090137479METHODS OF TREATING AND DIAGNOSING LAMINOPATHY - The invention provides a method of treating laminopathy in a subject comprising administering a therapeutically effective amount of centrobin polypeptide to the subject such that laminopathy is treated. The invention also provides a method of identifying an agent that enhances nuclear envelope integrity. The method comprises administering an agent to a cell comprising mutant centrobin, allowing the cell to replicate to form daughter cells, and observing nuclear envelope morphology within the daughter cells. In addition, the invention includes a method for diagnosing or identifying a predisposition to a laminopathy. The method comprises detecting the presence or absence of mutant centrobin in a sample, wherein the presence of mutant centrobin indicates that the subject is suffering from, or is predisposed to develop, a laminopathy. A kit for diagnosing or identifying a predisposition to a laminopathy also is provided.05-28-2009
20090137478Hormone normalization therapy and uses therefor - The present invention discloses a novel method of prevention of birth defects, miscarriages and infertility in women. The two therapies, disclosed herein, the hormone normalization therapy and the aromatase inhibitor-hormone normalization therapy, focus on restoring young hormonal levels in women in order to prevent female infertility and miscarriages, guide follicular and oocyte maturation, and promote correct chromosomal segregation in oocytes and early embryos.05-28-2009
20090118188Activin-actriia antagonists and uses for decreasing or inhibiting FSH secretion - In certain aspects, the present invention provides compositions and methods for decreasing FSH levels in a patient. The patient may, for example, be diagnosed with an FSH-related disorder or desire to delay or inhibit germ cell maturation.05-07-2009
20090118187Regulation of epithelial tissue by hedgehog-like polypeptides, and formulations and uses related thereto - The present application is directed to the discovery that preparations of hedgehog polypeptides can be used to control the formation and/or maintenance of epithelial tissue.05-07-2009
20100152111Polymer-based sustained release device - This invention relates to compositions for the sustained release of biologically active polypeptides, and methods of forming and using said compositions, for the sustained release of biologically active polypeptides. The sustained release compositions of this invention comprise a biocompatible polymer having dispersed therein, a biologically active polypeptide and a sugar.06-17-2010
20100152113METAL-BINDING THERAPEUTIC PEPTIDES - The present invention is related methods of delivering MBD peptide-linked agents into live cells. The methods described herein comprise contacting MBD peptide-linked agents to live cells under a condition of cellular stress. The methods of the invention may be used for therapeutic or diagnostic purposes.06-17-2010
20080318863ISCHEMIA THERAPEUTIC AGENT - The present invention provides a ischemia therapeutic agent that contains vascularization induction factor and gelatin hydrogel, and gradually releases vascularization induction factor, which is useful in treating ischemia accompanying peripheral circulatory disorders etc. encountering as complications of arteriosclerosis obliterans, Buerger's disease, diabetes and collagen disease.12-25-2008
20080318860High Activity Growth Factor Mutants - The application relates to novel biosynthetic growth factor mutants, derived from GDF-5, which exhibit improved biological activity. Mutations at positions 453 and 456 of human GDF-5 are disclosed, as well as use of these mutants in therapy of diseases associated with tissue degeneration/destruction.12-25-2008
20100004162Lynx, a novel family of receptor ligands in the central nervous system, corresponding nucleic acids and proteins and uses thereof - The present invention provides a novel family of polypeptides which are ligand-gated channel receptor accessory molecules or ligands, denoted Lynx. This invention provides an isolated polypeptide comprising an amino acid sequence of a Lynx polypeptide in which the amino acid sequence is set forth in SEQ ID NO:2, SEQ ID NO:4 or SEQ ID NO:15, including fragments, mutants, variants, analogs, homologs, or derivatives, thereof. This invention further provides an isolated immunogenic polypeptide comprising an amino acid sequence of a Lynx polypeptide and relates to antibodies of Lynx polypeptides and the use of such antibodies. The invention provides an isolated nucleic acid encoding a polypeptide comprising an amino acid sequence of a Lynx polypeptide. This invention provides pharmaceutical compositions and diagnostic and therapeutic methods of use of the isolated polypeptides and nucleic acids of the present invention. Assays for compounds which mimic, alter or inactivate the polypeptides of the present invention for use in therapy are also provided. The present invention further relates to methods of isolating Lynx polypeptides and the nucleic acids encoding such polypeptides.01-07-2010
20090005303PROTEASES FROM CARICA HAVING MITOGENIC ACTIVITY AND THEIR METHODS OF USE - Proteases having mitogenic activity isolated from the genus 01-01-2009
20090005308Variants derived from ACTRIIB and uses therefor - In certain aspects, the present invention provides compositions and methods for modulating (promoting or inhibiting) growth of a tissue, such as bone, cartilage, muscle, fat, and/or neuronal tissue. The present invention also provides methods of screening compounds that modulate activity of an ActRIIB protein and/or an ActRIIB ligand. The compositions and methods provided herein are useful in treating diseases associated with abnormal activity of an ActRIIB protein and/or an ActRIIB ligand.01-01-2009
20090005306Novel Bacillus Thuringiensis Gene with Lepidopteran Activity - The invention provides nucleic acids, and variants and fragments thereof, obtained from strains of 01-01-2009
20090005305SERVICE FOR EFFECTING LOCALIZED, NON-SYSTEMIC AND SYSTEMIC, IMMUNOGENIC TREATMENT OF CANCER USING CRT TRANSLOCATION - Anthracyclines-treated tumor cells are particularly effective in eliciting an anti-cancer immune response, where the rDNA-damaging agents, such as etoposide and mitomycin C do not induce immunogenic cell death. Anthracyclines induce the rapid, pre-apoptotic translocation of calreticulin (CRT) to the cell surface. Blockade or knock down of CRT suppressed the phagocytosis of anthracyclines-treated tumor cells by dendritic cells and abolished their immunogenicity in mammals, such as mice. The anthracyclines-induced CRT translocation was mimicked by inhibition of the protein phosphatase1/GADD34 complex. Administration of recombinant CRT or inhibitors of protein phosphatase1/GADD34 restored the immunogenicity of cell death elicited by etoposide and mitomycin C, and enhanced their antitumor effects in vivo. These data identify CRT as a key feature determining anti-cancer immune responses and delineate a possible strategy for immunogenic chemotherapy.01-01-2009
20090005310(En) Pharmaceutical Composition for Treating Haemorrhagic Shock and its Consecutive Symptoms - The invention is concerned with the use of a peptide comprising the N-terminal sequence01-01-2009
20090005307Compositions and Methods for Detection of Colorectal Cancer - We have identified a new variant of ileal bile acid binding protein (IBABP), designated IBABP-L, which is a biomarker for colorectal cancer. The transcript for IBABP-L arises from an alternative start site and includes three exons that are absent in IBABP. IBABP-L also shares part of a fourth exon with IBABP. The protein encoded by IBABP-L contains a deduced 49 residue N-terminal sequence that is not found in the IBABP protein. The present invention provides methods for diagnosing colorectal cancer and other compositions and methods based on this discovery.01-01-2009
20090005304Human KCNQ5 potassium channel, methods and compositions thereof - An isolated polynucleotide encoding a novel potassium channel polypeptide, KCNQ5, that is expressed primarily in brain and skeletal muscle is described. The new polypeptide has been cloned and isolated from a human brain cDNA library and is a member the KCNQ family of potassium channels. The provided human KCNQ5 nucleic acid sequence and encoded polypeptide can be employed for diagnostic, screening and therapeutic uses. Moreover, the hKCNQ5 polypeptide can be used to assay for KCNQ5 potassium channel modulators, which can be utilized in the treatment of neurological, neurophysiological, neuropsychological and neuroaffective diseases, conditions and disorders, including, but not limited to, acute and chronic pain, migraine, acute stroke, dementia, vascular dementia, trauma, epilepsy, amyelotrophic lateral sclerosis (ALS), multiple sclerosis (MS), Parkinson's Disease, learning and cognitive disorders, and neurophysiological disorders including anxiety disorders, depression, bipolar disorders, sleep disorders, addiction, and eating disorders.01-01-2009
20090005302METHOD, APPARATUS, AND COMPOUND FOR EFFECTING LOCALIZED, NON-SYSTEMIC, IMMUNOGENIC TREATMENT OF CANCER - Anthracyclin-treated turn or cells are particularly effective in eliciting an anti-cancer immune response, where the rDNA-damaging agents, such as etoposide and mitomycin C do not induce immunogenic cell death. Anthracyclins induce the rapid, pre-apoptotic translocation of calreticulin (CRT) to the cell surface. Blockade or knock down of CRT suppressed the phagocytosis of anthracyclin-treated tumor cells by dendritic cells and abolished their immunogenicity in mammals, such as mice. The anthracyclin-induced CRT translocation was mimicked by inhibition of the protein phosphatase1/GADD34 complex. Administration of recombinant CRT or inhibitors of protein phosphatase1/GADD34 restored the immunogenicity of cell death elicited by etoposide and mitomycin C, and enhanced their antitumor effects in vivo. These data identify CRT as a key feature determining anti-cancer immune responses and delineate a possible strategy for immunogenic chemotherapy.01-01-2009
20090118180USE OF FUSION PROTEINS FOR THE PREVENTION OR THE TREATMENT OF PATHOLOGIES RESULTING FROM ISCHEMIA - The present invention relates to the use of a fusion protein including a peptide sequence having membrane transducing properties, and a peptide sequence having cell survival properties, or a nucleic acid coding for the fusion protein, for the manufacture of a medicament intended for the prevention or the treatment of pathologies resulting from ischemia.05-07-2009
20090186817PEPTIDE-PEPTIDASE INHIBITOR CONJUGATES AND METHODS OF USING SAME - Peptide-peptidase inhibitor conjugate molecules are disclosed. These conjugate molecules are useful as agents for the treatment and prevention of metabolic and cardiovascular diseases, disorders, and conditions. Such diseases, conditions and disorders include, but are not limited to, hypertension, dyslipidemia, cardiovascular disease, eating disorders, insulin-resistance, obesity, and diabetes mellitus of any kind, and other diabetes-related disorders.07-23-2009
20090186821USE OF ASPARTIC PROTEASES IN COSMETICS AND THERAPEUTICS - The invention provides a cosmetic or pharmaceutical composition comprising, in a physiologically acceptable medium, at least one purified natural or synthetic polypeptide wherein the peptide sequence is represented wholly or partly by at least one sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 16, SEQ ID NO: 25 and SEQ ID NO: 27 and their homologs.07-23-2009
20090186820STREPTOCOCCUS PYOGENES POLYPEPTIDES AND CORRESPONDING DNA FRAGMENTS - The present invention relates to antigens, more particularly antigens of 07-23-2009
20090186818Therapeutic Method for Glycaemic Control - The invention relates to a therapeutic method for glycaemic control, comprising the use of a combination of a DPIV inhibitor and a GLP-1 receptor agonist.07-23-2009
20090186813CHRONIC TREATMENT REGIMEN USING GLUCAGON-LIKE INSULINOTROPIC PEPTIDES - The present invention encompasses a method of treating a disease by maintaining chronic steady state serum levels of a GLP-1 compound within a specified range.07-23-2009
20090186811Y2 Selective Receptor Agonists for Therapeutic Interventions - Y receptor agonists other than PYY 3-36, which are selective for the Y2 receptor over the Y1 and Y4 receptors, and their use in the treatment of conditions responsive to activation of Y2 receptors, are disclosed. Broadly, a Y2-selective agonist is one which (a) is a PP-fold peptide or PP-fold peptide mimic selected from PYY, NPY, PYY mimics and NPY mimics which have a C-terminal Y2 receptor-recognition amino acid sequence and have various modifications relative to the natural peptides or (b) a PP-fold peptide or PP-fold peptide mimic selected from PP and PP-mimics which have a C-terminal Y2 receptor-recognition amino acid sequence and which have various modifications relative to the natural peptide or (c) comprise a C-terminal Y2 receptor-recognition amino acid sequence fused at its N-terminus to an amphiphilic amino acid sequence domain comprising at least one alpha helical turn adjacent the N-terminus of the said Y2 receptor-recognition sequence, said turn being constrained in a helical configuration by a covalent intramolecular link, and (ii), in the case where the agonist has an N-terminal structure analogous to NPY or PYY, having one or more of the modifications listed in (a) above and, in the case where the agonist has an N-terminal structure analogous to PP, having one or more of the modifications listed in (b) above.07-23-2009
20090186819FORMULATION OF INSULINOTROPIC PEPTIDE CONJUGATES - The present invention provides pharmaceutical formulations comprising insulinotropic peptide conjugates, particularly a conjugate of albumin to exendin-4, or a derivative thereof, and methods of administration thereof. The present invention also provides methods for treating diabetes and insulinotropic peptides related diseases or conditions by administering the pharmaceutical formulations described herein.07-23-2009
20090062203DIPEPTIDYL PEPTIDASE IV INHIBITORS FOR THE TREATMENT OF SCHIZOPHRENIA AND DEPRESSION - A method for therapeutically treating an animal, including a human, for psychosomatic, depressive and neuropsychiatric diseases, such as anxiety, depression, insomnia, schizophrenia, epilepsy, spasm and chronic pain. Administration of a suitable DP IV inhibitor causes the reduction of activity in the enzyme dipeptidyl peptidase (DP IV or CD 26) or of DP IV-like enzyme activity in the brain of mammals and leads as a causal consequence to a reduced degradation of the neuropeptide Y (NPY) and similar substrates by DP IV and DP IV-like enzymes. Such treatment will result in a reduction or delay in the decrease of the concentration of functionally active neuronal NPY (1-36). As a consequence of the resulting enhanced stability of the endogenous NPY (1-36) caused by the inhibition of DP IV activity, NPY activity is prolonged thereby resulting among other things in functionally active NPY Y1 receptor activity thereby facilitating antidepressive, anxiolytic, analgesic, antihypertension and other neurological effects.03-05-2009
20090143302PYRIMIDINE COMPOUNDS - This invention relates to a method for treating inflammatory diseases or immune diseases, developmental or degenerative diseases, or tissue injuries. The method includes administering to a subject in need thereof an effective amount of one or more compounds of formula (I). Each variable in this formula is defined in the specification.06-04-2009
20090143297MODULATORS OF ANTIESTROGEN PHARMACOLOGY - A protein, designated ERCoA3 is provided. The ERCoA3 protein interacts with the estrogen receptor and the progesterone receptor and causes activation of these receptors is provided. Also provided are polynucleotides which encode ERCoA3 or block translation of the mRNA which encodes ERCoA3. Antibiodies that bind to one or more epitopes in the human ERCoA3 protein are provided. The present invention also relates to methods of inhibiting or reducing tamoxifen or estrogen induced proliferation of cancer cells, particularly breast cancer cells, endometrial cancer cells and uterine cancer cells. The method comprises reducing the activity or levels of ERCoA3 in such06-04-2009
20090143295PEPTIDE-BASED ANTIACNE REAGENTS - Peptide-based antiacne reagents, formed by coupling a skin-binding peptide with an antiacne agent, are described. The skin-binding peptide portion of the peptide-based antiacne reagent binds strongly to the skin, thus keeping the antiacne agent coupled to the skin for a long lasting effect. Skin care compositions comprising the peptide-based antiacne reagents are also provided as well as a method of treating or preventing skin acne.06-04-2009
20090054335AXMI-028 AND AXMI-029, A FAMILY OF NOVEL DELTA-ENDOTOXIN GENES AND METHODS FOR THEIR USE - Compositions and methods for conferring pesticidal activity to bacteria, plants, plant cells, tissues and seeds are provided. Compositions comprising a coding sequence for a delta-endotoxin polypeptide are provided. The coding sequences can be used in DNA constructs or expression cassettes for transformation and expression in plants and bacteria. Compositions also comprise transformed bacteria, plants, plant cells, tissues, and seeds. In particular, isolated delta-endotoxin nucleic acid molecules are provided. Additionally, amino acid sequences corresponding to the polynucleotides are encompassed. In particular, the present invention provides for isolated nucleic acid molecules comprising nucleotide sequences encoding the amino acid sequence shown in SEQ ID NO:2, 4, 15, 17, or 19, or the nucleotide sequence set forth in SEQ ID NO:1, 3, 14, 16, or 18, as well as variants and fragments thereof.02-26-2009
20090054328Reagents and Methods for Modulating Gene Expression Related to Hypertension - This invention relates to gene expression and proliferation in eukaryotic, preferably mammalian and most preferably human cells. The invention specifically relates to hypertension associated with proliferation and contractility of vascular smooth muscle cells.02-26-2009
20090054313METHOD FOR INDUCING DEPOSITION AND MATURATION OF BONE COMPRISING A CO-THERAPEUTIC REGIMEN OF LMP-1 AND BMP-2 - The present invention relates to the methods and compositions for the treatment of subjects having compromised bone conditions. Specifically, the invention relates to combinatorial therapeutic strategies including small molecules and peptide mimics of LIM mineralization proteins, particularly LMP-1, to overcome the dose-related translational barriers for BMP-2 therapeutics. 02-26-2009
20090054340Use of heat-shock protein 27 for cardiovascular disease prevention and treatment - A method of preventing or treating cardiovascular disease is provided. The method comprises administering heat shock protein 27 (HSP27), a co-factor, variant or analogue thereof. The cardiovascular disease can include atherosclerosis. A pharmaceutical composition comprising HSP27 for use in the prevention or treatment of cardiovascular disease is also provided.02-26-2009
20090005309SUBSTITUTED PIPERIDINES - Disclosed herein are substituted piperidine-based muscarinic receptor modulators of Formula I, process of preparation thereof, pharmaceutical compositions thereof, and methods of use thereof.01-01-2009
20090005301207 Human Secreted Proteins - The present invention relates to novel human secreted proteins and isolated nucleic acids containing the coding regions of the genes encoding such proteins. Also provided are vectors, host cells, antibodies, and recombinant methods for producing human secreted proteins. The invention further relates to diagnostic and therapeutic methods useful for diagnosing and treating diseases, disorders, and/or conditions related to these novel human secreted proteins.01-01-2009
20090018072HIGH PROTEIN SUPPLEMENT - The present disclosure relates to high protein dietary supplements for treating various symptoms and diseases associated with protein deficiency including weight gain, obesity, catabolic diseases, fibromyalgia, anxiety reactions, posttraumatic stress and chronic fatigue syndrome. Embodiments of dietary supplements comprise combinations of proteins, essential and semi-essential amino acids including L-Lysine, L-Arginine, and/or L-Histidine.01-15-2009
20090011988METHOD FOR TREATING CARTILAGE DISORDERS - The present invention relates to a method for the treatment of a cartilage disorder, including cartilage damaged by injury or degenerative cartilagenous disorders. The method involves contacting the cartilage with an IGF-1 analog with altered affinity for IGF-binding proteins (IGFBPs) or an IGFBP displacer peptide that prevents the interaction of an IGF with an IGFBP and does not bind to a human IGF receptor.01-08-2009
20090005312NOVEL GLP-1 ANALOGUES LINKED TO ALBUMIN-LIKE AGENTS - Novel GLP-1 agonists which are protracted by coupling to a protraction protein.01-01-2009
20080318862CROSSLINKABLE POLYMERIC MATERIALS AND THEIR APPLICATIONS - The present invention relates to a novel composition for dental, orthopedic and drug delivery purpose. Specifically, it relates to composition comprising an admixture of a resorbable bone substitute and a crosslinkable prepolymer. It also relates to the composition formed by crosslinking the admixture.12-25-2008
20080318857Compositions and Methods for the Intracellular Disruption of Vegf and Vegfr-2 By Intraceptors - The present invention provides an intraceptor that interacts with and decreases activity of with VEGF and/or a VEGFR for the treatment of angiogenesis-related conditions. The present invention further provides pharmaceutical compositions, and methods of use thereof, for the treatment and prevention of an angiogenesis-related condition using said intraceptors. The invention further provides for nucleic acids encoding said intraceptors.12-25-2008
20080318864METHODS AND COMPOSITIONS REGARDING POLYCHALCOGENIDE COMPOSITIONS - The present invention concerns the use of polychalcogenide compositions on cells, tissue, organs, and organisms to enhance their survivability. It includes compositions, compounds, methods, articles of manufacture and apparatuses for enhancing survivability and for protecting them from or treating them for injury or damage. In specific embodiments, there are also therapeutic methods and apparatuses for hypoxic/ischemic injury, organ transplantation, hyperthermia, wound healing, hemorrhagic shock, cardioplegia for bypass surgery, neurodegeneration, hypothermia, and cancer using the polychalcogenide compositions described.12-25-2008
20080318865Stabilized Pharmaceutical Peptide Compositions - Method for increasing the shelf-life of a pharmaceutical composition comprising a glucagon-like peptide which is prepared from a peptide product that has been dried at a pH above neutral pH.12-25-2008
20080318858Isolated Recombinant Vaccinia Virus Complement Control Protein (Hrvcp) Polypeptide - An isolated recombinant vaccinia virus complement control protein (hrVCP) polypeptide comprises a modified amino acid sequence comprising one or more amino acid substitutions to an amino acid sequence as set forth in SEQ ID NO: 2. The hrVCP polypeptide exhibits a complement activation regulatory activity greater than a complement activation regulatory activity of a polypeptide comprising the amino acid sequence as set forth in SEQ ID NO: 2. The one or more amino acid substitutions are selected from the group consisting of H98Y, E102K, E108K, E120K, and combinations thereof.12-25-2008
20080318855DNA ENCODING FOR RECOMBINANT POLYPEPTIDE EMUTANTS OF HUMAN STROMAL CELL-DERIVED FACTOR 1 - This invention is generally directed to a recombinant method of producing SDF-1 receptor antagonists. More particularly, the invention is directed to the isolated and/or recombinant polynucleotide sequences encoding analogs of human SDF-1 alpha or beta and, in particular, SDF-1 analogs having the proline at residue position number 2 replaced with a glycine to provide an SDF-1 receptor antagonist. The recombinant method can be used to produce drugs for a variety of therapeutic uses including, but not limited to, treatment of cancer, inhibiting angiogenesis, and hematopoietic cell proliferation.12-25-2008
20090011986Thiosuccinic Acid Derivatives and the Use Thereof - The present invention relates to compounds of the Formula (I), wherein X01-08-2009
20090325881MODIFIED FACTOR VIII - Methods of treating patients with Factor VIII deficiency by administration of modified porcine factor VIII are disclosed. The particular modified porcine factor VIII is one in which most of the B domain has been removed through genetic engineering. This modified factor VIII is particularly useful for treatment of hemophiliacs, especially those undergoing bleeding episodes.12-31-2009
20090325880TNF RECEPTOR-LIKE MOLECULES AND USES THEREOF - Novel MK61 polypeptides and nucleic acid molecules encoding the same. The invention also provides vectors, host cells, selective binding agents, and methods for producing MK61 polypeptides. Also provided for are methods for the treatment, diagnosis, amelioration, or prevention of diseases with MK61 polypeptides.12-31-2009
20090325878ORGAN PRECONDITIONING, ARREST, PROTECTION, PRESERVATION AND RECOVERY - The present invention relates to a method for reducing electrical disturbance of a cell's resting membrane potential comprising administering an effective amount of a composition comprising an effective amount of a local anaesthetic and of one or more of a potassium channel opener, an adenosine receptor agonist, an anti-adrenergic, a calcium antagonist, an opioid, an NO donor and a sodium hydrogen exchange inhibitor.12-31-2009
20090325875Muteins of human tear lipocalin - The present invention relates to novel muteins derived from tear lipocalin or a homologue thereof. In particular, the invention relates to a mutein of human tear lipocalin. The invention also refers to a corresponding nucleic acid molecule encoding such a mutein and to a method for its generation. The invention further refers to a method for producing such a mutein. Finally, the invention is directed to a pharmaceutical composition comprising such a lipocalin mutein as well as to various use of the mutein.12-31-2009
20090325873HUMAN GLP-1 MIMETIBODIES, COMPOSITIONS, METHODS AND USES - The present invention relates to at least one improved human GLP-1 mimetibody or specified portion or variant, including isolated nucleic acids that encode at least one GLP-1 mimetibody or specified portion or variant, GLP-1 mimetibody or specified portion or variants, vectors, host cells, transgenic animals or plants, and methods of making and using thereof, including therapeutic compositions, methods and devices.12-31-2009
20090325870FOAMY VIRAL ENVELOPE GENES - The present invention concerns the technical field of nucleic acids and expression-optimized nucleic acids. The present invention concerns especially nucleic acids comprising a mutated foamy viral envelope gene encoding a foamy viral envelope polypeptide, which comprises a leader peptide (LP), a surface unit (SU) and a transmembrane domain (TM). The present invention also relates to modified polypeptides encoded by these nucleic acids. Furthermore, the present invention regards a method for preparing pseudotyped vector particles as well as a method for treating a genetic disorder comprising administering a nucleic acid or a polypeptide encoded by that nucleic acid.12-31-2009
20090325869SYNTHETIC REGULATORS OF FERRITIN PROTEIN NANOCAGE PORES AND METHODS OF USE THEREOF - The present invention provides synthetic regulators of ferritin pores, and compositions comprising the regulators. The regulators function to reduce ferritin demineralization rates. The regulators are useful for treating inflammatory conditions. The present invention also provides methods of treating inflammatory conditions. The present invention further provides synthetic regulators of bacterial mini-ferritins; such regulators are useful as antibacterial agents.12-31-2009
20090325868Materials And Methods For FOXP3 Tumor Suppression - Provided herein are methods of treating a cancer in a subject comprising administering a FOXP3 protein, a nucleic acid encoding a FOXP3 protein, or an inducing compound which induces FOXP3 protein expression. Methods of altering a phenotype of a cancer cell or tumor cell, methods of inhibiting growth of such cells, and methods of inducing apoptosis of these cells are also provided herein. These methods comprise contacting the cell with a FOXP3 protein, a nucleic acid encoding a FOXP3 protein, or an inducing compound which induces FOXP3 protein expression. Further provided herein are diagnostic methods, comprising comparing the expression or structure of a FOXP3 protein or FOXP3 gene in a test sample to that of a normal or prior sample. A method of screening a test compound for anti-cancer activity comprising administering to cells the test compound and measuring FOXP3 protein or FOXP3 gene expression is moreover provided herein.12-31-2009
20090325864NOVEL PROTEIN AND PROCESS FOR PREPARING THE SAME - A protein having amino acid sequence in SEQ ID No.:1 of the Sequence Listing derived from human MP52, and a dimer protein thereof. A homodimer protein described above can be obtained by constructing a plasmid containing DNA coding amino acid sequence in SEQ ID No.:1 of the Sequence Listing with a methionine at the N-terminus, introducing the plasmid into 12-31-2009
20090325872USE OF ALPHA-LACTALBUMIN FOR REGULATIONS OF GLYCEMIA - Use of alpha-lactalbumin in a dietary, health-food or pharmaceutical type of composition to promote the cellular absorption of glucose, to improve the regulation of glycemia, to prevent the appearance of insulin resistance and/or type II diabetes.12-31-2009
20090247457NEUROTROPHIC COMPONENTS OF THE ADNF I COMPLEX - This invention relates to Activity Dependent Neurotrophic Factor I complex (ADNF I complex) and polypeptides of this complex, which produce their neurotrophic effects through multiple proteases intrinsic to the ADNF I complex. The invention also relates to pharmaceutical compositions comprising ADNF I complex polypeptides, as well as methods for reducing neuronal cell death in vitro and in vivo, methods for treating oxidative stress in a patient, methods for reducing a condition associated with fetal alcohol syndrome in a subject, and methods of enhancing learning and memory both pre- and post-natally, all of which methods use the ADNF I complex polypeptides of the invention.10-01-2009
20100004168Use of Crystallin For The Modulation of Angiogenesis - The present invention features therapeutic and prophylactic compositions and methods for modulating a blood vessel by altering angiogenesis, vasculogenesis, blood vessel stabilization, regression, persistence, or remodeling.01-07-2010
20090018077Fibroblast Growth Factor-Like Polypeptides - The present invention provides novel Fibroblast Growth Factor-like (FGF-like) polypeptides and nucleic acid molecules encoding the same. The invention also provides vectors, host cells, antibodies and methods for producing FGF-like polypeptides. Also provided for are methods for the diagnosis and treatment of diseases associated with FGF-like polypeptides.01-15-2009
20100004164PLATELET AGGREGATION INHIBITOR COMPOSITION - The invention provides a pharmaceutical composition comprising at least one polypeptide of the following (a) to (d): 01-07-2010
20100004163Composition and Uses of a Galectin for Treatment of Dry Eye Syndrome - Methods for the therapeutic treatment of dry eye in mammals comprising administering to a mammal afflicted with an epithelial wound a therapeutically effective amount of a galectin-1 protein, a galectin-3, a galectin-7 protein and/or a galectin-8 protein are provided. Pharmaceutical and ophthalmic compositions and kits, comprising a pharmaceutically an active agent which is a galectin-1 protein, a galectin-3 protein, galectin-7 protein and/or a galectin-8 protein, and a suitable carrier or a diluent, are provided.01-07-2010
20090221503USE OF RAPAMYCIN AND RAPAMYCIN DERIVATIVES FOR THE TREATMENT OF BONE LOSS - The present invention relates to a new use of rapamycin and rapamycin derivatives.09-03-2009
20090221501MIXING AND MATCHING TC PROTEINS FOR PEST CONTROL - The subject invention relates to the surprising discovery that toxin complex (TC) proteins, obtainable from 09-03-2009
20090203600PHARMACEUTICAL COMPOSITION FOR THE PROPHYLAXIS AND TREATMENT OF HIV INFECTION AND ITS USE - Pharmaceutical compositions for the prophylaxis and treatment of HIV infection and its use are provided. Particularly, the present invention provides a pharmaceutical composition comprising anti-virus peptides, use of said composition for manufacturing a medicament for the prophylaxis and treatment of HIV infection, and method for preventing and treating HIV infection by using said composition.08-13-2009
20090023660Novel Hemopoietin Receptor Protein, NR12 - A novel hemopoietin receptor gene (NR12) was successfully isolated by extracting motifs conserved among the amino acid sequences of known hemopoietin receptors and by using the predicted sequence. The NR12 gene encodes two forms of proteins, a transmembrane type and a soluble type. The expression of the NR12 gene was detected in tissues containing hematopoietic cells. NR12 is a novel hemopoietin receptor molecule involved in the regulation of immune system and hematopoiesis in vivo. Thus, NR12 is useful in the search for novel hematopoietic factors that functionally bind to the NR12 receptor, and in the development of therapeutic drugs for diseases associated with immunity or hematopoiesis.01-22-2009
20090023653Method of using broad-spectrum delta-endotoxins - Disclosed are novel synthetically-modified 01-22-2009
20090023658Neovascularization Inhibitors Derived From HGF and Methods Involving the Same - Novel neovascularization inhibitory factors and neovascularization inhibitors useful in preventing and treating various diseases in association with neovascularization. These neovascularization inhibitors contain as the active ingredient polypeptides with the following definition (a) or (b): (a) a polypeptide having an amino acid sequence of PyrGlu01-22-2009
20090023656Combination Comprising Combretastatin and Anticancer Agents - This invention relates to therapeutic combinations comprising VEGF Trap and a stilbene derivative, and to methods for treatment of cancer comprising administration of such combinations.01-22-2009
20090023659Methods and Materials Relating to CD84-like Polypeptides and Polynucelotides - The invention provides novel polynucleotides and polypeptides encoded by such polynucleotides and mutants or variants thereof that correspond to a novel human secreted CD84-like polypeptide. These polynucleotides comprise nucleic acid sequences isolated from cDNA library from human spleen (Hyseq clone identification numbers 2938352 (SEQ ID NO: 1)). Other aspects of the invention include vectors containing processes for producing novel human secreted CD84-like polypeptides, and antibodies specific for such polypeptides.01-22-2009
20090023657CATECHOLAMINE REGULATED PROTEIN - A novel family of mammalian catecholamine proteins is identified. These proteins are useful in methods of diagnosing neurological diseases, including schizophrenia and bipolar disease, as well as cardiovascular disease. This family of CRP40 proteins are also useful to treat neurological diseases.01-22-2009
20090023654AXMI-008, A DELTA-ENDOTOXIN GENE AND METHODS FOR ITS USE - Compositions and methods for conferring pesticidal activity to bacteria, plants, plant cells, tissues and seeds are provided. Compositions comprising a coding sequence for a delta-endotoxin and delta-endotoxin-associated polypeptides are provided. The coding sequences can be used in DNA constructs or expression cassettes for transformation and expression in plants and bacteria. Compositions also comprise transformed bacteria, plants, plant cells, tissues, and seeds. In particular, isolated delta-endotoxin and delta-endotoxin-associated nucleic acid molecules are provided. Additionally, amino acid sequences corresponding to the polynucleotides are encompassed. In particular, the present invention provides for isolated nucleic acid molecules comprising nucleotide sequences encoding the amino acid sequences shown in SEQ ID NOS:3, 5, and 7, and the nucleotide sequences set forth in SEQ ID NO:1, 2, 4, and 6, as well as variants and fragments thereof.01-22-2009
20090023646GHRH analogues - The present invention relates to growth hormone-releasing hormone (GHRH) analogues. More particularly, the invention relates to synthetic GHRH analogues of amino acids or more, exhibiting concomitantly an increased resistance to proteolysis and high binding affinity to human GHRH receptor in in vitro studies, in comparison with human native GHRH (1-29)NH01-22-2009
20090023644Methods of using cgrp for cardiovascular and renal indications - The present invention provides methods of treating and preventing mortality associated with heart failure and renal insufficiency in a Stage B, C, or D heart failure patient, and for improving quality of life by providing improved methods of administering a therapeutically effective amount CGRP. One method comprise administering between about 50 and about 500 ng/min of CGRP for a time between 30 minutes and 8 hours per day for as many days as needed to provide symptomatic relief, prevent exacerbation of symptoms, and/or prevent and/or delay progression of the disease state of heart failure in said patient. The therapies can be administered on an outpatient or inpatient basis.01-22-2009
20090023650Treatment of egfr-dependent tumors by abin (a20 -binding inhibitor of nf kappab) - The present invention relates to the treatment of epidermal growth factor-family receptor- (ErbB-) dependent tumors. More specifically, the present invention relates to the use of ABIN for the preparation of a medicament to inhibit epidermal growth factor- (EGF-) induced proliferation, and to treat ErbB-dependent tumors.01-22-2009
20090023651INHIBITORS OF HUMAN PLASMIN DERIVED FROM THE KUNITZ DOMAINS - This invention provides: novel proteins, which are homologous to the first Kunitz domain (K1) of lipoprotein-associated coagulation inhibitor (LACI), and which are capable of inhibiting plasmin; uses of such novel proteins in therapeutic, diagnostic, and clinical methods; and polynucleotides that encode such novel proteins.01-22-2009
20090023647METHOD OF PRODUCING BIOLOGICALLY ACTIVE HUMAN ACIDIC FIBROBLAST GROWTH FACTOR AND ITS USE IN PROMOTING ANGIOGENESIS - The present invention relates to the treatment of coronary heart disease by revascularization therapy, and more particularly to the intramyocardial injection of a pharmaceutical composition comprising a recombinant fibroblast growth factor-1 protein or a fragment of a recombinant fibroblast growth factor-1 protein, optionally, with a physiologic glue for inducing local neoangiogenesis in ischemic myocardium. Methods of producing the recombinant fibroblast growth factor 1 protein and fragments are also disclosed.01-22-2009
20090023643Methods For Treating Acute Myocardial Infarction By Administering Calcitonin Gene Related Peptide And Compositions Containing The Same - This invention relates to methods of treating acute myocardial infarction by administering calcitonin gene related peptide (CGRP). This invention also relates to preventing an acute myocardial infarction by administering calcitonin gene related peptide (CGRP). This invention further relates to compositions of CGRP for use in such methods. This invention also relates to the use of calcitonin gene related peptide in the manufacture of medicament for treating or preventing an acute myocardial infarction in a subject or for treating a subject suspected of having an acute myocardial infarction.01-22-2009
20090023649Recombinant proteins containing shiga-like toxin and vascular endothelial growth factor fragments - The present invention is directed to an isolated polypeptide including: (1) the A subunit of Shiga-like bacterial toxin, wherein said subunit has the nucleic acid sequence of SEQ ID NO:9; and (2) human vascular endothelial growth factor wherein the growth factor has the nucleic acid sequence of SEQ ID NO:10; wherein the isolated polypeptide possesses ribosome inactivating activity. The present invention is also directed to compositions for inhibiting endothelial cell growth in a patient.01-22-2009
20090023648Methods for Treating Body Tissue - Methods of treating body tissue including repairing defects in body tissue as well as augmenting body tissue. Body tissue defects are repaired by injecting a polymeric adhesive composition through an injector into the region of the defect and allowing the adhesive composition to cure to repair the defect or to form an implant that adheres to at least one surface tissue in the region of the defect. Body tissue is augmented by filling a defect void with a polymeric adhesive composition and allowing it to cure.01-22-2009
20090118192METHODS USEFUL IN THE TREATMENT OF BONE RESORPTION DISEASES - The invention relates to a combined pharmaceutical preparation comprising parathyroid hormone and a bone resorption inhibitor, said preparation being adapted for (a) the administration of parathyroid hormone during a period of approximately 6 to 24 months; (b) after the administration of parathyroid hormone has been terminated, the administration of a bone resorption inhibitor during a period of approximately 12 to 36 months.05-07-2009
20090118185RECOMBINANT FACTOR VIII HAVING REDUCED INACTIVATION BY ACTIVATED PROTEIN C - The present invention relates to a recombinant factor VIII that is characterized by one or more mutations within a region surrounding an activated protein C cleavage site, which one or more mutations result in a reduced rate of inactivation by activated protein C. Isolated nucleic acid molecules, recombinant expression vectors, and host cells suitable for expression of the recombinant factor VIII are also disclosed. The recombinant factor VIII can be used for the treatment of clotting disorders, such as hemophilia A.05-07-2009
20090118183ERYTHROPOIETIN RECEPTOR PEPTIDE FORMULATIONS AND USES - The present invention relates to peptide compounds that are agonists of the erythropoietin receptor (EPO-R). The invention also relates to therapeutic methods using such peptide compounds to treat disorders associated with insufficient or defective red blood cell production. Pharmaceutical compositions, which comprise the peptide compounds of the invention, and dosages are also provided.05-07-2009
20090118182Fibroblast Growth Factor-Like Polypeptides - The present invention provides novel Fibroblast Growth Factor-like (FGF-like) polypeptides and nucleic acid molecules encoding the same. The invention also provides vectors, host cells, antibodies and methods for producing FGF-like polypeptides. Also provided for are methods for the diagnosis and treatment of diseases associated with FGF-like polypeptides.05-07-2009
20090275518G-CSF POLYPEPTIDES AND USES THEREOF - The present invention relates to G-CSF polypeptides and their uses, particularly for therapeutic or prophylactic treatment in human subjects. The invention also relates to nucleic acids encoding said polypeptides, vectors comprising such nucleic acids and recombinant cells containing the same. The invention further discloses methods of producing such polypeptides, as well as methods and tools for detecting or dosing these polypeptides in any sample.11-05-2009
20090054329COMPOSITION WITH DOCOSAPENTAENOIC ACID - This invention concerns a method for stimulating barrier integrity in a subject by administering to a subject a composition comprising docosapentaenoic acid (22:5 n3; DPA). Also the invention concerns a composition comprising DPA and eicosapentaenoic acid (EPA).02-26-2009
20090054337NATRIURETIC POLYPEPTIDES - This document provides natriuretic polypeptides. For example, this document provides polypeptides having a natriuretic activity. In some cases, a polypeptide provided herein can have natriuretic activities, while lacking the ability to lower blood pressure. This document also provides methods and materials for inducing natriuretic activities within a mammal.02-26-2009
20090054321Polypeptides and use thereof - An isolated polypeptide comprises an amino acid sequence of SEQ ID No. 1 or 2 or a variant or fragment thereof. The variant may comprise an amino acid sequence that is at least 70% or 95% identical to the amino acid sequence of SEQ ID No. 1 or 2. A fragment thereof may be a peptide comprising at least 12 contiguous amino acids of SEQ ID No. 1 or 2. The polypeptide exhibits toll-like receptor activity. The TLR has been named TLR1 4. TLR receptors recognise a range of ligands and activate a series of signalling pathways that lead to the induction of immune and inflammatory genes.02-26-2009
20090088382Use of the cathelicidin LL-37 and derivatives therof for wound healing - Use of the antimicrobial cathelicidin peptide II-37, N-terminal fragments of LL-37 or extended sequences of LL-37 having 1-3 amino acids in the C-terminal end, for stimulating proliferation of epithelial and stromal cells and thereby healing of wounds, such as chronic ulcers. The cytotoxic effect of LL-37 may be reduced by including a bilayer-forming polar lipid, especially a digalactosyldiacylglycerol, in pharmaceutical compositions and growth media comprising LL-37.04-02-2009
20090062194COMPOSITIONS AND METHODS FOR THE THERAPY AND DIAGNOSIS OF LUNG CANCER - Compositions and methods for the therapy and diagnosis of cancer, particularly lung cancer, are disclosed. Illustrative compositions comprise one or more lung tumor polypeptides, immunogenic portions thereof, polynucleotides that encode such polypeptides, antigen presenting cell that expresses such polypeptides, and T cells that are specific for cells expressing such polypeptides. The disclosed compositions are useful, for example, in the diagnosis, prevention and/or treatment of diseases, particularly lung cancer.03-05-2009
20090062199Nogo Receptor Polypeptides and Polypeptide Fragments and Uses Thereof - Nogo receptor 1 (NgR1) is a leucine rich repeat protein that forms part of a signaling complex that modulates axon regeneration. Previous studies have shown that the entire LRR region of Nogo receptor-1, including the C-terminal cap of LRR, LRRCT, is needed for ligand binding, and that the adjacent CT stalk of the Nogo receptor-1 contributes to interaction with its co-receptors. The present invention is directed to the use of certain Nogo receptor-1 and Nogo receptor-2 polypeptides and polypeptide fragments for promoting neurite outgrowth, neuronal survival, and axonal regeneration in CNS neurons. The invention features molecules and methods useful for inhibiting neurite outgrowth inhibition, promoting neuronal survival, and/or promoting axonal regeneration in CNS neurons.03-05-2009
20090062200VEGF-Binding Fusion Proteins and Therapeutic Uses Thereof - Nucleic acid molecules encoding fusion proteins which bind and inhibit vascular endothelial growth factor (VEGF). The VEGF-binding fusion proteins are therapeutically useful for treating VEGF-associated conditions and diseases, and are specifically designed for local administration to specific organs, tissues, and/or cells.03-05-2009
20090062197Sp1 Polypeptides, Modified Sp1 Polypeptides and Uses Thereof - SP1 and modified SP1 variant polypeptides capable of forming reversible molecular associations with substances, compositions-of-matter comprising same, and uses thereof are provided.03-05-2009
20090062195Kallikrein-Inhibitor Therapies - Methods are described for preventing or reducing ischemia, e.g., cerebral ischemia, and/or reperfusion injury, e.g., reperfusion injury associated with cerebral ischemia, in a patient.03-05-2009
20090062191Composition for maintaining gastrointestinal homeostasis - The invention relates to a suspension of albumin and tannic acid for maintaining gastrointestinal homeostasis.03-05-2009
20090062189TUMOR SUPPRESSOR PROTEIN AND NUCLEOTIDE ENCODING SAME - The invention provides a method for suppressing tumor cell growth in a patient, comprising: administering to the patient an effective amount of an expression vector including a polynucleotide encoding a tumor suppressor protein having SEQ ID NO: 1 under conditions wherein the expression vector incorporates itself into the tumor cell genome and inhibits cell proliferation or induces cell death.03-05-2009
20090054333Peptide inhibitors of cyclin-dependent kinase activity and uses thereof - Novel polypeptides or derivatives comprising cdk2 binding site are disclosed. The novel polypeptides or derivatives have growth suppressive activity. Nucleic acids encoding those polypeptides are also disclosed. The polypeptides identified herein are also useful in methods for treating or preventing cancer. The treatment methods comprise administration of the polypeptide to the patient. The methods also comprise contacting the sample with the above-described polypeptide or derivative, wherein the polypeptide or derivative also comprises a covalently attached detectable moiety, then determining whether the polypeptide or derivative is binding cdk2 from the sample.02-26-2009
20090054338Synergisms between repartitioning and immunomodulating compounds - Combination therapies of adrenergic beta-receptor agonists and beta-glucans are described.02-26-2009
20090054334Combinatorial improvement of bifunctional drug properties - A method is provided for improving at least one pharmacokinetic property and maintaining or improving affinity of a therapeutic upon administration to a host. In the method, one administers to the host an effective amount of a bifunctional compound of less than about 5000 Daltons comprising the therapeutic or an active derivative, fragment or analog thereof and a recruiter ligand moiety. The recruiter ligand moiety binds to at least one biomoiety. The bifunctional compound has at least one modulated pharmacokinetic property upon administration to the host and equivalent or greater affinity for a target of the therapeutic as compared to a free drug control that comprises the therapeutic. In addition, the overall drug efficacy is improved by the steric bulk of the bifunctional complexed with the recruited biomoiety.02-26-2009
20090054326FORMULATIONS FOR ENHANCED MUCOSAL DELIVERY OF PYY - Pharmaceutical formulations are described for enhancing mucosal delivery of peptide YY (PYY) to a mammal. A PYY dosage form is described that is suitable for multi-use administration. The PYY dosage form comprises a bottle containing an aqueous pharmaceutical formulation and an actuator effective intranasal administration of the formulation. The formulation comprises a therapeutically effective amount of PYY, a buffer to control pH, a water-miscible polar organic solvent and a chelating agent for cations. The PYY dosage form exhibits at least 90% PYY recovery after storage as used for greater than about five days.02-26-2009
20090054331HIGH TEMPERATURE STABLE PEPTIDE FORMULATION - A stabilized pharmaceutical composition in the form of a lyophilized product to be later reconstituted to generate an aqueous drug product is described herein. The therapeutically active ingredient in the form of a peptide of sequence TDLQERGDNDISPFSGDGQPFKD is stabilized with a buffer, carbohydrate stabilizer, a nonionic bulking agent and a surfactant to facilitate reconstitution. The preferred preparation contains a peptide of the sequence TDLQERGDNDISPFSGDGQPFKD, histidine buffer, mannitol or glycine, sucrose and/or Polysorbate 20. This combination of excipients has demonstrated exceptional stability as a lyophilized product when stored at the elevated temperature of 40° C. for at least 6 months and for at least 3 Months at 50° C. The lyophilized mixture thus formed is reconstituted to a high peptide concentration without apparent loss of stability of the peptide. Also, this combination of excipients has also enabled the ability to terminally sterilize the lyophilized product using gamma irradiation without affecting the stability of the active ingredient of the formulation.02-26-2009
20090082274Collections of repeat proteins comprising repeat modules - The present invention relates to collections of repeat proteins comprising repeat modules which are derived from one or more repeat units of a family of naturally occurring repeat proteins, to collections of nucleic acid molecules encoding said repeat proteins, to methods for the construction and application of such collections and to individual members of such collections.03-26-2009
20090082270Uses of cerberus, Coco and derivatives thereof - The disclosure relates to Cerberus/Coco polypeptides or variants thereof for use in treating a variety of disorders associated with myostatin, nodal and GDF-11.03-26-2009
20090099088System for Inhibiting Pathogenicity in the Rice-Blast Fungus Magnaporthe Grisea04-16-2009
20090069235IGF-1 Fusion Polypeptides and Therapeutic Uses Thereof - A fusion protein comprising at least one IGF1 variant component and a fusion component (F), and, optionally, a signal sequence, exhibiting improved stability relative to the native IGF1 or IGF2 polypeptide. The fusion component (F) may be a multimerizing component, a targeting ligand, or another active or therapeutic compound. IGF1 variants were shown to have improved ability to induce skeletal muscle hypertrophy relative to native IGF1.03-12-2009
20090069237METHODS AND COMPOSITIONS FOR TREATING CONDITIONS - The invention relates to compositions that can be used to treat, prevent, and modulate pain, inflammation, and metabolic processes in various organisms including plants and animals. Such compositions can be formulated with an acceptable pharmaceutical excipient for administration to a human or a plant. The compositions can be administered topically or for systemic use.03-12-2009
20090036378Use of Factor VIIa or a Tissue Factor Antagonist for Regulating Gene Expression and Cell Migration or Chemotaxis - The present invention relates to use of FVII and/or FVIIa and/or another TF agonist and/or FVIIai and/or another TF antagonist in therapeutic treatment of pathological conditions that can be related to cell migration or treated by specific regulation of cell migration or chemotaxis.02-05-2009
20090203587Diagnosis and Therapy of Cell Proliferative Disorders Characterized by Resistance to Trail Induced Apoptosis - Described are methods and compounds for diagnosis and therapy of subsets of cell proliferative disorders which are characterized by resistance to TRAIL induced apoptosis. Examples of such diseases are B-cell chronic lymphocytic leukemia (CLL), mantle cell lymphoma (MCL), and prostate cancer. Furthermore, methods for identifying drugs which are suitable for treatment of such diseases are described.08-13-2009
20090203601Method for the treatment of neutropenia by administration of a multi-pegylated granulocyte colony stimulating factor (G-CSF) variant - The invention relates to a method for treating or preventing neutropenia in a patient receiving chemotherapy by administering a multi-PEGylated granulocyte colony stimulating factor (G-CSF) variant on the same day that chemotherapy is administered.08-13-2009
20090192088Vascular Endothelial Growth Factor 2 - Disclosed is a human VEGF2 polypeptide and DNA(RNA) encoding such VEGF2 polypeptides. Also provided is a procedure for producing such polypeptide by recombinant techniques and antibodies and antagonist against such polypeptide. Such polypeptides may be combined with a suitable pharmaceutical carrier or diluent to provide diagnostic, therapeutic and/or prophylactic effects against various diseases. Also provided are methods of using the antibodies and antagonists to inhibit the action of VEGF2 for therapeutic purposes.07-30-2009
20090192080Cerberus/coco derivatives and uses thereof - The invention relates to Cerberus/Dan/Gremlin polypeptides or variants thereof for use in treating a variety of disorders associated with myostatin, nodal and GDF-11. Preferred polypeptides are Coco or Cerberus derivatives.07-30-2009
20090082262Processed human chemokines PHC-1 and PHC-2 - The present invention is related to newly identified compounds, polynucleotide sequences encoding the amino acid sequences of the compounds, as well as agonists, antagonists or inhibitors of the compounds for chemokine receptors, especially the CCR-5 receptor and their use in the field of diagnostics and therapeutics involving the chemokine receptors.03-26-2009
20090197804Methods and Compositions for the Prevention and Treatment of Kidney Disease - Compositions for preventing or treating kidney disease comprising one or more food ingredients containing relatively low amounts of protein, sodium, and potassium, typically protein in amounts of from about 5% to about 40%, sodium in amounts of from about 0.01% to about 1%, and potassium in amounts of from about 0.01% to about 1%, and methods comprising administering such compositions to patients susceptible to or suffering from kidney disease for the purpose of preventing or treating kidney disease.08-06-2009
20090197803METHODS AND COMPOSITIONS FOR MODULATING T HELPER (Th) CELL DEVELOPMENT AND FUNCTION - Methods and compositions for modulating T helper (Th) cell development and function using modulators of IL-21, e.g., human IL-21, activity or level.08-06-2009
20090209469Use of Exendins and GLP-1 Receptor Agonists for Altering Lipoprotein Particle Size and Subclass Composition - The present invention relates to altering the concentration of various lipid molecules, specifically for example by shifting from small LDL particles to large LDL and HDL particles. The present invention also relates to methods for increasing average lipid particle size and methods for improving the cardiovascular risk profile of a subject by altering lipid particle sizes or concentrations or both.08-20-2009
20090209468Alpha-neurotoxin proteins with anti-inflammatory properties and uses thereof - The invention provides methods and compositions for treating arthritic conditions such as osteoporosis and rheumatoid arthritis. The treatment methods include administering an effective amount of a pharmaceutical composition comprising an isolated alpha-neurotoxin protein, or an effective variant or fragment thereof. The compositions are effective for decreasing the levels of pro-inflammatory cytokines and increasing the level of interleukin-10 in a subject with arthritis, and can reduce symptoms of the arthritic condition including edema, infiltration of inflammatory cells and pannus formation in affected joints. In some preferred embodiments of compositions in accordance with the invention, the effective therapeutic protein is an alpha-neurotoxin protein isolated from snake venom, or a recombinant or synthetic protein based on, or derived from, the amino acid of sequence of an alpha-neurotoxin protein isolated from snake venom. Some preferred alpha-neurotoxin proteins are derived from the venom of elapid snakes including 08-20-2009
20090209467VIRAL CAPSID PROTEINS AND ANY PEPTIDES OR COMPOSITIONS THEREOF FOR THE TREATMENT OF PATHOLOGIC DISORDERS - The present invention relates to viral capsid proteins, as a medicament for the treatment of a pathologic disorder. More particularly, the invention relates to the viral capsid proteins VP1, VP2 and VP3, preferably, the SV40 VP1 or any peptide, fragment, mutant, derivative and mixtures thereof or of virus-like particles (VLP's) comprising the same, as the active ingredient in compositions for the treatment of pathologic disorders, preferably disorders associated with inactivation of cellular proteins involved with quality control processes, particularly, chaperones. The invention further provides methods for the treatment of such disorders and the use of the SV40 capsid proteins for the preparation of pharmaceutical compositions.08-20-2009
20090209460COMPOSITIONS AND METHODS FOR TREATING OBESITY AND RELATED METABOLIC DISORDERS - The present invention relates to the use of neuromedins in methods to treat and prevent conditions such as obesity and other food-related disorders. In addition, novel peptides, FNX Peptides, are provided, which find use in treating these disorders.08-20-2009
20090005298Bone Sialoprotein Collagen-Binding Peptides - The present invention provides Novel collagen-binding peptides of bone sialoprotein (BSP). Peptides comprising a portion of the N-terminal collagen binding domain of BSP (residues 1-100) are used to stimulate mineralization, nucleate hydroxyapatite, and promote bone formation in collagen expressing tissues. Medicaments for use in the same are also contemplated. Chimeric and conjugate peptides comprising said collagen-binding BSP peptides are also included.01-01-2009
20100234293Novel Neurotrophic Factors - The invention relates to neublastinneurotrophic factor polypeptides, nucleic acids encoding neublastin polypeptides, and antibodies that bind specifically to neublastin polypeptides, as well as methods of making and methods of using the same.09-16-2010
20090054332THOMBOPOIETIN PEPTIDE CONJUGATES - The present invention relates to compounds comprising modified thrombopoietin peptides and conjugates of such modified peptides to serum components, typically serum proteins or peptides. The compounds and conjugates of the invention comprise a reactive group or a residue of a reactive group, which is covalently attached to a modified peptide, optionally through a linking group. The present invention also provides methods for the covalent attachment of a modified peptide to a serum protein or peptide to form a conjugate of the invention. The conjugates of the invention typically exhibit a longer in vivo circulating half-life compared to the corresponding unconjugated peptides. The conjugates of the invention also retain at least some of the biological activity of the unconjugated peptides, and typically exhibit increased biological activity compared to the unconjugated peptides. The present invention also provides methods for the treatment and prevention of a disease or disorder comprising the administration of one or more of the compounds or conjugates of the invention to a subject in need of such treatment or prevention.02-26-2009
20090054324Transcriptional Regulation of High Affitnity Ige Receptor Gamma-Chain - Transcriptional regulatory regions and transcriptional regulatory factors for the human high affinity IgE receptor (FcεRI) γ-chain gene are specified and are targets for the development of transcriptional regulatory agents for the FcεRI γ-chain gene. The following are provided: DNA comprising the full length or a portion of the base sequence shown in SEQ ID NO:1, that regulates transcription of the human high affinity IgE receptor (FcεRI) γ-chain gene; and DNA comprising the full length or a portion of the base sequence shown in SEQ ID NO:2, that regulates transcription of the human high affinity IgE receptor (FcεRI) γ-chain gene. The present invention is promising for the development of novel agents for the prophylaxis/treatment of allergic diseases, autoimmune diseases, thrombosis, glomerulonephritis, and lupus nephritis.02-26-2009
20090005296Ammonium/Ammonia Transporter - The present invention relates to methods and means for ammonia and/or ammonium transport in a variety of organisms, including mammals, yeast and plants. In particular, the present invention is related to the use of isolated polypeptide molecules, which are particular members of the aquaporin superfamily, and isolated nucleic acid molecule that encode such polypeptides in the transport of NH01-01-2009
20090203604SOOTHING AGENT AND FOOD FOR TREATING FATIGUE - It is an objective of the present invention to provide a soothing agent and a food for treating fatigue whereby: physical strength can be quickly restored from exhaustion (a state with lowered spontaneous motility), such as after exercise or exhausting labor or upon awakening in the early morning; physical strength decline can be prevented; and physical strength can be maintained.08-13-2009
20090203613SYSTEMS AND METHODS FOR PREPARING AUTOLOGOUS FIBRIN GLUE - The invention provides a system for preparing an autologous solid-fibrin web suitable for regenerating tissue in a living organism. The system includes a sealed primary container containing a separation medium and a low-density high-viscosity liquid. The separation medium is capable of separating red blood cells from plasma when the container contains blood and is centrifuged, and the primary container has a first pressure. The system further includes a sealed secondary container containing a calcium-coagulation activator. The secondary container has a second pressure that is less than the first pressure. The system also includes a transfer device having a cannula with a first end and a second end. The first and second ends are adapted to puncture the sealed primary and secondary containers in order to provide fluid communication between the first and second containers.08-13-2009
20080293632Use of natriuretic peptides for the treatment of stature disorders related to shox gene - The invention relates to the use of natriuretic peptides (ANP or BNP) for the preparation of pharmaceutical compositions for the treatment of short stature in a subject being suspected of having a genetic defect in the human SHOX gene. Further, the invention relates to use of natriuretic peptides in combination with a growth protein and/or a SHOX protein for the preparation of pharmaceutical compositions for the treatment of patients having a SHOX gene disorder. The invention also relates to the use of natriuretic peptides (ANP and BNP) in combination with a SHOX protein for the preparation of pharmaceutical compositions for the treatment of patients with cardiovascular diseases. The invention also comprises an article of manufacture comprising packaging material and a pharmaceutical composition comprising natriuretic peptides.11-27-2008
20090203611ANTI-MICROBIAL DEFENSIN-RELATED PEPTIDES AND METHODS OF USE - An antimicrobial peptide and its analogs that are insensitive to physiological salt and divalent cation concentrations is provided, as are methods for their use to treat and prevent bacterial infections. The peptides are especially useful to treat infections caused by bacteria that are resistant to traditional antibiotic therapy.08-13-2009
20090203609Use of IL-1 inhibitors for treating IL-1 mediated diseases - The invention relates to methods for treating or preventing arthritis. The method comprises administering to patients in need thereof therapeutically effective amounts of an IL-1 inhibitor and methotrexate. In a preferred embodiment, the IL-1 inhibitor is human recombinant IL-1ra and the methotrexate is N-[4-[(2,4-diamino-6-pteridinyl)methylamino]benzoyl]-L-glutamic acid. The invention also relates to pharmaceutical compositions containing an IL-1 inhibitor and methotrexate useful in such methods.08-13-2009
20090203586METHOD FOR AMELIORATING AN INFLAMMATORY SKIN CONDITION - The present invention relates to the use of thioredoxin in the manufacture of a medicament suitable for application to a skin surface for ameliorating an inflammatory skin condition. The present invention further relates to a method of ameliorating an inflammatory skin condition comprising applying to a skin surface an effective amount of a composition comprising thioredoxin. The invention further relates to a pharmaceutical composition suitable for ameliorating an inflammatory skin condition comprising from 0.0001 to 0.5 w/v thioredoxin.08-13-2009
20090203603Compositions for the Treatment and Prevention of Nephropathy - Compositions and methods for the prevention and treatment of nephropathy, including hypertensive and diabetic nephropathy, and nephropathy associated with insulin resistance and metabolic syndrome are described. Compositions of the invention include a compound that binds to a receptor for the glucagon like peptide-1, an incretin, a glucagon-like peptide-1 (GLP-1), an exendin, or an analog (including an agonist analog), derivative, or variant of any of them.08-13-2009
20090203595NEUREGULIN VARIANTS AND METHODS OF SCREENING AND USING THEREOF - The present invention provides polypeptide variants of neuregulin-1β (NRG-1β) that have enhanced or decreased binding affinity to ErbB3 and/or ErbB4. The invention also provides methods of screening and producing polypeptide variants of NRG-1β and methods of using polypeptide variants of NRG-1β for treating diseases.08-13-2009
20090203596Phosphatase Inhibitor Protein-1 As A Regulator of Cardiac Function - The present invention relates to novel nucleic acids which encode novel mutant forms of Inhibitor Protein-1 (1-1). In particular, the 1-1 mutant forms comprise altered phosphorylation sites of PKC-α. In addition, the present invention relates to methods of regulating cardiac contractility and function, and for treatment of cardio myopathy and heart failure, which employ the novel nucleic acids and polypeptides. Vectors comprising the novel nucleic acids, Antibodies to the novel proteins, and diagnostic and screening methods associated therewith, are also provided.08-13-2009
20090203589CHEMICALLY MODIFIED HUMAN GROWTH HORMONE RECEPTOR ANTAGONIST CONJUGATES - The present invention provides a chemically modified human Growth Hormone (hGH) receptor antagonists prepared by attaching a single polyethylene glycol moiety to the N-terminus. The chemically-modified protein according to the present invention have decreased PEGylation heterogeneity and which may also have increased binding affinity.08-13-2009
20090203599N-TERMINAL MODIFIED PEG-TRAIL, METHOD FOR PREPARING AND USES THEREOF - Disclosed herein are an N-terminal modified PEG-TRAIL conjugate and a preparation method and use thereof. The PEG-TAIL conjugate has pharmaceutical activity identical or similar to that of native TRAIL (TNF-related apoptosis-inducing ligand) with extended in vivo half-life and enhanced stability. Compared to native TRAIL, the PEG-TAIL conjugate exhibits high solubility and solution stability, with highly improved pharmacokinetic profiles. Thus, the PEG-TAIL conjugate may be very useful for preventing and treating proliferative diseases and autoimmune diseases.08-13-2009
20090203597Methods to Restore Glycemic Control - Provided herein are methods and compositions to achieve a sustained delay in the progression of, or an amelioration of diabetes in a subject, or a delay in diabetes onset in a subject at risk for diabetes, comprising an abbreviated course of administration of a pharmaceutical composition comprising an exendin or an exendin agonist analog in an amount effective to induce cell regeneration.08-13-2009
20090203588Outcome prediction and risk classification in childhood leukemia - Genes and gene expression profiles useful for predicting outcome, risk classification, cytogenetics and/or etiology in pediatric acute lymphoblastic leukemia (ALL). OPAL1 is a novel gene associated with outcome and, along with other newly identified genes, represent a novel therapeutic targets.08-13-2009
20090203610METHODS OF TREATING OBESITY OR DIABETES USING NT-4/5 - The invention concerns methods for treating obesity, non-insulin dependent diabetes mellitus, metabolic syndrome, and other related diseases by administering an NT-4/5 polypeptide. The invention also concerns compositions and kits comprising an NT-4/5 polypeptide.08-13-2009
20090221504DOSE OF AN ANGIOGENIC FACTOR AND METHOD OF ADMINISTERING TO IMPROVE MYOCARDIAL BLOOD FLOW - The present invention has multiple aspects. In one aspect, the present invention is directed to a unit dose pharmaceutical composition comprising from about 5 ng/dose to less than 135,000 ng of an angiogenic agent, typically from 5 ng to 67,500 ng. Preferably, the angiogenic agent is FGF, more preferably it is basic FGF (FGF-2). In its second aspect, the present invention is directed to a method for inducing angiogenesis, or increasing myocardial perfusion or vascular density in a patient's heart, comprising administering directly into the myocardium in an area in need, as a single injection or a series of injections, a unit dose of an angiogenic agent. It is also within the scope of the present invention that a plurality of unit dose compositions be administered directly into the myocardium at a plurality of sites in need of angiogenesis. In another aspect, the present invention is directed to a method for treating a patient for coronary artery disease, comprising administering directly into the myocardium in an area of need of angiogenesis in said patient, a unit dose (i.e., from about 5 ng to less than 135,000 ng) of an angiogenic agent. In yet another aspect, the present invention is directed to a method for treating a patient for a myocardial infarction, comprising administering directly into the myocardium in an area in need of angiogenesis in said patient, a unit dose (i.e., from about 5 ng to less than 135,000 ng) of an angiogenic agent.09-03-2009
20090221492EXPRESSION OF ACTIVE HUMAN FACTOR IX IN MAMMARY TISSUE OF TRANSGENIC ANIMALS - Recombinant Factor IX characterized by a high percentage of active protein can be obtained in the milk of transgenic animals that incorporate chimeric DNA molecules according to the present invention. Transgenic animals of the present invention are produced by introducing into developing embryos DNA that encodes Factor IX, such that the foreign DNA is stably incorporated in the DNA of germ line cells of the mature animal. Particularly efficient expression was accomplished using a chimeric construct comprising a mammary gland specific promoter, Factor IX cDNA that lacked the complete or any portion of the 5′-untranslated and 3′-untranslated region, which is substituted with a 5-′ and 3′-end of the mouse whey acidic protein gene. In vitro cell cultures of cells explanted from the transgenic mammal of the invention and methods of producing Factor IX from such said culture and methods of treating hemophilia B are also described.09-03-2009
20090221486METHOD FOR TREATING AND/OR PREVENTING INFECTIONS IN INFANTS DELIVERED VIA CAESAREAN SECTION - The present invention provides the use of a composition comprising uronic acid oligosaccharide for the manufacture of a composition for enteral administration to an infant delivered via caesarean section.09-03-2009
20090221476Peptide Capable of Altering Tubulin Polymerization and use Thereof for Inhibiting Cell Proliferation - The invention concerns a peptide derived from intermediate filaments and an intermediate filament fragment capable of altering tubulin polymerization and used for inhibiting cell proliferation, and more particularly for obtaining medicines designed to prevent or treat diseases involving cell proliferation, such as cancers for example.09-03-2009
20090203608Novel Proteins and Use Thereof - The present invention provides a novel secretory/membrane protein associated with adipocyte differentiation and/or metabolism function, specifically, an adipocyte-derived secretory/membrane protein containing amino acid sequence which is the same or substantially the same as an amino acid sequence represented by SEQ ID NOS: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20 or 22, a nucleic acid encoding it, an antibody therefor, a method of screening prophylactic and/or therapeutic agents for diseases involving abnormality of adipocyte differentiation/metabolism function using it and/or a kit for the screening, a prophylactic and/or therapeutic agent for the diseases or a diagnostic agent containing the membrane protein.08-13-2009
20090203598ABC TRANSPORTER LIGAND - Compositions and methods of using scorpion venom peptide that is a ligand for ABC transporters. One aspect provides a peptide having at least 80% sequence identity to SEQ ID NO: 1. The peptide Is believed to have a molecular mass of about 3.7 kDa and specifically interacts with cystic fibrosis transmembrane conductance regulator. Methods of treating a disorder or symptom of a disorder related to aberrant ABC transporter activity are also provided.08-13-2009
20090197801NEURITOGENIC PEPTIDES - The present invention relates to peptide compounds that are capable of stimulating neuronal differentiation, neurite outgrowth and survival of neural cells, and enhancing synaptic plasticity, learning and memory, methods of treating diseases and conditions of nervous system by administration of compositions comprising said compounds. The compounds and compositions of the invention include peptide sequences that are derived from the sequence of human erythropoietin or proteins that are homologous of human erythropoietin.08-06-2009
20080261890Use of neurotransmitters and neuropeptides for the treatment of dry eye diseases and related conditions - The invention further features novel methods and compositions for treating and preventing dry eye by administration of neurotransmitters and/or neuropeptides, optionally in formulation with various other agents, as well as kits for the use of such novel formulations and methods.10-23-2008
20080261889Method for determining the risk of developing a neurological disease - Methods and kits are provided for determining whether a subject is at risk of developing a neurological disease such as Alzheimer's disease and multiple sclerosis. The methods and kits are based on the detection of one or more nucleic acid variants in the MBL gene of the subject.10-23-2008
20080261887USE OF A PCV2 IMMUNOGENIC COMPOSITION FOR LESSENING CLINICAL SYMPTOMS IN PIGS - The present invention relates to the use of an immunogenic composition that comprises a porcine circovirus type 2 (PCV2) antigen for treatment of several clinical manifestations (diseases). Preferably, the clinical manifestations are associated with a PCV2 infection. Preferably, they include lymphadenopathy, lymphoid depletion and/or multinucleated/giant histiocytes. Moreover, the clinical symptoms include lymphadenopathy in combination with one or a multiple of the following symptoms in pigs: (1) interstitial pneumonia with interlobular edema, (2) cutaneous pallor or icterus, (3) mottled atrophic livers, (4) gastric ulcers, (5) nephritis and (6) reproductive disorders, e.g. abortion, stillbirths, mummies, etc. Furthermore the clinical symptoms include Pia like lesions, normally known to be associated with Lawsonia intracellularis infections.10-23-2008
20080261884Lung Volume Reduction Therapy Using Crosslinked Biopolymers - One aspect of the present invention relates to bronchoscopic lung volume reduction using solutions of biopolymers that can be polymerized in situ with a crosslinker and a polymeric additive which accelerates the cross-linking reaction. In certain embodiments, the biopolymer solutions can be in the form of a foam or gel. The biopolymer compositions disclosed herein may also be used for indications other than lung volume reduction, such as sealing fistulas or performing emergency tamponade of vessels.10-23-2008
20080261883RUNX3 GENE SHOWING ANTI-TUMOR ACTIVITY AND USE THEREOF - The present invention relates to a RUNX3 gene showing anti-tumor activity which is essentially involved in TGF-β-dependent programmed cell death (apoptosis) and use thereof. In addition, the present invention finds that RUNX3 gene expression is suppressed in the various gastric cancer and lung cancer cell lines. The suppression of the RUNX3 gene expression is due to hyper-methylation of CpG islands located around RUNX3 exon 1. The RUNX3 gene and its gene product of the present invention can be used effectively for the development of anti-cancer agents. The CpG islands around RUNX3 exon 1 could also be used not only for the development of anti-cancer agents which regulate the abnormal DNA methylation and thereby induce RUNX3 expression, and also for the development of methods for cancer diagnosis by measuring the abnormal DNA methylation.10-23-2008
20080261882Methods for Inhibiting Heregulin and Treating Cancer - The present invention discloses a method using human soluble ErbB3, for example p85-sErbB3, as a negative regulator of heregulin-stimulated ErbB2, ErbB3, and ErbB4 activation. The present invention also discloses p85-sErbB3 binding to heregulin with an affinity comparable to that of full-length ErbB3, and competitively inhibiting high affinity heregulin binding to ErbB2/ErbB3 heterodimers on the cell surface of breast carcinoma cells. The present invention also uses p85-sErbB3 to inhibit heregulin-induced phosphorylation of ErbB2, ErbB3, and ErbB4 in cells, as a negative regulator of heregulin-stimulated signal transduction, and as a block for cell growth. The present invention is also directed to nucleic acids and expression vectors encoding p85-sErbB3, host cells harboring such expression vectors, and methods of producing the protein. The present invention discloses a method of therapeutically treating human malignancies associated with heregulin-mediated cell growth such as breast and prostate cancer.10-23-2008
20080261881Use of human chorionic gonadotropin (HCG) orally or for injection for the treatment of mood disorders and alcoholism - A new use of Human Chorionic Gonadotropin (HCG) diluted as previously established for the treatment of mood disorders and alcoholism.10-23-2008
20080261880Synthetic approach to designed chemical structures - This invention relates to the chemical design and production of peptides, peptide structure and three dimensional conformation was assessed using NMR, circular dichroisin and pulsed field gradient NMR. In addition, this invention relates to peptides produced by these methods and to methods for using the peptides.10-23-2008
20080261878Method of inducing the formation of neurofibrillary tangles in transgenic animals - The present invention discloses a method and an in-vivo assay system useful for the identification and testing of modulating agents as well as for the validation of therapies of neurodegenerative diseases associated with the formation of neurofibrillary tangles, in particular Alzheimer's disease. The present invention is based on the surprising-finding that injection of β-amyloid Aβ10-23-2008
20080261876Method for Purifying Marine Collagen and the Processing Thereof Into Porous Sponges - Methods are provided for purifying marine collagen and for processing the collagen into porous sponges. Products produced with these methods and the use of the products are also provided.10-23-2008
20080261875Method For Treating Cardiovascular Disease - A method for treating cardiovascular disease comprising administering an effective amount of FGF-21 or an FGF-21 compound to a patient in need thereof.10-23-2008
20080261874Mutants of Trichosanthin With Anti-Tumor Activity and Lowered Side-Effects - The invention provides the mutants and coding genes of trichosanthin (TCS). The mutants thereof are the TCS mutants with the single or double alternation of tyrosine-55 and aspartate-78 (counted from N-terminus), wherein the tyrosine-55 is mutated to an aliphatic amino acid and aspartate-78 is mutated to an amino acid with low hydrophilicity. This invention also relates to the application of TCS mutants and their coding genes in the drug development to treat carcinoma, AIDS and other diseases.10-23-2008
20090197807SULPHATED HYALURONIC ACID FOR TREATING DEGENERATIVE OSTEOARTHRITIS - This invention relates to oral and intra-articular formulations based on sulphated hyaluronic acid which are effective in the treatment of degenerative osteoarthritis.08-06-2009
20080261873Growth-Hormone Secretagogues - Disclosed are methods of treating a disorder of the stomach, intestine or duodenum in a human subject. The method includes administering to the subject, a pharmaceutical composition comprising a compound that increases gastrointestinal motility (e.g., by modulating myenteric nerve activity) and/or induces the secretion or production of growth hormone.10-23-2008
20080280829METHODS OF TREATMENT AND PREVENTION OF METABOLIC BONE DISEASES AND DISORDERS - The present invention provides compostions and methods useful for treating and preventing metabolic bone diseases and disorders by inhibition of Lp-PLA11-13-2008
20080280821 Recombinant Protein Having an Anti-Cancer Effect, Its Encoding Gene and Uses Thereof - The present invention discloses a recombinant protein having an anti-cancer effect, its encoding gene and uses thereof. The recombinant protein having an anti-cancer effect provided by the present invention is one selected from the group consisting of: 1) a protein having the amino acid sequence of SEQ ID No:2 shown in the sequence listing; 2) a protein derived from SEQ ID No:2, which has a sequence homology of more than 90% with SEQ ID No:2 and which has the same activity as that of SEQ ID No:2; 3) a protein derived from SEQ ID No:2, which is obtained by adding or deleting 15 or less amino acid residues at the N-terminus of the amino acid sequence of SEQ ID No:2, and which has the same activity as that of SEQ ID No:2; 4) a protein derived from SEQ ID No:2, which is obtained by adding or deleting 15 or less amino acid residues at the C-terminus of the amino acid sequence of SEQ ID No:2, and which has the same activity as that of SEQ ID No:2; 5) a protein derived from SEQ ID No:2, which is obtained by substitution, deletion, or addition of one or several amino acid residues in the amino acid sequence of SEQ ID No:2, and which has the same activity as that of SEQ ID No:2. The medicament containing above recombinant protein as active component has significant selective inhibitory effect on tumor cells, and does not induce apoptosis of normal tissue cells, and has important applicable value.11-13-2008
20080261872Use of Ghrelin and Unacylated Ghrelin Compositions in Insulin-Related Disease Conditions - A novel combination of ghrelin and unacylated ghrelin is described herein. Methods of administering and uses of this combination to alter an insulin-associated parameter are also described. Compositions and packages containing ghrelin and/or one of its analogs and nonacylated ghrelin and/or one of its analogs as well as the uses of such compositions in providing therapeutic benefit to human patients diagnosed with for example insulin resistance, diabetes and obesity are described.10-23-2008
20080261871Y2/Y4 Selective Receptor Agonists for Therapeutic Interventions - Y receptor agonists which are selective for Y2 and Y4 receptors over the Y1 receptor are useful for treatment of, for example obesity, are (a) PP-fold peptides or PP-fold peptides mimics which have (i) a C-terminal Y receptor-recognition amino acid sequence represented by —X-Thr-Arg-X10-23-2008
20080261870Use of the Pro-Peptide Domain of Lysyl Oxidase as a Therapeutic Agent - A therapeutic composition that includes an active portion of the lysyl oxidase pro-peptide in a pharmaceutically acceptable carrier substance and methods of using such a therapeutic composition are disclosed. The active agent does not have lysyl oxidase enzymatic activity. Preferably, the active polypeptide is active in inhibiting cell growth in soft agar and active in inhibiting tumor formation. In addition, the active polypeptide preferably comprises an active portion of the amino acid sequence given in SEQ ID NO.: 1 or SEQ ID NO.: 2, or conservative substitions thereof. Alternatively, the active polypeptide comprises a polypeptide comprising an active portion of an amino acid sequence selected from the group consisting of SEQ ID NOs.: 3-8, or conservative substitions thereof.10-23-2008
20090105148COMPOSITIONS AND METHODS FOR TREATING MYOCARDIAL INFARCTION - The invention features compositions and methods that are useful for preventing or treating a cardiac disease or for promoting cardiac health following a myocardial infarction. The invention further features compositions and methods for promoting angiogenesis, cell proliferation, and/or decreasing apoptosis in muscle tissue, such as cardiac tissue. The invention provides for the expression of human growth hormone in cardiac muscle following a myocardial infarction.04-23-2009
20090105145Method of Diagnosing and Treating Colon Cancer - The invention provides a method of diagnosing carcinoma in a patient, the method comprising providing a sample of colorectal cells from a human patient and analyzing the sample for CXCL12 hypermethylation.04-23-2009
20090105146PROTEINS, NUCLEIC ACIDS AND MEDICAMENTS - The invention provides TGF-β3s, or fragments or derivatives thereof, wherein the alpha-helix-forming domain between amino acid residues (58) and (67) of full-length wild type TGF-β3 comprises at least one alpha-helix-stabilising substitution. The invention also provides TGF-β3s, or fragments or derivatives thereof, wherein the Glycine residue at position (63) of full-length wild type TGF-β3 is replaced with Proline. Further still, the invention provides TGF-β3s, or fragments or derivatives thereof, comprising a substitution of the Glutamic acid residue at position (12) of full-length wild type TGF-β3 and/or the Arginine residue at position (52) of full-length wild type TGF-β3. The invention also provides medicaments and methods of treatment using such TGF-β3s.04-23-2009
20090105143HIV FUSION INHIBITOR PEPTIDES WITH IMPROVED BIOLOGICAL PROPERTIES - Provided is an HIV fusion inhibitor peptide having an amino acid sequence of any one of SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, or SEQ ID NO:15; and provided is a pharmaceutical composition comprising a HIV fusion inhibitor peptide and one or more of a pharmaceutically acceptable carrier and macromolecular carrier, and uses and methods of treatment provided by these compositions.04-23-2009
20090105142TREATMENT WITH KALLIKREIN INHIBITORS - Methods, kits and compositions are disclosed that include a non-naturally occurring kallikrein inhibitor and an optional additional gout therapeutic for the treatment of gout, such as acute gout.04-23-2009
20090105135Therapeutic Agent for Cancer - The present invention provides a cancer therapeutic agent containing as an active ingredient a substance, particularly CRM197 which inhibits the binding of HB-EGF to EGF receptor by binding to HB-EGF, wherein a cancer is selected from the group consisting of a bladder cancer, a colon cancer or peritoneal metastatic cancers of a stomach cancer and a pancreatic cancer.04-23-2009
20090105139Soluble HER2 and HER3 splice variant proteins, splice-switching oligonucleotides, and their use in the treatment of disease - Soluble epidermal growth factor receptors 2 and 3 (HER2 and HER3) splice variant proteins with HER2 and HER3 antagonist activity and anti-proliferative properties, as well as the corresponding nucleic acids, are provided for treatment of proliferative diseases, in particular cancer. Also provided are compositions and methods for inducing expression of these splice variants, including splice switching oligonucleotides that modulate splicing of pre-mRNA that codes for these receptors.04-23-2009
20090105133Gamma-Delta T Cell Receptors - The present invention provides gamma-delta T cell receptors (γδTCRs) with an introduced disulfide interchain bond. Such proteins, and cells expressing of such proteins on the surface thereof, have value in methods for distinguishing between cell populations by the TCR ligand they present, and in the treatment of diseases.04-23-2009
20090209470T24 ANTIGEN FOR IMMUNODIAGNOSIS OF TAENIA SOLIUM CYSTICERCOSIS - The present disclosure relates to T24 nucleic acid sequences, amino acid sequences, and antibodies. Methods for detecting and diagnosing 08-20-2009
20090247459MODIFIED RECOMBINANT FACTOR VIII AND VON WILLEBRAND FACTOR AND METHODS OF USE - The present invention provides novel methods of increasing the survival of a coagulation protein by inhibiting the interaction with a clearance receptor. The invention also provides methods of preparing compositions that inhibit coagulation protein clearance receptors. Conjugated coagulation proteins, including compositions and formulations thereof, are also provided by the present invention.10-01-2009
20090209464Flavivirus fusion inhibitors - The present invention relates to peptides and methods of inhibiting fusion between the virion envelope of Flaviviruses and membranes of the target cell, the process that delivers the viral genome into the cell cytoplasm. The invention provides for methods which employ peptides or peptide derivatives to inhibit Flavivirus:cell fusion. The present invention is based in part on the discovery that E1 envelope glycoprotein of hepaciviruses and E2 envelope glycoprotein of pestivirus have previously undescribed structures, truncated class II fusion proteins. The present invention provides peptides and methods of treatment and prophylaxis of diseases induced by Flaviviruses.08-20-2009
20090239798Compounds, Methods and Formulations for the Oral Delivery of a Glucagon-Like Peptide (Glp)-1 Compound or a Melanocortin-4 Receptor (Mc4) Agonist Peptide - The present application relates to novel compounds, methods and formulations useful for the oral delivery of a glucagon like peptide-1 compound or a melanocortin 4 receptor agonist peptide.09-24-2009
20090239802Hsp70 PEPTIDE STIMULATING NATURAL KILLER (NK) CELL ACTIVITY AND USES THEREOF - The present invention relates to an immunostimulatory peptide derived from an Hsp70 protein and peptides comprising said immunostimulatory peptide. Furthermore the present invention pertains to polynucleotides encoding said peptide, vectors comprising said polynucleotides, fusion (poly)peptides comprising said peptide and compositions comprising said peptide. In addition the present invention relates to the use of said peptide, polynucleotide, vector or fusion (poly)peptide, for the preparation of pharmaceutical compositions for the treatment of diseases and for the stimulation of natural killer cell (NK cell) activity.09-24-2009
20090239799Pharmaceutical Compositions Comprising Ccl2 and Use of Same For The Treatment of Inflammation - A method of treating an inflammation in a subject thereof is provided. The method comprising administering to the subject a therapeutically effective amount of CCL2, thereby treating the inflammation. Also provided are pharmaceutical compositions and unit dosage forms which comprise CCL2 for the treatment of inflammation.09-24-2009
20090215684Use of BPI Protein for Treatment of Diseases - Use of a bactericidal/permeability-increasing (BPI) protein product for the manufacture of a medicament for therapeutic or preventive treatment of a disease involving a clinical disorder associated with insulin resistance in a human.08-27-2009
20100130414Methods of Using E2F2 for the Treatment of Hypertension - The present invention features compositions and methods of treating or preventing hypertension or a cardiac indication. In particular embodiments, the invention provides E2F2 as a new therapeutic target for the treatment of hypertension or a cardiac indication, and methods of increasing the expression and/or activity of E2F2.05-27-2010
20090137475MEDICAMENTS AND PROTEINS BASED ON TGF-BETA MONOMERS FOR THE TREATMENT OF WOUNDS - There is provided the use of monomeric TGF-βs, or there fragments or derivatives, as medicaments. These medicaments preferably comprise monomeric TGF-β3, or fragments or derivatives thereof. The medicaments provided may be used in the acceleration of wounding and/or the inhibition of scarring, in the promotion of epithelial regeneration, or in the prevention and/or treatment of fibrotic disorders.05-28-2009
20090221485ORAL PEPTIDES CONJUGATES FOR METABOLIC DISEASES - The present invention relates to the field of metabolic compound conjugates, methods of forming said conjugates and uses of these conjugates in the treatment of diabetes and conditions related to this condition. The metabolic compound conjugates of this invention include a metabolic peptide having a glucagon-like peptide (GLP-1) receptor binding motif for action on a GLP-1 receptor and at least one oligomer conjugation site for binding with at least one oligomer, wherein the oligomer includes a polyethylene glycol moiety (PEG), and/or alkyl moiety.09-03-2009
20090221495TREATMENTS FOR NEUROLOGICAL DISORDERS - Disclosed are methods of improving impaired proprioception, treating brachial plexus injuries, regenerating large and small nerve fibers, treating dorsal root nerve injuries, and improving sensory neural responses in a subject by administration of a neublastin polypeptide.09-03-2009
20090221494METHOD OF MODULATING CELLULAR ACTIVITY AND AGENTS FOR USE THEREIN - The invention provides a method for improving airway conductance in a subject in need thereof, the method comprising administering to the subject an effective amount of one or more of tumstatin; a derivative, variant or homologue thereof, a polynucleotide encoding tumstatin or a derivative, variant or homologue thereof; or an agent capable of increasing the expression or production of tumstatin.09-03-2009
20090221491Purification and Use of a Factor for Supporting Wound Healing - A process for manufacturing of a composition containing a purified factor for supporting wound healing selected from the group consisting of Hepatocyte Growth Factor (HGF) platelet derived growth factor (PDGF), Epidermal growth factor (EGF), transforming growth factor alfa (TGF-α), Transforming growth factor beta (TGF-β), insulin like growth factor (IGF-1) and Fibroblast growth factor (FGF) from sources, such as blood, containing the factor for supporting wound healing, wherein the manufacturing process comprises purification steps which are performed in the presence of antithrombin III (AT-III).09-03-2009
20090221489Water-Soluable Films Comprising Low-Viscosity Alginates - A film comprising as a film-forming agent an alginate salt of monovalent cation or a mixture of alginate salts containing at least one alginate salt of monovalent cation, the film-forming agent being such that a 10% aqueous solution thereof at a temperature of 20° C. has a viscosity of 100-1000 mPas, as measured at a shear rate of 20 rpm by use of a Brookfield viscometer with a spindle No. 2. A method of preparing the film. The film is useful for delivery of active ingredients to a mammal.09-03-2009
20090221488Certain Compositions and Methods of Treatment - Disclosed inter alia is the use of certain chromenone derivatives, which are modulators of a mitotic kinesin such as KSP, in the treatment of cellular proliferative diseases. The chromenones derivatives are administered with another chemotherapeutic agent selected from neutropenia treatment agents, alkylating agents, antimetabolites, platinating agents, topoisomerase inhibitors, tubulin agents and signalling inhibitors (e.g., kinase inhibitors). Pharmaceutical compositions comprising one or both types of active agents are also disclosed.09-03-2009
20090221484Use of Factor VII Polypeptides for Neuroprotection - New methods and compositions for providing neuroprotection in gyrencephalic mammals comprising a neuroprotective dose of Factor Vila or a neuroprotective Factor Vila equivalent are provided.09-03-2009
20090221482TISSUE PROTECTIVE PEPTIDES AND USES THEREOF - The present invention is directed to novel tissue protective peptides. The tissue protective peptides of the invention may bind to a tissue protective receptor complex. In particular, the present invention is drawn to tissue protective peptides derived from or sharing consensus sequences with portions of cytokine receptor ligands, including Erythropoietin (EPO), that are not involved in the binding of the ligand to the receptor complex, e.g., to the EPO receptor homodimer. Accordingly, the tissue protective peptides of the invention are derived from the amino acid sequences of regions of cytokine receptor ligands that are generally located on or within the region of the ligand protein that is opposite of the receptor complex, i.e., are generally derived from amino acid sequences of regions of the ligand protein that face away from the receptor complex while the ligand is bound to the receptor. The invention is further directed to the consensus sequences for use in engineering a synthetic tissue protective peptide. These tissue protective peptides also include fragments, chimeras, as well as peptides designed to mimic the spatial localization of key amino acid residues within the tissue protective receptor ligands, e.g., EPO. The invention further encompasses methods for treating or preventing a disease or disorder using tissue protective peptides of the current invention. The invention also encompasses methods for enhancing excitable tissue function using tissue protective peptides of the current invention.09-03-2009
20090221480Kallikrein Inhibitors and Anti-Thrombolytic Agents and Uses Thereof - Methods, kits and compositions are described that include a non-naturally occurring kallikrein inhibitor and an anti-thrombolytic agent, e.g., an anti-fibrinolytic agent, for preventing or reducing blood loss and/or ischemia, e.g., ischemia associated with perioperative blood loss and cerebral ischemia, the onset of systemic inflammatory response, and/or reperfusion injury, e.g., reperfusion injury associated with cerebral ischemia or a focal brain ischemia, e.g., in patients subjected to invasive surgical procedures, especially procedures requiring cardiopulmonary bypass.09-03-2009
20090221479Lgi, lingo and p75ntr family members: novel modulators of neuronal growth - The present invention relates to a novel method to promote regeneration or repair of the central or peripheral nervous system following injury The present invention concerns the use of a leucine-rich, glioma-inactivated protein (LGIn), or an analog or derivative thereof, to promote the regeneration or remyelination of neurons after injury to the central nervous system LGIns are endogenous proteins secreted by central neurons that promote regeneration of neurons after injury to the central nervous system The present invention includes an assay to measure the interaction of LGIn with LINGOn and p75NTRn as well as to identify factors that enhance or disrupt these interactions The invention further includes cell lines capable of expressing LGIn, LINGOn and p75NTRn molecules, as well as the proteins purified from these cells.09-03-2009
20090221487POLYETHLENE GLYCOL MODIFICATIONS OF THYMOSIN ALPHA-1 - Polyethylene glycol modifications of thymosin alpha 1 (T&agr; 1-PEGs), their preparation process, the medicine composition containing them, and their application in the medicine for preventing and treating diseases related with immune deficiency and hypoimmunity, including hepatitis B, hepatitis C, hepatoma, malignant melanoma, non-small cell lung cancer, SARS, and AIDS etc.09-03-2009
20090264355METHODS TO TREAT ALZHEIMER'S DISEASE OR OTHER DISORDERS MEDIATED BY AMYLOID-BETA ACCUMULATION IN A SUBJECT - The invention provides methods of delaying the onset, slowing the progression, preventing, or treating Alzheimers disease in a subject. In particular, the invention provides methods of modulating transport of Aβ across the blood brain barrier of the subject.10-22-2009
20090221493OCL-2A3 COMPOSITIONS AND USES THEREOF - This invention relates to osteoclast-specific gene and proteins. Specifically, the invention relates to OCL-2A3 or Atp6v0d2, the gene encoding it and uses thereof in methods and treatment of bone disorders.09-03-2009
20090221477Linkers - We disclose therapeutic polypeptides comprising at least two domains capable of binding to a cytokine receptor, wherein the domains are connected by a peptide linker, wherein the linker optionally comprises a rigid alpha helical region.09-03-2009
20090221483Antimicrobial Cathelicidin Peptides - The invention relates to antimicrobial cathelicidin polypeptides related to a 38 amino acid peptide having SEQ ID NO:4. The invention provides for polypeptides having broad spectrum antimicrobial activity, nucleic acids and expression vectors encoding such polypeptides, as well as host cells and methods of reducing survival of a microbe. In addition, the invention also provides compositions, as well as articles of manufacture, that comprise a broad spectrum antimicrobial polypeptide.09-03-2009
20100160225Lefty, lefty derivatives and uses thereof - The disclosure relates to Lefty derivatives and the uses of Lefty polypeptides as antagonists of the function of certain ligands such as Nodal, GDF-8 (Myostatin), and GDF-11. These derivatives may be fused to other functional heterologous proteins such as IgG, especially the Fc portion of IgG. According to the disclosure, Lefty polypeptides are useful in the treatment of a variety of disorders, including, for example, neuronal diseases, muscle and bone conditions, and metabolic disorders.06-24-2010
20090247460Inhibitor of vascular endothelial cell growth factor - The vascular endothelial cell growth factor (VEGF) inhibitors of the present invention are naturally occurring or recombinantly engineered soluble forms with or without a C-terminal transmembrane region of the receptor for VEGF, a very selective growth factor for endothelial cells. The soluble forms of the receptors will bind the growth factor with high affinity but do not result in signal transduction. These soluble forms of the receptor bind VEGF and inhibit its function.10-01-2009
20090247458COMPOSITIONS AND METHODS FOR TREATING CYSTIC FIBROSIS - Particular aspects provide electrokinetically-generated fluids (e.g., electrokinetically-generated gas-enriched fluids and solutions), and therapeutic compositions and methods comprising use thereof in treating at least one symptom of cystic fibrosis. In particular embodiments, at least one symptom of cystic fibrosis treated by the present invention include inhibition of 10-01-2009
20090239804PREVENTION AND TREATMENT OF OSTEOARTHRITIS - Subjects lacking Nfat1 display osteoarthritis in weight-bearing joints. Osteoarthritic changes associated with Nfat1 deficiency are characterized by articular cartilage degradation, articular chondrocyte proliferation/clustering, progressive articular surface destruction, periarticular chondro-osteophyte formation, and exposure of thickened subchondral bone. Methods of treating osteoarthritis, methods of diagnosis and early prediction of the onset of osteoarthritis, and methods for screening drug candidates that may be useful for treatment of osteoarthritis are presented.09-24-2009
20090239803BITE-SIZE CARBOHYDRATE NUTRITIONAL PRODUCTS AND METHODS FOR USING SAME - Bite-size carbohydrate-based products and methods of using same are provided. In a general embodiment, the present disclosure provides a bite-size carbohydrate-based product comprises a carbohydrate source comprising a glucogenic:fructogenic carbohydrate ratio ranging between about 1.5 to about 2.5 with at least 60% of the energy content of the bite-size carbohydrate-based product coming from the carbohydrate source. Along with the carbohydrate source, the bite-size carbohydrate-based product further comprises a suitable amount of sodium. The bite-size carbohydrate-based products can be specifically designed and provided to an athlete for customized carbohydrate intake and portion control before, during and/or after exercising.09-24-2009
20090239796METHODS FOR TREATING DIABETES AND REDUCING BODY WEIGHT - Methods for reducing body weight, altering body composition, treating diabetes, reducing HbA09-24-2009
20090239794HCV F PROTEIN AND USES THEREOF - The invention provides polypeptides, nucleic acids, antibodies, compositions, vaccines, microarrays and uses thereof for the prevention, treatment of HCV infection. The invention further provides uses of the above-noted products for the detection and diagnosis of HCV infection. The invention further provides corresponding methods and commercial packages relating to such uses. The invention further provides recombinant polypeptides and methods for their production.09-24-2009
20090239801Modified Fusion Polypeptides - Chimeric polypeptides wherein the polypeptides comprise a modified binding domain of growth hormone linked to a receptor binding domain of growth hormone receptor; and tandems/oligomers of such modified growth hormone binding domains.09-24-2009
20090239795EXENDIN FUSION PROTEINS - The invention provides fusion proteins comprising an exendin-4 fused to a transferrin (Tf) via a polypeptide linker, as well as corresponding nucleic acid molecules, vectors, host cells, and pharmaceutical compositions. The invention also provides the use of the exendin-4/Tf fusion proteins for treatment of Type II diabetes, obesity, and to reduce body weight.09-24-2009
20090318357Molecules Preferentially Associated with Effector T Cells or Regulatory T Cells and Methods of Their Use - The present invention is based, at least in part, on the finding that certain molecules are preferentially associated with effector T cells or regulatory T cells. Accordingly, immune responses by one or the other subset of cells can be preferentially modulated. The invention pertains, e.g., to methods of modulating (e.g., up- or down-modulating), the balance between the activation of regulatory T cells and effector T cells leading to modulation of immune responses and to compositions useful in modulating those responses. The invention also pertains to methods useful in diagnosing, treating, or preventing conditions that would benefit from modulating effector T cell function relative to regulatory T cell function or from modulating regulatory T cell function relative to effector T cell function in a subject. The subject methods and compositions are especially useful in the diagnosis, treatment or prevention of conditions characterized by a too-vigorous effector T cell response to antigens associated with the condition, in the diagnosis, treatment or prevention of conditions characterized by a weak effector T cell response, in the diagnosis, treatment or prevention of conditions characterized by a too-vigorous regulatory T cell response, or in the diagnosis, treatment, or prevention of conditions characterized by a weak regulatory T cell response.12-24-2009
20090253617DIAGNOSIS AND TREATMENT OF ATTENTIONAL DISORDERS - This invention features methods and compositions useful for the treatment and diagnosis of attentional disorders including attention deficit hyperactivity disorder (ADHD). Also disclosed are methods for identifying compounds useful for such therapy.10-08-2009
20090253618NEURONAL DIFFERENTIATION-INDUCING PEPTIDE AND USE THEREOF - A neuronal differentiation inducer comprising at least one peptide which can induce the differentiation of at least one cell into a neurocyte. The peptide is an artificially synthesized peptide comprising an amino acid sequence derived from a BC-box of at least one protein belonging to the SOCS protein family or an amino acid sequence having a partial modification in the BC-box-derived amino acid sequence, wherein the BC-box-derived amino acid sequence is composed of at least 10 contiguous amino acid residues selected in the amino acid sequence constituting the BC-box.10-08-2009
20100152115DETECTION OF PHYSIOLOGICALLY ACCEPTABLE POLYMER MOLECULES USING NEAR INFRARED SPECTROSCOPY - The present invention relates, in general, to methods for detecting the amount of a polymer on a protein using near-infrared spectroscopy. Measurement of the number of polymer moieties per protein molecule allows for production of molecules having a uniform number of polymer moieties, which is useful in the production of pharmaceutical compositions.06-17-2010
20100152110ALTERNATE READING FRAME POLYPEPTIDES DERIVED FROM HEPATITIS C AND METHODS OF THEIR USE - Novel hepatitis C virus (HCV) polypeptides are provided which are not encoded by the standard HCV open reading frame. These alternate reading frame polypeptides are useful, inter alia, in vaccine compositions, in diagnosing HCV infection, and as therapeutic targets.06-17-2010
20100152106AGENT FOR THERAPY AND/OR IMPROVEMENT OF DISSEMINATED INTRAVASCULAR COAGULATION - It is an object of the present invention to provide a therapeutically effective agent for therapy and/or improvement of DIC, or a method for treating and/or improving DIC. The present invention provides an agent for therapy and/or improvement of disseminated intravascular coagulation comprising thrombomodulin as an active ingredient, which is administered to antithrombin-reduced patients having a low plasma antithrombin activity of less than 50%.06-17-2010
20090143289Orthopoxvirus vectors, genes and products thereof - An orthopoxvirus vector, such as vaccinia, is described in which the A46R protein from vaccinia, or a closely related protein from any orthopoxvirus is not expressed or is expressed but is non-functional. Also described is the use of a vaccinia virus A46R protein or a closely related protein from any orthopoxvirus, or a functional peptide, peptidometic, fragment or derivative thereof, or a DNA vector expressing any of the above in the modulation and/or inhibition of IL1R/TLR superfamily signalling.06-04-2009
20090253630PEGYLATED PTH AS PTH RECEPTOR MODULATORS AND USES THEREOF - Pharmaceutical compositions and methods are provided for the treatment and prevention of bone loss diseases including osteoporosis in a mammal.10-08-2009
20090247461METHODS FOR THERAPEUTIC TREATMENT OF PAIN - A medicament for therapeutic and/or prophylactic treatment of pain such as neuropathic pain that occurs after peripheral or central nerve injury, which contains ginsenoside Rb1 as an active ingredient.10-01-2009
20100204102HYBRID GEL COMPRISING CHEMICALLY CROSSLINKED HYALURONIC ACID DERIVATIVE AND PHARMACEUTICAL COMPOSITION COMPRISING THE SAME - The present invention provides a composition comprising a hyaluronic acid derivative having a crosslinking group(s) and a hydrophilic polysaccharide derivative having a hydrophobic group(s), wherein the hyaluronic acid derivative having a crosslinking group(s) is prepared by crosslinkage formation reaction in hyaluronic acid or a derivative thereof having a crosslinkable group(s) in the presence of the hydrophilic polysaccharide derivative wherein the hydrophilic polysaccharide derivative may have a crosslinkable group(s).08-12-2010
20090325876USE OF LIPID CONJUGATES IN THE TREATMENT OF DISEASES ASSOCIATED WITH VASCULATURE - This invention provides for the use of compounds represented by the structure of the general formula (A):12-31-2009
20080318859Methods for Tissue Engineering - The invention relates to the use of parathyroid hormone-related protein (PTHrP) in the prevention of hypertrophy in chondrogenic cells for cartilage replacement. A method for engineering three dimensional cartilage constructs from chondrogenic cells is provided, said method comprising a step of treating the chondrogenic cells or immature constructs with PTHrP to regulate hypertrophy. Also provided are: three dimensional cartilage produced by the method of the invention, and an engineered cartilage construct comprising chondrogenic cells and a bioactive scaffold capable of controlled release of PTHrP. In addition, the invention provides a method for the treatment of osteoarthritis.12-25-2008
20080318853Diagnostic and Therapeutic Use of a Novel Growth Factor, Neublasmin - The present invention relates to the field of diagnostic and therapeutic use of proteins and genes, in particular to the diagnostic and therapeutic use of a secreted human hormone/growth factor, Neublasmin, and use or the gene coding for Neublasmin in the diagnosis and treatment of testicular disorders, in particular diagnosis and treatment of germ cell tumours and infertility. The invention also relates to use of Neublasmin in the treatment of CNS disorders. Neublasmin is expressed at high levels in human adult testicles and in developing mouse testicles from pn 22 and onwards. Expression or Neublasmin is strongly up-regulated in carcinoma in situ. Expression is also seen in foetal and adult brain.12-25-2008
20100160234CELL-PROLIFERATION INHIBITING VPG PROTEINS, FRAGMENTS OR ANALOGS THEREOF AND THEIR APPLICATIONS - Use of VPg proteins, fragments or analogs thereof having the ability to bind an eukaryotic initiation factor eIF4E, for inhibiting cell-proliferation.06-24-2010
20100160222Treatment of Psoriasis through Down-Regulation of the EGF-Receptor with Topically Applied EGF - A topical formulation containing epidermal growth factor for treating psoriasis is described.06-24-2010
20100160218Airway Administration of Tissue Factor Pathway Inhibitor in Inflammatory Conditions Affecting the Respiratory Tract - The present invention provides methods for the local treatment of acute and chronic extravascular pulmonary fibrin deposition and/or reducing unwanted effects associated with systemic administration of natural anticoagulants to a subject via airway administration to the subject by intratracheal, intrabronchial or intraalveolar routes of natural anticoagulants or biologically active derivatives thereof.06-24-2010
20100016233Heterocyclic Aromatic Compounds Useful As Growth Hormone Secretagogues - Novel heterocyclic aromatic compounds are provided that are useful in stimulating endogenous production or release of growth hormone, said compounds having the general structure of formula I01-21-2010
20100016230Treatment Of Inflammatory Bowel Diseases With Mammal Beta Defensins - The present invention relates to treatment of inflammatory bowel diseases with mammal beta defensins.01-21-2010
20100016227LIGAND/LYTIC PEPTIDE COMPOSITIONS AND METHODS OF USE - Amphipathic lytic peptides are ideally suited to use in a ligand/cytotoxin combination to specifically inhibit cells that are driven by or are dependent upon a specific ligand interaction; for example, to induce sterility or long-term contraception, or to attack tumor cells, or to selectively lyse virally-infected cells, or to attack lymphocytes responsible for autoimmune diseases. The peptides act directly on cell membranes, and need not be internalized. Administering a combination of gonadotropin-releasing hormone (GnRH) (or a GnRH agonist) and a membrane-active lytic peptide produces long-term contraception or sterilization in animals in vivo. Administering in vivo a combination of a ligand and a membrane-active lytic peptide kills cells with a receptor for the ligand. The compounds are relatively small, and are not antigenic. Lysis of gonadotropes has been observed to be very rapid (on the order of ten minutes.) Lysis of tumor cells is rapid. The two components—the ligand and the lytic peptide—may optionally be administered as a fusion peptide, or they may be administered separately, with the ligand administered slightly before the lytic peptide, to activate cells with receptors for the ligand, and thereby make those cells susceptible to lysis by the lytic peptide. The compounds may be used in gene therapy to treat malignant or non-malignant tumors, and other diseases caused by clones or populations of “normal” host cells bearing specific receptors (such as lymphocytes), because genes encoding a lytic peptide or encoding a lytic peptide/peptide hormone fusion may readily be inserted into hematopoietic stem cells or myeloid precursor cells.01-21-2010
20100016226UNACYLATED GHRELIN AND ANALOGS AS THERAPEUTIC AGENTS FOR VASCULAR REMODELING IN DIABETIC PATIENTS AND TREATMENT OF CARDIOVASCULAR DISEASE - The present invention relates to a method for treating a cardiovascular disease, for increasing the number of circulating angiogenic cells (CAC) and/or improving the function of CAC and a method for improving vascular remodeling and/or neovascularisation. The method comprises administering to the subject a therapeutically effective amount of unacylated ghrelin or a polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 1 or a fragment or analog thereof having the biological activity of SEQ ID NO: 1; and to pharmaceutical compositions comprising unacylated ghrelin or a polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 1 or a fragment or analog thereof having the biological activity of SEQ ID NO: 1.01-21-2010
20100016224COMPOSITIONS AND METHODS FOR MODULATING AN IMMUNE RESPONSE - The present invention relates to a method of enhancing a pro-inflammatory immune response through the administration of the DEAD-box protein DDX3, as encoded by SEQ ID NO:1. The invention further extends to a method of suppressing an aberrant immune response, such at that associated with autoimmune conditions, through inhibition of DDX3. The invention also extends to a method of suppressing a pro-inflammatory immune response through the administration of the vaccinia virus protein K7. The invention further extends to the provision of an attenuated poxvirus wherein the K7R gene which encodes for the K7 protein is deleted or rendered non-functional. Pharmaceutical compositions comprising DDX3 inhibitory compounds, such as K7, are also provided.01-21-2010
20100016220GENES AND POLYPEPTIDES RELATING TO HUMAN COLON CANCERS - The present application provides novel human genes RNF43 whose expression is markedly elevated in colorectal cancers, as well as CXADRL1 and GCUD1 whose expression is markedly elevated in gastric cancers compared to corresponding non-cancerous tissues. The genes and polypeptides encoded by the genes can be used, for example, in the diagnosis of a cell proliferative disease, and as target molecules for developing drugs against the disease.01-21-2010
20100016221METHOD OF DEGRADING PROTEIN BY CHAPERONE-MEDIATED AUTOPHAGY - The present invention provides a method of degrading a target protein in a subject comprising administrating to the subject an effective amount of any of: (a) a peptide comprising an HSC70-binding moiety and a target protein-binding moiety; and/or (b) a polynucleotide encoding the peptide of (a).01-21-2010
20100152109Influenza inhibiting compositions and methods - The present invention provides peptides, peptide analogs, peptide derivatives and pharmaceutical compositions useful for treating or preventing influenza infections or preventing the person-to-person transmission of an influenza infection. A peptide of the invention comprises an influenza virus-cell fusion inhibiting portion of the fusion initiation region (FIR) of a wild-type influenza hemagglutinin 2 protein or a variant thereof. In a preferred embodiment, a peptide of the invention consists of 8 to 40 consecutive amino acid residues a portion of a wild-type influenza hemagglutinin 2 protein or a variant thereof, the portion of the protein comprising the FIR of the protein and up to five amino acid residues on the amino-terminal and carboxy-terminal sides of the FIR.06-17-2010
20100152117Aequorin-Containing Compositions and Methods of Using Same - Compositions containing aequorin and methods for their use in preventing and/or alleviating symptoms and disorders related to calcium imbalance are provided by the present invention.06-17-2010
20100152116Treatment of amyotrophic lateral sclerosis - The present invention relates to the treatment of motoneuron diseases. More particularly, the invention relates to the treatment of amyotrophic lateral sclerosis (ALS). It is found that the intracerebroventricular delivery of low amounts of vascular endothelial growth factor into a pre-clinical ALS animal model induces a significant motor performance and prolongation of survival time of the animals.06-17-2010
20100152108METHODS AND COMBINATION THERAPIES FOR TREATING ALZHEIMER'S DISEASE - The invention provides methods and combination therapies for treating and/or preventing and/or slowing the onset and/or development of Alzheimer's disease using a hydrogenated pyrido (4,3-b) indole (e.g., dimebon) in conjunction with another compound, pharmaceutically acceptable salt thereof or therapy for Alzheimer's disease.06-17-2010
20090093412METHODS FOR THE MODULATION OF NEOVASCULARIZATION AND/OR THE GROWTH OF COLLATERAL ARTERIES AND/OR OTHER ARTERIES FROM PREEXISTING ARTERIOLAR CONNECTIONS - Described is the modulation of the neovascularization and/or growth of collateral arteries and/or other arteries from preexisting arteriolar connections. Methods are provided for enhancing neovascularization and/or the growth of collateral arteries and/or other arteries from preexisting arteriolar connections comprising contacting organs, tissue or cells with a colony stimulating factor (CSF) or a nucleic acid molecule encoding said CSF. Furthermore, the use of a CSF or a nucleic acid molecule encoding said CSF for the preparation of pharmaceutical compositions for enhancing neovascularization and/or collateral growth of collateral arteries and/or other arteries from preexisting arteriolar connections is described. Also provided are methods for the treatment of tumors comprising contacting an organ, tissue or cells with an agent which suppresses neovascularization and/or the growth of collateral arteries and/or other arteries from preexisting arteriolar connections through the inhibition of the biological activity of CSFs. Described is further the use of an agent which suppresses neovascularization and/or the growth of collateral arteries and/or other arteries from preexisting arteriolar connections through inhibition of the biological activity of CSFs for the preparation of pharmaceutical compositions for the treatment of tumors.04-09-2009
20090093410Methods for Local Treatment with Factor VII - The present invention provides methods for the local treatment of bleeding in a subject and/or reducing unwanted effects associated with the systemic administration of thrombotic agents to a subject, by local administration of FVII to the subject.04-09-2009
20090093409NEUROPROTECTIVE SYNERGY OF ERYTHROPOIETIN AND INSULIN-LIKE GROWTH FACTORS - The present invention provides a method of providing acute neuroprotection by inducing the erythropoietin (EPO) signaling pathway in neuronal cells close to or subsequent to the time of excitatory insult; and inducing an insulin-like growth factor (IGF) signaling pathway in the neuronal cells close to or subsequent to the time of excitatory insult, thereby producing a synergistic acute neuroprotective effect in the neuronal cells. The invention also provides a method of preventing or reducing the severity of a neurologic condition in a subject by administering to the subject EPO or an active fragment or analog thereof at a dose of at most 2000 U/kg; and administering to the subject an IGF or an active fragment or analog thereof, thereby providing neuroprotection and preventing or reducing the severity of the neurologic condition. Such a method can be used to prevent or reduce the severity of, for example, Alzheimer's disease, Parkinson's disease, Huntington's disease, epilepsy, amyotrophic lateral sclerosis, multiple sclerosis, a movement disorder, HIV-associated dementia, HIV-associated neuropathy, neuropathic pain, migraine, glaucoma, drug addiction, drug withdrawal, drug dependency, depression or anxiety.04-09-2009
20090093403SYSTEMS, METHODS AND COMPOSITIONS FOR OPTICAL STIMULATION OF TARGET CELLS - Stimulation of target cells using light, e.g., in vivo or in vitro, is implemented using a variety of methods and devices. One example involves a vector for delivering a light-activated NpHR-based molecule comprising a nucleic acid sequence that codes for light-activated NpHR-based molecule and a promoter. Either a high expression of the molecule manifests a toxicity level that is less than about 75%, or the light-activated NpHR-based proteins are expressed using at least two NpHR-based molecular variants. Each of the variants characterized in being useful for expressing a light-activated NpHR-based molecule that responds to light by producing an inhibitory current to dissuade depolarization of the neuron. Other aspects and embodiments are directed to systems, methods, kits, compositions of matter and molecules for ion pumps or for controlling inhibitory currents in a cell (e.g., in in vivo and in vitro environments).04-09-2009
20090093401CYSTATIN C AS AN ANTAGONIST OF TGF-BETA AND METHODS RELATED THERETO - Disclosed are Cystatin C (CysC) homologues, including CystC homologues that act as antagonists or inhibitors of transforming growth factor-β (TGF-β). Also disclosed are methods to identify CystC homologues that are antagonists or inhibitors of TGF-β and compositions and therapeutic methods using CystC and homologues thereof to regulate the activity of TGF-β, and TGF-β-mediated tumor malignancy and invasion and other TGF-β-mediated fibrotic or proliferative conditions and diseases.04-09-2009
20100160221EFFECT OF TULA ON HIV - A method of inhibiting a retrovirus production, the method includes administering a retrovirus inhibitor selected from at least one of a TULA protein, a fragment of TULA containing a UBA domain, a UBA domain of TULA, a peptide mimicking TULA, a peptide mimicking a fragment of TULA containing a UBA domain, a peptide mimicking a UBA domain of TULA, a polynucleotide encoding TULA, a polynucleotide encoding a fragment of TULA containing a UBA domain, a polynucleotide encoding a UBA domain of TULA, a polynucleotide encoding a peptide mimicking TULA, a polynucleotide encoding a peptide mimicking a fragment of TULA containing a UBA domain, a polynucleotide encoding a peptide mimicking the UBA domain of TULA, fragments thereof, muteins thereof, variants and splice variants thereof, and combinations thereof to a cell or a tissue infected by a retrovirus.06-24-2010
20100160227SIGNALING PEPTIDES - The present invention provides novel peptides of specified sequence and their use as a signal peptide or a membrane-anchoring peptide. It also relates to chimeric polypeptide comprising one or more such peptides and a polypeptide of interest as well as nucleic acid molecules, vectors, infections vital particles and host cells encoding such peptides and chimeric polypeptides. The present invention also relates to a pharmaceutical composition comprising such elements and a pharmaceutically acceptable vehicle. The present invention also provides a method for recumbently producing a polypeptide using such peptides, especially for directing expression of a polypeptide of interest extracellularly or anchored at the surface of the plasma membrane.06-24-2010
20090286727DP-78-Like Nanobodies - The present invention relates to Nanobodies® that have a high degree of sequence homology with human variable domain sequences from the V11-19-2009
20100160216ENHANCED TRANSPORT USING MEMBRANE DISRUPTIVE AGENTS - Compositions and methods for transport or release of therapeutic and diagnostic agents or metabolites or other analytes from cells, compartments within cells, or through cell layers or barriers are described. The compositions include a membrane barrier transport enhancing agent and are usually administered in combination with an enhancer and/or exposure to stimuli to effect disruption or altered permeability, transport or release. In a preferred embodiment, the compositions include compounds which disrupt endosomal membranes in response to the low pH in the endosomes but which are relatively inactive toward cell membranes (at physiologic pH, but can become active toward cell membranes if the environment is acidified below ca. pH 6.8), coupled directly or indirectly to a therapeutic or diagnostic agent. Other disruptive agents can also be used, responsive to stimuli and/or enhancers other than pH, such as light, electrical stimuli, electromagnetic stimuli, ultrasound, temperature, or combinations thereof. The compounds can be coupled by ionic, covalent or H bonds to an agent to be delivered or to a ligand which forms a complex with the agent to be delivered. Agents to be delivered can be therapeutic and/or diagnostic agents. Treatments which enhance delivery such as ultrasound, iontopheresis, and/or electrophereis can also be used with the disrupting agents.06-24-2010
20100160236Method for Preventing Formation of Trisulfide Derivatives of Polypeptides - A method for reducing or substantially preventing formation of a trisulfide derivative of a polypeptide in a liquid medium containing the polypeptide ijn question comprises stripping the liquid medium with a gas, suitably a chemically unreactive gas such as nitrogen or argon.06-24-2010
20100160237DRY FEEDSTUFF FOR CONTROLLING EXCESS WEIGHT AND OBESITY OF DOGS - The invention concerns a dry feedstuff designed to feed dogs containing at least 35% of proteins relative to dry matter, and/or a protein input more than 110 grams per 1 000 kcal of metabolizable energy, and its use as food, additive or veterinary medicine in particular for controlling excess weight and obesity in dogs.06-24-2010
20100160235FGF HOMOLOGS COMPOSITIONS AND USES THEREOF - The present invention relates to methods of using zFGF5 compositions to proliferate chondrocytes and their progenitors, and to induce deposition of cartilage. zFGF5 compositions are disclosed for treating disorders associated with chondrocytes, such as cartilage injuries and defects. In addition, methods for treating neurological disorders, such as stroke, are disclosed, and methods for using zFGF5 compositions to stimulate growth of cells associated with neurological injury and disease are disclosed.06-24-2010
20100160217ACETYLYCHOLINE GATED ION CHANNEL CHAPERONS AND METHODS OF USING THE SAME - The present invention provides receptor chaperons and means for producing cells having increased and/or decreased expression of nAChR subunit combinations and/or nAChR subtypes, which provide useful models for investigating pharmacological properties of the receptors and regulation of the binding sites of potential nAChR subtypes.06-24-2010
20100160223Synergetic Effects of HGF and Antibacterial Treatment - A method of treating an infection and/or an injury caused or complicated by an infection in a mammal, comprising providing an antibiotic or fungicide and either HGF or a polypeptide exhibiting HGF activity to said mammal. In one embodiment, the injury is not a chronic skin ulcer.06-24-2010
20090075879Novel Peptide Compositions and the Use Thereof, in Particular, in the Preparation of Active Pharmaceutical Compositions Against the Hepatitis C Virus - The invention relates to novel peptide compositions. In particular, the invention relates to a peptide composition comprising at least two peptides which are selected from among the following peptides: a peptide A having at least the amino acid sequence of SEQ ID No1, a peptide B having at least the amino acid sequence of SEQ ID No45, a peptide C having at least the amino acid sequence of SEQ ID No127, and a peptide D having at least the amino acid sequence of SEQ ID No 174. The inventive compositions can be used, in particular, in the preparation of active pharmaceutical compositions against the hepatitis C virus.03-19-2009
20090286724AGGREGABLE GLP-1 ANALOGUE AND SUSTAINED-RELEASE PHARMACEUTICAL COMPOSITION - The present invention provides a GLP-1 analogue having a high association-aggregability or a pharmaceutically acceptable salt thereof, and a pharmaceutical composition to be used for preventing or treating diabetes, hyperglycemia, a diabetic complication caused by diabetes or hyperglycemia, or obesity, using the same.11-19-2009
20100190706Stable Non-Aqueous Pharmaceutical Compositions - The present invention relates to shelf stable non-aqueous pharmaceutical compositions, and to the use thereof in methods of treating diabetes and hyperglycaemia, comprising insulinotropic peptide and semi-polar protic organic solvent.07-29-2010
20100190711BIG GASTRIN I AS A THERAPEUTIC AGENT - The present invention is directed to the use of the peptide compound Pyr-Leu-Gly-Pro-Gln-Gly-Pro-Pro-His-Leu-Val-Ala-Asp-Pro-Ser-Lys-Lys-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH07-29-2010
20100190699GLUCAGON ANALOGS EXHIBITING ENHANCED SOLUBILITY IN PHYSIOLOGICAL pH BUFFERS - Modified glucagon peptides are disclosed having improved solubility while retaining glucagon agonist activity. The glycogen peptides have been modified by substitution of native amino acids with, and/or addition of, charged amino acids to the carboxy terminus of the peptide. The modified glucagon agonists can be further modified by pegylation, or the addition of a carboxy terminal peptide selected from the group consisting of SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 23, or both to further enhance the solubility of the glucagon agonist analogs.07-29-2010
20090018075Peptides in Inhibiting Insects - The subject invention pertains to the use of peptide fragments of cadherins (including cadherin-like proteins). The subject invention includes a cell (and use thereof) comprising a polynucleotide that expresses the peptide fragment. The subject invention includes methods of feeding the peptides to insects. In preferred embodiments, the peptides are fed to target insects together with one or more insecticidal proteins, preferably (but not limited to) B.t. Cry proteins. When used in this manner, the peptide fragment can not only enhance the apparent toxin activity of the Cry protein against the insect species that was the source of the receptor but also against other insect species. Preferably, the cadherin is a 01-15-2009
20090018073Methods for treating muscle diseases and disorders - The invention relates to methods of treating diseases and disorders of the muscle tissues in a vertebrate by the administration of compounds which bind the p18501-15-2009
20090018069Methods and Compositions Related to Mutant Kunitz Domain I of Tfpi-2 - Disclosed are methods and compositions relating to plasmin inhibition.01-15-2009
20090048163Nucleic acid and protein sequences of asporins - Mouse asporin protein and nucleic acid sequences are disclosed. The protein contains a unique aspartic acid region near the N-terminus. The central domain contains ten leucine rich repeats. Sequences consistent with other class I small leucine rich repeat proteoglycans (SLRP) are also observed. Methods of use for the protein include regulating the complement system, inhibiting fibrosis formation, regulating the growth of endothelial cells and angiogenesis, regulating or inhibiting the growth of cancer cells, and regulating the functions of neuromuscular junctions.02-19-2009
20090048170TARGET FOR ANTI-ANGIOGENESIS THERAPY - The present disclosure concerns the use of peptides and compositions, such as pharmaceutical compositions, to influence angiogenesis. Particular methods are useful for promoting angiogenesis, while others are particularly useful for inhibiting angiogenesis.02-19-2009
20090048169Identification of Crmp4 as a Convergent Regulator of Axon Outgrowth Inhibition - The present invention relates to the identification of the cytosolic phosphoprotein CRMP4b as a protein that physically and functionally interacts with RhoA to mediate neurite outgrowth inhibition. siRNA-mediated knockdown of CRMP4 promotes neurite outgrowth on myelin substrates indicating a critical role for CRMP4 in neurite outgrowth inhibition. Disruption of CRMP4b-RhoA binding with a competitive inhibitor attenuates neurite outgrowth inhibition on myelin and aggrecan substrates. Stimulation of neuronal growth cones with Nogo leads to co-localization of CRMP4b and RhoA at discrete regions within the actin-rich central and peripheral domains of the growth cone indicative of a potential function in cytoskeletal rearrangements during neurite outgrowth inhibition. Together these data indicate that a RhoA-CRMP4b complex forms in response to inhibitory challenges in the growth cone environment and regulate cytoskeletal dynamics at distinct sites necessary for axon outgrowth inhibition. Competitive inhibition of CRMP4b-RhoA binding suggests a novel, highly specific therapeutic avenue for promoting regeneration following CNS injury.02-19-2009
20090048167DISEASE TREATMENT VIA ANTIMICROBIAL PEPTIDES OR THEIR INHIBITORS - The invention provides methods for the treatment of disease and promotion of healing that include providing a therapeutically effective amount of a mammalian antimicrobial peptide (AMP) or analog thereof, in particular a cathelicidin or cathelicidin fragment or cathelicidin analog, thereby treating the disease in the subject in need thereof. The invention also provides specific analogs or fragments of cathelicidin that function as agonists, as do endogenous cathelicidins, or as either dominant negatives or as inhibitors to endogenous cathelicidin or to other endogenous AMPs or that compete with pro-inflammatory agents or fragments of AMPs on cognate receptors without inducing disease.02-19-2009
20090048166NOVEL PEPTIDES THAT BIND TO THE ERYTHROPOIETIN RECEPTOR - The present invention relates to peptide compounds that are agonists of the erythropoietin receptor (EPO-R). The invention also relates to therapeutic methods using such peptide compounds to treat disorders associated with insufficient or defective red blood cell production. Pharmaceutical compositions, which comprise the peptide compounds of the invention, are also provided.02-19-2009
20090048161Cytokine receptor modulators and uses thereof - The present invention relates to cytokine receptor-binding compounds, such as non-competitive VEGF receptor, IL-1 receptor, IL-4 receptor, or IGF-1 receptor-binding peptides and petidomimetic antagonists, and therapeutic uses of such compounds. The compounds of the present invention may be used in the treatment of cytokine-associated diseases such as proliferative disorders (for example, colon, breast, prostate, and lung cancer), abnormal neovascularization and angiogenesis, age-related macular degeneration, and proliferative and/or inflammatory skin disorders such as psoriasis.02-19-2009
20090048164THERAPEUTIC PRO-APOPTOTIC BH3-LIKE MOLECULES AND METHODS FOR GENERATING AND/OR SELECTING THE SAME - The present invention relates generally to therapeutic molecules which are useful for modulating apoptosis in a target cell or cell population. More particularly, the present invention provides therapeutic agents which inhibit pro-survival molecules and which are capable of inducing or facilitating apoptosis of a target cell or cell population such as cancer cells. The present invention further provides methods for generating or selecting the therapeutic molecules and pharmaceutical compositions comprising the therapeutic molecules.02-19-2009
20090048157USE OF ORGANIC COMPOUNDS - This invention relates generally to calcitonin and their use in bone growth. Specifically, the invention relates to the use of calcitonin, e.g. salmon calictonin, to stimulate new bone formation in patients in need thereof.02-19-2009
20090111749Delivery of Active Agents - A method of introducing a physiologically-active agent into the circulatory system of a mammal is disclosed herein. The method utilizes a rapid drug delivery system which prevents deactivation or degradation of the active agent being administered to a patient in need of treatment. In particular, the drug delivery system is designed for pulmonary drug delivery such as by inhalation, for delivery of the active agents such as proteins and peptides to the pulmonary circulation in a therapeutically effective manner avoiding degradation of the active agents in peripheral and vascular tissue before reaching the target site.04-30-2009
20100184690Combined Use Of A GLP-1 Compound And A Modulator Of Diabetic Late Complications - Methods and uses for treatment of diabetic late complications comprising administration of a GLP-1 compound and a modulator of diabetic complications.07-22-2010
20100184686USE OF INHIBITORS FOR THE TREATMENT OF RTK-HYPERFUNCTION-INDUCED DISORDERS, PARTICULARLY CANCER - The present invention concerns the use of inhibitors for the treatment and/or prophylaxis of diseases which are the consequence of increased receptor tyrosine kinase activity, particularly cancer. The use is particularly directed towards inhibition or lowering of the overexpression and/or altered activity of receptor tyrosine kinases (RTKs). In particular, this altered activity of receptor tyrosine kinase can be triggered by a mutation of FGFR-4, wherein this mutation is in particular a point mutation in the transmembrane domain of FGFR-4 and leads to an exchange of a hydrophobic amino acid for a hydrophilic amino acid. The invention further concerns the use of an inhibitor directed against FGFR-4, for the treatment and/or prophylaxis of cancer. Furthermore, the invention concerns a mutated FGFR-4, which leads to over-expression and/or altered activity in cells. Finally, the invention concerns a DNA and RNA sequence of a mutated FGFR-4 molecule. Finally, in addition the invention concerns a pharmaceutical composition, containing the inhibitor as described above and further a diagnostic and screening procedure.07-22-2010
20100184680THERAPEUTIC USES OF B-TYPE NATRIURETIC PEPTIDE AND HUMAN GROWTH HORMONE 1-43 - The present invention is directed to the use of the peptide compound Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His as a therapeutic agent for the pro-phylaxis and/or treatment of cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurodegenerative diseases, infectious diseases, lung diseases, heart and vascular diseases and metabolic diseases. Moreover the present invention relates to pharmaceutical compositions preferably in form of a lyophilisate or liquide buffer solution or artificial mother milk formulation or mother milk substitute containing the peptide Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His optionally together with at least one pharmaceutically acceptable carrier, cryoprotectant, lyoprotectant, excipient and/or diluent.07-22-2010
20100184682Composition and Methods for the Inhibition of Membrane Fusion by Paramyxoviruses - Fusion of the membrane of enveloped viruses with the plasma membrane of a receptive host cell is a prerequisite for viral entry and infection and an essential step in the life cycle of all enveloped viruses, such as paramyxoviruses. The instant invention is directed to providing polypeptides which are a heptad portion of a Henipavirus F protein effective against fusion between a membrane of a paramyxovirus and a plasma membrane of a cell. The instant invention also provides nucleic acids, compositions, and methods effective against paramyxovirus infection. Accordingly, the instant invention provides therapeutic agents and vaccines effective against paramyxoviruses viruses, especially HeV or NiV.07-22-2010
20100184668 METHOD OF TREATING ABNORMAL ANGIOGENESIS VIA THE BAI FAMILY OF PROTEINS AND THEIR PROTEIN FRAGMENTS - The present disclosure encompasses the protein BAI1, and two cleavage products thereof, Vstat120 and Vstat40. The disclosure also describes the use of BAI1, and two cleavage products thereof, Vstat120 and Vstat40, as an anti-angiogenic and anti-tumorigenic therapy for gliomas as well as its other types of cancer and conditions involving aberrant angiogenesis. One aspect of the disclosure therefore provides a polypeptide, derived from the protein BAI1, comprising an integrin binding domain and a thrombospondin type 1 repeat. Another aspect of the disclosure provides methods of inhibiting the formation of a tumor sustained or disseminated by angiogenesis, comprising: contacting a developing tumor with one of the polypeptides derived from the protein BAI1 whereupon angiogenesis is inhibited, and thereby inhibiting the formation of the tumor. Another aspect of the disclosure is pharmaceutical compositions comprising a Vstat120 and Vstat40 polypeptide, or variants thereof, an at least one carrier for delivery to an animal or human patient.07-22-2010
20100184659Sustained-Release Formulations Comprising Crystals, Macromolecular Gels, and Particulate Suspensions of Biologic Agents - The present invention is directed to sustained release formulations of biologic agents which permit persistent bioavailability. Preferred biologic agents include bone morphogenetic proteins. Diseases susceptible to amelioration and/or treatment with the formulations of the present invention include skeletal tissue diseases such as, but not limited to, osteoarthritis and other osteochondral diseases. The sustained release formulations of the present invention are especially suitable for treatment of minimally-vascularized or non-vascularized tissue sites such as, but not limited to, intra joint, interarticular, or intraminiscal sites.07-22-2010
20100184665METHOD FOR ACTIVATING RECEPTOR BY COFACTOR AND METHOD FOR UTILIZING LIGAND ACTIVITY - Using betaKlotho or a substance that increases or inhibits betaKlotho activity as an agent for controlling the activity of FGF21 mediated by an FGF receptor, the present invention provides a pharmaceutical composition comprising such betaKlotho or such substance as an active ingredient, particularly, a pharmaceutical composition for anti-metabolic syndrome, and further particularly, a pharmaceutical composition for therapeutic or preventive use associated with the control of blood glucose level. In addition, the present invention provides a screening system for each of a substance that enhances or suppresses betaKlotho activity, an FGF21-like active substance, and a betaKlotho-like active substance, which uses a cell system that has expressed an FGF receptor and/or betaKlotho on the surface thereof.07-22-2010
20100184670ANTISENSE COMPOSITIONS AND METHODS FOR MODULATING CONTACT HYPERSENSITIVITY OR CONTACT DERMATITIS - Provided are methods and compositions, including topical compositions, for inducing tolerance to a sensitizing agent known to provoke contact hypersensitivity in a subject. Included are methods of topically applying to the subject an effective amount of an antisense composition targeting the start site or splice site of a CFLAR mRNA.07-22-2010
20100184675USE OF GLUCAGON (1-29) ALONE OR IN COMBINATION WITH NEUROPEPTIDE W30 AS A THERAPEUTIC AGENT - The present invention is directed to the use of the peptide compound His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH as a therapeutic agent for the prophylaxis and/or treatment of cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurodegenerative diseases, infectious diseases, lung diseases, heart and vascular diseases and metabolic diseases. Moreover the present invention relates to pharmaceutical compositions preferably in form of a lyophilisate or liquid buffer solution or artificial mother milk formulation or mother milk substitute containing the peptide His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH optionally together with at least one pharmaceutically acceptable carrier, cryoprotectant, lyoprotectant, excipient and/or diluent.07-22-2010
20100184662METHOD FOR ASSAYING ANTIBODIES IN BODY FLUIDS BY IMMUNE REACTION WITH GLYCOPROTEIN 2 (GP2) FROM ZYMOGENIC GRANULES OF THE PANCREAS FOR THE DIFFERENTIAL DIAGNOSIS OF INFLAMMATORY INTESTINAL DISEASES AND CHRONIC PANCREATITIS - The invention relates to a method for the detection of antibodies from body fluids via immune reaction with GP2 from pancreatic zymogenic granules, immunoreactive sequences or analogs thereof, excluding tissue sections.07-22-2010
20100184661CONJUGATE COMPRISING ANGIOSTATION OR ITS FRAGMENT, THE METHOD FOR PRODUCING THE CONJUGATE AND USE THEREOF - The present invention provides an anti-tumor or anti-angiogenesis medicament, the combination or kit containing the medicament, and the method for producing the same. The anti-tumor or anti-angiogenesis medicament contains a conjugate comprising a modifying agent and the angiostatin or its fragments, wherein the conjugate exhibits prolonged in vivo half-life as compared to an unmodified angiostatin or its fragments. The modifying agent is selected from the group consisting of macromolecular polymers, protein molecules or fragments thereof, peptides, small molecules, or chemical substances of any other forms.07-22-2010
20080306006MicroRna-Based Methods and Compositions for the Diagnosis, Prognosis and Treatment of Solid Cancers - The present invention provides novel methods and compositions for the diagnosis and treatment of solid cancers. The invention also provide methods of identifying inhibitors of tumorigenesis.12-11-2008
20090318358COMPOSITIONS AND METHODS OF USE OF ORF 554 FROM BETA HEMOLYTIC STREPTOCOCCAL STRAINS - The present invention relates to compositions and methods of use comprising peptidyl-prolyl isomerase (PPI) polypeptides of group C and G streptococci and polynucleotides encoding same. The invention also relates to immunogenic compositions comprising the PPI polypeptides and polynucleotides, as well as antibodies and antibody fragments that bind the PPI polypeptides. In addition, the invention relates to methods of inducing an immune response in a subject against beta hemolytic streptococci using the immunogenic compositions, as well as conferring passive immunity by administering a therapeutic antibody or antibody fragment.12-24-2009
20090318352Materials and Methods Involving Hybrid Vascular Endothelial Growth Factor DNAs and Proteins - The present invention provides polypeptides that bind cellular receptors for vascular endothelial growth factor polypeptides; polynucleotides encoding such polypeptides; compositions comprising the polypeptides and polynucleotides; and methods and uses involving the foregoing. Some polypeptides of the invention exhibit unique receptor binding profiles compared to known, naturally occurring vascular endothelial growth factors.12-24-2009
20090318346BIVALENT ErbB LIGAND BINDING MOLECULES AND METHODS FOR THEIR PREPARATION AND USE - A new bivalent ErbB-based ligand binding molecule is disclosed along with its method of preparation and use. The binding molecule can be a protein expressed from a recombinant DNA molecule. The protein can contain two extracellular domains of an ErbB receptor that both bind to ErbB receptor ligands. These binding molecules act as traps to bind and sequester ligands, thus making them unavailable for binding to cellular ErbB receptors.12-24-2009
20090318344COMPOSITIONS AND METHODS FOR MODULATING HEMOSTASIS USING VARIANT FORMS OF ACTIVATED FACTOR V - Methods for the treatment of coagulation disorders using Factor V/Va variants are provided.12-24-2009
20090318338METHODS FOR MODULATING BONE FORMATION AND MINERALIZATION BY MODULATING KRC ACTIVITY - This invention demonstrates that KRC molecules have multiple important functions as modulating agents in regulating a wide variety of cellular processes including bone formation and mineralization. TGF-β signaling in osteoblasts promotes the formation of a multimeric complex between KRC, Runx2, Smad3, and the E3 ubiquitin ligase, WWP1 which inhibits Runx2 function due to the ability of WWP1 to promote Runx2 polyubiquitination and proteasome-dependent degradation. Furthermore, KRC and WWP1 form a complex with RSK2 which promotes RSK2 phosphorylation and inhibits RSK2 function due to the ability of WWP 1 to promote RSK2 ubiquitination. Methods for identifying modulators of KRC activity are provided. Methods for modulating an immune response, bone formation and mineralization, and KRC-associated disorders using agents that modulate KRC expression and/or activity are also provided.12-24-2009
20100261652Tissue Adhesive Using Engineered Proteins - There is provided in one embodiment of the disclosure a tissue adhesive composition comprising an engineered protein having repeated blocks of an elastin domain and at least one cell-binding domain and further comprising a polymer crosslinker. When the engineered protein and the polymer crosslinker are introduced onto a tissue, the engineered protein and the polymer crosslinker initiate an in situ crosslinking reaction to form an adhesive bond that is mechanically strong, transparent, biocompatible, and stimulates regrowth of one or more tissue layers over the adhesive bond. In another embodiment of the disclosure there is provided a molded corneal onlay and method of making the same.10-14-2010
20100168029METHODS FOR TREATING BONE TUMORS - The present invention provides methods of treating bone cancer, inducing differentiation of bone tumor cells, inhibiting bone tumor growth, inducing bone tumor regression or treating a hyperproliferative cell disorder by administering a pharmaceutically effective amount of a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein.07-01-2010
20100168021UROCORTIN PROTEINS AND USES THEREOF - A human urocortin-related peptide with significant sequence homology to the CRF neuropeptide family was identified. A mouse cDNA was isolated from whole brain poly (A+) RNA that encodes a predicted 38 amino acid peptide protein designated herein as urocortin II. Both human URP and mouse Ucn II are structurally related to the other known mammalian family members, CRF and urocortin (Ucn). These peptides are involved in the regulation of the hypothalamic-pituitary-adrenal axis under basal and stress conditions, suggesting a similar role for URP and Ucn IL Synthesized Ucn-II and URP peptide binds with higher affinity to CRF-R2 than to CRF-R1 Ucn II and human URP appear to be involved in the regulation of body temperature and appetite and may play a role in other stress related phenomenon. These findings identify Ucn II and human URP as a new members of the CRF family of neuropeptides, which are expressed centrally and bind to CRF-R2.07-01-2010
20100168014Screening method - The present inventors have found that relaxin-3 has a feeding-stimulating activity, a body weight increasing activity, and fat weight increasing activity by intracerebroventricularly administering relaxin-3 to rats and observing the amount of feeding, body weight and fat weight, and so on after the administration. According to the present invention, a polypeptide having useful effects in stimulating feeding, increasing body weight, and fattening; a therapeutic agent containing said polypeptide; a method of screening for a compound, a substance, or a salt thereof which activates or suppresses a receptor of said polypeptide; a kit for said screening; and an agent which comprises a substance which inhibits expression of said polypeptide, such as a feeding-surpressing agent, a therapeutic agent for the treatment of obesity, and a therapeutic agent for the treatment of diabetes.07-01-2010
20100168023Injectable Botulinum Toxin Formulations - This invention provides novel injectable compositions comprising botulinum toxin that may be administered to a subject for various therapeutic, aesthetic and/or cosmetic purposes. The injectable compositions contemplated by the invention exhibit one or more advantages over conventional botulinum toxin formulations, including reduced antigenicity, a reduced tendency to undergo unwanted localized diffusion following injection, increased duration of clinical efficacy or enhanced potency relative, faster onset of clinical efficacy, and/or improved stability.07-01-2010
20100190715Stable Formulations of Peptides - Method for increasing the shelf-life of a pharmaceutical formulation comprising a glucagon-like peptide.07-29-2010
20100190708Composition for amelioration of body lipid - An object of the present invention is to obtain a composition, which is excellent in amelioration of a lipid metabolism disorder and has a preventive or ameliorating effect on hyperlipemia, obesity or type II diabetes induced by the lipid metabolism disorder, and is also economical and safe with respect to allergy, by extracting a rice bran extract containing a rice bran protein, followed by separation.07-29-2010
20100190702Compositions and Methods of Treating Neoplasia - The invention features compositions and methods that are useful for the treatment of neoplasia by reducing base excision repair (BER). Such compositions are useful, for example, for enhancing the efficacy of known chemotherapeutics, such as DNA alkylating agents. In particular, the invention features agents that mimic the interaction of APC with pol-β. Such agents reduce the activity of long patch- and single nucleotide-base extension repair pathways.07-29-2010
20100168012HUMAN CANCER THERAPY USING ENGINEERED MATRIX METALLOPROTEINASE-ACTIVATED ANTHRAX LETHAL TOXIN THAT TARGETS TUMOR VASCULATUTURE - The present invention provides methods for inhibiting tumor associated angiogenesis by administering a mutant protective antigen protein comprising a matrix metalloproteinase-recognized cleavage site in place of the native protective antigen furin-recognized site in combination with a lethal factor polypeptide comprising a protective antigen binding site. Upon cleavage of the mutant protective antigen by a matrix metalloproteinase, the lethal factor polypeptide is translocated into cancer and endothelial cells and inhibits tumor associated angiogenesis.07-01-2010
20100184689Pharmaceutical Composition Containing Botulinum Neurotoxin - A composition, medicament or use, comprising or consisting of 07-22-2010
20100184683ANTIBACTERIAL AND ANTIFUNGAL PEPTIDES - This invention provides novel antimicrobial peptides and formulations thereof. The peptides and/or formulations are effective to kill or to inhibit the growth and/or proliferation of various bacteria, yeast, and fungi.07-22-2010
20100184681ANTIBACTERIAL AND ANTIFUNGAL PEPTIDES - This invention provides novel antimicrobial peptides and formulations thereof. The peptides and/or formulations are effective to kill or to inhibit the growth and/or proliferation of various bacteria, yeast, and fungi.07-22-2010
20100184671Binding molecules for the treatment of myeloid cell malignancies - Provided is a human C-type lectin, binding molecules that specifically bind to the human C-type lectin, nucleic acid molecules encoding the binding molecules or the human C-type lectin, compositions comprising the binding molecules or the human C-type lectin and methods of identifying or producing the binding molecules. The human C-type lectin is specifically expressed on myeloid cells and binding molecules capable of specifically binding to the human C-type lectin can be used in the diagnosis, prevention and/or treatment of neoplastic disorders and diseases.07-22-2010
20100184672PROTEIN C FOR USE IN MAINTAINING HEMOSTASIS - It is disclosed herein that protein C functions as a hemostatic agent. Thus, provided is a method of preventing, treating or ameliorating abnormal bleeding in a subject, comprising administering to the subject a protein C polypeptide or polynucleotide. Abnormal bleeding can result from a bleeding disorder, such as hemophilia or a platelet disorder, or from a bleeding episode, such as from a traumatic injury.07-22-2010
20100184673USE OF PARATHYROID HORMONE ( 1-34 ) AS ANTI-HIV AGENT - The present invention is directed to the use of the peptide compound Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe as a therapeutic agent for the prophylaxis and/or treatment of cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurodegenerative diseases, infectious diseases, lung diseases, heart and vascular diseases and metabolic diseases. Moreover the present invention relates to pharmaceutical compositions preferably in form of a lyophilisate or liquid buffer solution or artificial mother milk formulation or mother milk substitute containing the peptide Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe optionally together with at least one pharmaceutically acceptable carrier, cryoprotectant, lyoprotectant, excipient and/or diluent.07-22-2010
20100184666NOVEL USE OF COCOA EXTRACT - A cocoa extract obtainable by the extraction of non-defatted cocoa beans which have not been fermented or have been allowed to ferment for no more than three days, having a polyphenol content of more than 25% by weight, may be used in weight management.07-22-2010
20100184667MODIFIED PLASMINOGEN ACTIVATOR INHIBITOR TYPE-1 MOLECULE AND METHODS BASED THEREON - The present invention relates to a modified plasminogen activator inhibitor type-1 (PAI-1) molecule that displays CN an increased in vivo half-life of the active form of PAI-1, but is deficient in one or more functional activities as compared to the wild-type PAI-1 protein. The modified PAI-1 molecule that displays an increased half-life further displays at least one of the following funtional characteristics: (i) decreased binding activity to at least one of the following molecules: urokinase plasminogen activator (uPA), tissue plasminogen activator (tPA) and vitronectin (Vn); and (ii) decreased specific activity against at least one of the following molecules: uPA, tPA and Vn. The invention further relates to pharmaceutical compositions comprising modified PAI-1 molecules and methods of using these pharmaceutical compositions for treatment.07-22-2010
20100184663Methods and Compositions Related to Inhibition of Viral Entry - Disclosed are compositions and methods for inhibiting viral entry.07-22-2010
20100184658COMPOSITIONS AND METHODS FOR DIAGNOSIS AND TREATMENT OF TYPE 1 DIABETES - The present invention relates generally to the identification of biological markers associated with an increased risk of developing Diabetes, as well as methods of using such biological markers in diagnosis and prognosis of Diabetes. The biological markers of the invention may indicate new targets for therapy or constitute new therapeutics for the treatment or prevention of Diabetes.07-22-2010
20100184660SINGLE EXON GENES ENCODING FOR NOVEL BIO-ACTIVE PEPTIDES - The present invention relates to novel bio-active peptide hormone, process for the production of the same, and use of the same. The present invention identified novel bioactive peptide precursor and salts thereof which can be used as drugs, for example therapeutic polypeptides, ligands to discover relevant targets (e.g. GPCRs) or targets for drug intervention.07-22-2010
20100184656PANTROPIC NEUROTROPHIC FACTORS - Pantropic neurotrophic factors which have multiple neurotrophic specificities are provided. The pantropic neurotrophic factors of the present invention are useful in the treatment of neuronal disorders. Nucleic acids and expression vectors encoding the pantropic neurotrophins are also provided.07-22-2010
20100184657METHODS OF TREATING EPITHELIAL LESIONS OUTSIDE THE STOMACH AND INTESTINES - Intestinal trefoil factors and nucleic acids encoding intestinal trefoil factors are disclosed. The intestinal trefoil factors disclosed are resistant to destruction in the digestive tract and can be used for the treatment of peptic ulcer diseases, inflammatory bowel diseases, and other insults.07-22-2010
20100184651TARGETED FUSION PROTEINS FOR CANCER THERAPY - The invention relates to fusion proteins useful as therapeutics against cancer. The fusion protein comprises of cell-targeting moiety and apoptosis-inducing moiety. Cell-targeting moiety and apoptosis-inducing moiety are linked by a flexible linker, which are specifically recognized by cancer specific protease and cleaved in situ to release the apoptotic domain. In particular, the invention is illustrated by a recombinant fusion protein between human Vasoactive Intestinal Peptide (VIP) and BH3 domain of Bcl2 family protein, linked by a linker that has site for cancer specific proteases. The fusion protein specifically targets VIP receptor over-expressing cancer cells and induces cell-specific apoptosis after cleavage at the linker site by cancer specific proteases. Such fusion proteins are useful for the delivery of therapeutic/apoptotic moiety (peptides) to specific cells with perturbed expression of, but not limited to neuropeptide receptors.07-22-2010
20100184653Derivates of Polyethylene Glycol Modified Thymosin Alpha 1 - Pharmaceutical compositions that include thymosin alpha 1 peptide derivatives modified at the C-terminal of the peptide chain with polyethylene glycol, and their pharmaceutical acceptable salts, are generally disclosed. Also, new methods used to prepare these thymosin alpha 1 peptide derivatives modified at the C-terminal of the peptide chain with polyethylene glycol are generally provided. The presently disclosed compounds and their salts can be prepared administered to humans to treat immune disease and can also be used in adjuvant treatment.07-22-2010
20090318349TRANSGLUTAMINASE VARIANTS WITH IMPROVED SPECIFICITY - Variants of transglutaminase from 12-24-2009
20090318348Proteins, Nucleic Acids Encoding the Same, and Associated Methods of Use - Disclosed herein are nucleic acid sequences that encode novel polypeptides. Also disclosed are polypeptides encoded by these nucleic acid sequences, and antibodies, which immunospecifically-bind to the polypeptide, as well as derivatives, variants, mutants, or fragments of the aforementioned polypeptide, polynucleotide, or antibody. The invention further discloses therapeutic, diagnostic and research methods for diagnosis, treatment, and prevention of disorders involving any one of these novel human nucleic acids and proteins.12-24-2009
20090318343Protein Formulations for Use at Elevated Temperatures - Liquid formulations of bone morphogenetic proteins are provided for prolonged use at elevated temperatures. More specifically, the invention relates to liquid formulations comprising rhGDF-5, trehalose, and one or more biocompatible excipients that provide stability to the protein for at least 30 days at temperatures up to body temperature.12-24-2009
20090318350PAN-HER ANTAGONISTS AND METHODS OF USE - The present invention features human epidermal receptor (HER) antagonists. These antagonists are polypeptide variants of ligands of HER. The HER ligand polypeptide variants of the invention possess Pan-HER antagonistic properties and can inhibit at least one HER-mediated biological activity of one or more HER subtypes, such as inhibition of the receptor's kinase activation activity and subsequently, cell proliferation. Such polypeptide variants, and nucleic acids encoding these polypeptide variants can be used therapeutically in situations in which inhibition of HER activity is indicated.12-24-2009
20090318347NOVEL COMPOUNDS AND THEIR EFFECTS ON FEEDING BEHAVIOUR - The invention provides a compound of formula (I): X-PYY*(3-36) (I) wherein X is selected from H, PYY12-24-2009
20100210550Novel Bacillus Thuringiensis Crystal Polypeptides, Polynucleotides, and Compositions Thereof - The present invention provides insecticidal polypeptides related to 08-19-2010
20090298769COMPOUNDS AND METHODS OF MODULATING ANGIOGENESIS - A method of modulating angiogenesis in a tissue comprises administering to the tissue a therapeutically effective amount of an agent that modulates complex formation of α12-03-2009
20090149380VASOSTATIN AS MARROW PROTECTANT - Specific fragments of vasostatin are disclosed. These fragments are of use in methods of stimulating the proliferation or survival of a hematopoietic cell exposed to a chemotherapeutic agent or irradiation. Methods of stimulating the proliferation or survival of a hematopoietic cell using these fragments are also disclosed. In one embodiment, methods are disclosed for stimulating the growth or survival of a hematopoietic stem cell with a fragment of vasostatin, in the presence of a growth factor.06-11-2009
20080214462FIX-Mutant Proteins for Hemophilia B Treatment - The present invention relates to recombinant blood coagulation factor IX (rFIX) mutants having improved FIX clotting activity. Three full length FIX proteins with combinations of mutations of amino acids important for functional activity of FIX and FIX wild type were cloned and expressed in HEK 293 cells. The proteins were tested by an activated partial thromboplastin time (aPTT) assays in FIX-depleted plasma. Two mutant proteins had increased specific FIX activity. Furthermore, a pre-activated FIX protein had an increased activity in FIX-depleted plasma. Therefore these FIX mutants can be used for the treatment of FIX associated bleeding disorders.09-04-2008
20080214465Method of administering and using VEGF inhibitors for the treatment of human cancer - A method of treating a human patient suffering from cancer, comprising administering an effective amount of a vascular endothelial growth factor (VEGF) trap antagonist to the human patient, the method comprising: (a) administering to the patient an initial dose of at least approximately 0.3 mg/kg of the VEGF antagonist; and (b) administering to the patient a plurality of subsequent doses of the VEGF antagonist in an amount that is approximately the same or less of the initial dose, wherein the subsequent doses are separated in time from each other by at least one day. The methods of the invention are useful for treating a human cancer selected from the group consisting of renal cell carcinoma, pancreatic carcinoma, breast cancer, prostate cancer, colorectal cancer, malignant mesothelioma, multiple myeloma, ovarian cancer, and melanoma. The invention is further useful for treating a condition which benefits from the reduction of VEGFA and placental growth factor (PLGF).09-04-2008
20080214460Formulations for cosmetic and wound care treatments with photosensitizers as fluorescent markers - Photoactive materials, such as photosensitizers, are used as fluorescent markers for in vivo detection of the distribution of the injected filler material during cosmetic treatments. In one preferred embodiment, liposomal formulated temoporfin is used, as the photoactive component, in very small concentrations along with fillers for cosmetic and wound healing applications. Fillers, which can be used in the invention, include collagen, hyaluronic acids and other synthetic or natural products which are generally used in wound healing, scar reduction and other such medical applications. In a preferred embodiment, the formulated photosensitizer is coupled to the filler so that tracking is possible over longer periods of time A liposomal formulated photosensitizer is injected with the fillers into the treatment area, and is irradiated with laser light shortly after injection. The emitted fluorescence is measured by a special non-invasive device. Thereby it is possible to monitor the injection site and the distribution of the injected solution around the injection site. When irradiated with laser or other light source, the fluorescence of the photosensitizer is detected using a fluorescence detector, which permits tracking the filler at injection site and in the injection volume.09-04-2008
20080214456Lkktet and/or Lkktnt Peptide Compositions and Methods - A composition including a peptide agent including amino acid sequence LKKTET or LKKTNT, a conservative variant thereof, or a stimulating agent that stimulates production of an LKKTET or LKKTNT peptide, or a conservative variant thereof, and an ophthalmically acceptable carrier, an antimicrobially effective preservative, a tonicity agent for providing the composition with an ophthalmically acceptable tonicity, a comfort enhancing agent, at least one of an acidic or basic pH adjusting agent capable of adjusting pH of the composition to a desired ophthalmically acceptable pH level, and a buffer to substantially maintain the desired pH level.09-04-2008
20100227814INHIBITORS OF GSK-3 AND CRYSTAL STRUCTURES OF GSK-3BETA PROTEIN AND PROTEIN COMPLEXES - The present invention relates to inhibitors of GSK-3 and methods for producing these inhibitors. The invention also provides pharmaceutical compositions comprising the inhibitors and methods of utilizing those compositions in the treatment and prevention of various disorders, such as diabetes and Alzheimer's disease. In addition, the invention relates to molecules or molecular complexes which comprise binding pockets of GSK-3β or its homologues. The invention relates to a computer comprising a data storage medium encoded with the structure coordinates of such binding pockets. The invention also relates to methods of using the structure coordinates to solve the structure of homologous proteins or protein complexes. The invention relates to methods of using the structure coordinates to screen for and design compounds that bind to GSK-3β protein or homologues thereof. The invention also relates to crystallizable compositions and crystals comprising GSK-3β protein or GSK-3β protein complexes.09-09-2010
20100216712NUCLEIC ACID CODIFYING FOR A UTROPHIN TRANSCRIPTION SPECIFIC REGULATING PROTEIN, PROTEIN CODIFIED THEREBY AND USES THEREOF - The present invention relates to a nucleic acid molecule comprising a nucleotide sequence codifying for a protein characterized in having at least four zinc finger domains and in modulating the transcription of the utrophin gene by binding to a nucleotidic sequence comprised in a utrophin gene untranscribed regulatory sequence. Protein codified thereby and uses thereof.08-26-2010
20100216709SYSTEMIC INSULIN-LIKE GROWTH FACTOR-1 THERAPY REDUCES DIABETIC PERIPHERAL NEUROPATHY AND IMPROVES RENAL FUNCTION IN DIABETIC NEPHROPATHY - The present invention provides methods of treatment of patients suffering from the complications of blood sugar disorders: diabetic peripheral neuropathy and diabetic nephropathy by administration of IGF-1 via protein therapy or gene therapy. It relates to methods of treating an individual having a diabetic disorder or a hyperglycemic disorder, comprising administering to the individual an effective amount of a DNA vector expressing IGF-1Eb or IGF-1Ec in vivo or an effective amount of at the IGF-1Eb or IGF-1Ec protein in the early hyperalgesia stage or in patients that have advanced to the hyposensitivity stage. Treatment at the early hyperalgesia stage prevents subsequent hyposensitivity with increases or maintenance of sensory nerve function. IGF-1Eb or IGF-1Ec treatment also increases muscle mass and improves overall mobility, which indicates a treatment-related improvement in motor function. Treatment with IGF-1Eb or IGF-1Ec at the hyposensitivity stage reverses hyposensitivity and improves muscle mass and overall health. Systemic IGF-1 provides a therapeutic modality for treating hyposensitivity associated with DPN. In addition, IGF-1Eb or IGF-1Ec provides a therapeutic modality for treating diabetic nephropathy. IGF-1Eb or IGF-1Ec improves renal function as evidenced by a modulation in serum albumin concentration and a reduction in urine volume and protein levels. IGF-1Eb or IGF-1Ec also reduces diabetic glomerulosclerosis.08-26-2010
20100216713NOVEL COMPOSITIONS AND METHODS IN CANCER ASSOCIATED WITH ALTERED EXPRESSION OF PRLR - The present invention relates to novel sequences for use in diagnosis and treatment of carcinomas, especially breast cancers. In addition, the present invention describes the use of novel compositions for use in screening methods. The invention provides compositions and methods associated with altered expression of PRLR in cancer.08-26-2010
20100216701Protein Kinase C Inhibitors for Prevention of Insulin Resistance and Type 2 Diabetes - The present invention provides peptides and peptide analogs capable of inhibiting the activity of protein kinase C. The invention discloses use of such peptides and analogs for preparation of pharmaceutical compositions and methods for prevention, delay, suppression or treatment of type 2 diabetes using such compositions.08-26-2010
20100216719Soluble Fiber Combinations for Weight Control and Improving Parameters of Cardiovascular Health - A food or pharmaceutical agent is provided for treating or offsetting the risks of a disease or disorder such as a cardiovascular disease, a hypercholesterolemia disorder, a low serum high density lipid (HDL)/low density lipid (LDL) ratio, a hypertriglyceridemia disorder, and diabetes includes a pharmaceutical carrier, and a composition including a purified glucomannan and at least one galactomannan. A method for treating or offsetting the risks of such a disease or disorder includes the step of administering to a human in need thereof an effective amount of the pharmaceutical composition to treat the cardiovascular disease.08-26-2010
20100184684ANTIBACTERIAL AND ANTIFUNGAL PEPTIDES - This invention provides novel antimicrobial peptides and formulations thereof. The peptides and/or formulations are effective to kill or to inhibit the growth and/or proliferation of various bacteria, yeast, and fungi.07-22-2010
20080318850Glycopegylated Factor Ix - The present invention provides conjugates between Factor IX and PEG moieties. The conjugates are linked via an intact glycosyl linking group interposed between and covalently attached to the peptide and the modifying group. The conjugates are formed from glycosylated peptides by the action of a glycosyltransferase. The glycosyltransferase ligates a modified sugar moiety onto a glycosyl residue on the peptide. Also provided are methods for preparing the conjugates, methods for treating various disease conditions with the conjugates, and pharmaceutical formulations including the conjugates.12-25-2008
20100227805Molecules and Methods of Using Same for Treating CCR5/CCR5 Ligands Associated Diseases - Soluble molecules are provided. Thus, for example, provided is a soluble molecule which comprises a heterologous amino acid sequence conjugated to a CCR5 amino acid sequence being capable of binding a CCR5 ligand, and wherein the molecule is devoid of an N-terminus domain of CCR5. Also provided are pharmaceutical compositions which comprise the above molecules and methods and uses of same.09-09-2010
20100227806Use Of A Ghrelin Agonist To Improve Catabolic Effects Of Glucocorticoid Treatment - A method and pharmaceutical composition for inhibiting the effect of glucocorticoids, particularly dexamethasone, which suppress growth hormone secretion, by administering ghrelin or a ghrelin analogue, specifically [Aib09-09-2010
20100227816Use of GLP-1 Analogues for the Treatment of Disorders Associated with Dysfunctional Synaptic Transmission - The present invention relates to a peptide analogue of glucagon-like peptide-1 (7-36), which is useful to prophylactically prevent, improve, or reverse the diminished cognitive function associated with these types of disorders, by increasing (or sustaining) the LTP of synaptic transmission. Moreover, sustaining LTP may find utility in the prophylaxis of neurological disease by delaying the onset of impaired cognitive processes, and could serve as a treatment, not only for the diminished cognitive function caused by neurodegeneration, but also for the dysfunctional cognitive processes associated with trauma or age.09-09-2010
20100227823METHODS FOR REGULATING ANGIOGENESIS AND VASCULAR INTEGRITY USING TRK RECEPTOR LIGANDS - The present invention relates to methods of inducing or inhibiting the angiogenic process and promoting vessel growth or stabilization in an organ by modulating the trk receptor pathway. The present invention also relates to a method for treating a pathological disorder in a patient which includes administering a trk receptor ligand or an inhibitor or expression or activity of a trk receptor ligand. The present invention also relates to a method of screening for a modulator of angiogenesis, vessel growth, or vessel stabilization. Another aspect of the present invention is a method of diagnosing or monitoring a pathological disorder in a patient which includes determining the presence or amount of a trk receptor ligand or activation of a trk receptor ligand in a biological sample.09-09-2010
20100227818Recombinant Human Albumin-Human Granulocyte Colony Stimulating Factor For The Prevention Of Neutropenia - Disclosed are compositions and methods for treating, preventing and ameliorating conditions and diseases characterized by a lowered white blood cell count. The methods and compositions described herein include a fusion polypeptide formed from human serum albumin protein (“HSA”) and human granulocyte-colony stimulating factor (“G-CSF”).09-09-2010
20100167999INHIBITION OF THE TUMORIGENIC POTENTIAL OF TUMOR STEM CELLS BY LIF AND BMPS - The present disclosure includes methods and compositions for the treatment or prevention of diseases and disorders characterized by excessive or misregulated cellular proliferations, including methods for the treatment of tumors. The methods involve the use of pharmaceutical compositions comprising at least one agent selected from the group consisting of a LIF preparation, a BMP preparation, a BMPR signalling activator, and a LIFR signalling activator. The disclosure also includes LIF preparations, BMP preparations, BMPR signalling activator, and LIFR signalling activators, and methods for the identification of LIF preparations, BMP preparations, BMPR signalling activator, and LIFR signalling activators. The disclosure also includes pharmaceutical compositions comprising at least one agent selected from the group consisting of a LIF preparation, a BMP preparation, a BMPR signalling activator, and a LIFR signalling activator.07-01-2010
20100160233ANTITUMOUR COMBINATIONS CONTAINING A VEGF INHIBITING AGENT AND IRINOTECAN - Disclosed are antitumor combinations of VEGF inhibitors with Irinotecan and the use thereof in the treatment of neoplastic diseases.06-24-2010
20100152112QUINOLINE DERIVATIVES AS P13 KINASE INHIBITORS - Invented is a method of inhibiting the activity/function of PI3 kinases using quinoline derivatives. Also invented is a method of treating one or more disease states selected from: autoimmune disorders, inflammatory diseases, cardiovascular diseases, neurodegenerative diseases, allergy, asthma, pancreatitis, multiorgan failure, kidney diseases, platelet aggregation, cancer, sperm motility, transplantation rejection, graft rejection and lung injuries by the administration of quinoline derivatives.06-17-2010
20100240585IN VIVO CELL SURFACE ENGINEERING - The present invention provides methods and compositions for the in vivo engineering of cell surfaces, such as tumor cell surfaces, with one or more immune co-stimulatory polypeptides. The methods, compositions and engineered cells are useful, for example, to stimulate an immune response against the cells. When the engineered cell surfaces are tumor cell surfaces, the methods, compositions and engineered cells are useful for improving a patient's immune response against the cancer and for reducing tumor size and inhibiting tumor growth.09-23-2010
20100216705HUMAN GROWTH HORMONE FORMULATIONS - Formulations containing complexed human growth hormone crystals are described. Also described are needleless injection systems for crystalline proteins.08-26-2010
20100216715FGF21 Derivatives With Albumin Binder A-B-C-D-E- And Their Use - The present invention relates to Fibroblast Growth Factor 21 (FGF21), more in particular to derivatives of FGF21 compounds having an albumin binder of the formula A-B-C-D-E- covalently attached. The invention also relates to novel FGF21 analogues, as well as to the pharmaceutical use of these FGF21 derivatives and analogues, in particular for the treatment of diabetes, dyslipidemia, obesity, cardiovascular diseases, metabolic syndrome, and/or Non Alcoholic Fatty Liver Disease (NAFLD). The derivatives of the invention are protracted, e.g. capable of maintaining a low blood glucose level for a longer period of time, capable of increasing the in vivo half-life of FGF21, and/or result in a lower clearance of FGF21. The derivatives of the invention are preferably furthermore of an improved oxidative stability.08-26-2010
20100216717Hypoallergenic Mutant Polypeptides Based on Fish Parvalbumin - The present invention relates to non-naturally occurring polypeptides derived from fish allergens such as parvalbumin Cyp c 1.01 from carp. The polypeptides display reduced allergenic activity and are useful as allergy vaccines for treatment of sensitized allergic patients and for prophylactic vaccination.08-26-2010
20100216707COSMETIC USE OF APOLIPOPROTEIN D TYPE PROTEINS - The subject of the present invention is the use, in particular the cosmetic and/or therapeutic use, of the apolipoprotein D, of polypeptides derived from this protein or of analogues thereof, of a nucleic sequence encoding such a polypeptide or of an agent modulating the activity or of the expression of such a polypeptide, in particular for stimulating terminal epithelial differentiation. The invention also relates to the use of the protein apolipoprotein D, of polypeptides derived from this protein or of analogues thereof, or of a nucleic sequence encoding such a polypeptide as a marker for evaluating the state of the epidermis.08-26-2010
20100216716Cell-Permeable Peptide Inhibitors Of The JNK Signal Transduction Pathway - The invention provides cell-permeable peptides that bind to JNK proteins and inhibit JNK-mediated effects in JNK-expressing cells.08-26-2010
20100216706Ghrelin Protects Substantia Nigra Dopamine Neurons - A method of treating neurodegeneration of substantia nigra pars compacta (SNpc) dopamine neurons and compositions therefor are provided.08-26-2010
20100216702VEGF ANALOGS AND METHODS OF USE - Modified VEGF proteins that inhibit VEGF-mediated activation or proliferation of endothelial cells are disclosed. The analogs may be used to inhibit VEGF-mediated activation of endothelial cells in angiogenesis-associated diseases such as cancer, inflammatory diseases, eye diseases, and skin disorders.08-26-2010
20100216711Protease-Stable, Cell Wall-Lysing Enzymes - The present invention relates to a modified polypeptide with a biological activity to lyse cell walls of bacteria, wherein the polypeptide has no caspase, clostripain, enterokinase, factor Xa, granzyme B, 08-26-2010
20100216718Cancer Classification and Methods of Use - The present invention relates to methods of classifying cancer cells based on the presence, absence or level of a tyrosine kinase or a phosphorylated tyrosine kinase. The present invention also relates to methods of treating cancer using cancer classification. The present invention further relates to methods of determining the effectiveness of a treatment for cancer using cancer classification.08-26-2010
20100216714NATRIURETIC COMPOUNDS, CONJUGATES, AND USES THEREOF - Modified natriuretic compounds and conjugates thereof are disclosed in the present invention. In particular, conjugated forms of hBNP are provided that include at least one modifying moiety attached thereto. The modified natriuretic compound conjugates retain activity for stimulating cGMP production, binding to NPR-A receptor, and in some embodiments an improved half-life in circulation as compared to unmodified counterpart natriuretic compounds. Oral, parenteral, enteral, subcutaneous, pulmonary, and intravenous forms of the compounds and conjugates may be prepared as treatments and/or therapies for heart conditions particularly congestive heart failure. Modifying moieties comprising oligomeric structures having a variety of lengths and configurations are also disclosed. Analogs of the natriuretic compound are also disclosed, having an amino acid sequence that is other than the native sequence.08-26-2010
20100234296FOOD MATERIAL FOR INHIBITING OSTEOCLASTOGENESIS - Disclosed is an osteoclastogenesis inhibitory agent which comprises a milk protein fraction having the following properties (1) to (4) and the agent is excellent in an osteoclastogenesis inhibitory effect and useful for preventing or treating bone diseases: 09-16-2010
20100227802Methods and materials relating to PAQR polypeptides and polynucleotides - The invention provides novel polynucleotides and polypeptides encoded by such polynucleotides and mutants or variants thereof that correspond to PAQR polypeptides. Other aspects of the invention include vectors containing processes for producing novel human PAQR polypeptides, and antibodies specific for such polypeptides.09-09-2010
20100227812METHOD OF SUPPLEMENTING THE DIET AND AMELIORATING OXIDATIVE STRESS - A method of supplementing a diet and ameliorating oxidative stress in a mammal includes administering a pharmaceutically effective amount of an active compound having the chemical structure:09-09-2010
20100227808HUMAN KUNITZ-TYPE INHIBITOR WITH ENHANCED ANTIFIBRINOLYTIC ACTIVITY - A human Kunitz-type inhibitor polypeptide with enhanced antifibrinolytic activity, methods of making, and methods of use. The novel polypeptide is structurally similar to the KD1 domain of human tissue factor pathway inhibitor-2 (TFPI-2).09-09-2010
20100227810METHOD FOR DIAGNOSING STAPHYLOCOCCAL INFECTIONS - The present invention relates to a method for determining if an individual is infected by a 09-09-2010
20100227807Use of Gelsolin to Diagnose and Treat Inflammatory Desease (Stossel) - The invention relates to the use of gelsolin to treat inflammatory diseases (e.g., rheumatoid arthritis) and to the use of gelsolin to diagnose, monitor, and evaluate therapies of inflammatory diseases (e.g., rheumatoid arthritis).09-09-2010
20100227822TARGETED DELIVERY OF BOTULINUM TOXIN TO THE SPHENOPALATINE GANGLION - Botulinum toxin, among other presynaptic neurotoxins is used for the treatment and prevention of migraine and other headaches associated with vascular disorders. Presynaptic neurotoxins are delivered focally, targeting the sphenopalatine ganglion. Exemplary delivery is carried out by way of injection.09-09-2010
20100227821MONITORING AND MODULATING HGF/HGFR ACTIVITY - Provided are methods and compositions for the modulation of hepatocyte growth factor activity to regulate lymphatic vessel development and function. Methods and composition for the monitoring and treatment of skin disorders, lymphedema, and metastatic cancers are disclosed. Also described are methods of identifying inhibitors of hepatocyte growth factor dependent lymphangiogenesis.09-09-2010
20100227819Serum-Free Cell Culture Medium for Mammalian Cells - The invention relates to a process for the manufacturing of a protein in mammalian cells cultured in a serum-free medium.09-09-2010
20100227815SITE-SPECIFIC PEGYLATED LINEAR SALMON CALCITONIN ANALOGUES - The present invention relates to site-specific PEGylated linear salmon calcitonin analogues, or pharmaceutically acceptable salts thereof, process for their preparation, pharmaceutical compositions comprising them, and their use for the preparation of a medicament for the treatment or prevention of diseases associated with bone metabolism, e.g., osteoporosis.09-09-2010
20100216703Inhibitors of PDE4 and Methods of Use - The inventors have succeeded in discovering that the p75 neurotrophin receptor (p75NTR) is directly involved in the degradation of cAMP via interaction of its intracellular domain with phosphodiesterase 4A4/5 (PDE4A4/5). Provided herein are methods and compositions for the treatment of conditions of PDE4A4/5 and p75NTR expression (such as pulmonary disease and nerve regeneration) by blocking the interaction of PDE4A4/5 and p75NTR, as well as methods for the screening of agents useful in such applications.08-26-2010
20100227813A METHOD OF USING INTERFERON-LIKE POTEIN ZCYTO20 (IL-28A) OR ZCYTO22(IL-28B) TO TREAT HEPATITIS B - The present invention relates to polynucleotide and polypeptide molecules for zcyto20, zcyto21, zcyto22, zycto24, and zcyto25 proteins which are most closely related to interferon-α at the amino acid sequence level. The receptor for this protein family is a class II cytokine receptor. The present invention includes methods of reducing viral infections and increasing monocyte counts. The present invention also includes antibodies to the zcyto20 polypeptides, and methods of producing the polynucleotides and polypeptides.09-09-2010
20100227820Effect of Porcine Sheath Proteins on the Regeneration Activity of Periodontal Ligament - The purpose of this study was to identify the periodontal regeneration factors in enamel protein shown to induce cementum- and osteo-promotive activities in vivo. The cementum regeneration (CR), a part of periodontal regeneration, was examined by using experimental cavities prepared in a buccal dehiscence dog model. The CR activity was found in the aggregate consisted of sheath proteins along with a small amount of amelogenins separated from newly formed secretory enamel. The sheath proteins were purified to be homogeneous, and examined for the alkaline phosphatase (ALP) inducing activity of human periodontal ligament (HPDL) cells. Application of 17 kDa sheath protein induced ALP activity in HPDL cells. Peptides synthesized from the sheath protein sequence also showed ALP inducing activity. The 17 kDa sheath protein has cell differentiation activity.09-09-2010
20100227803Polypeptides having antimicrobial activity and polynucleotides encoding same - The present invention relates to isolated polypeptides having antimicrobial activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.09-09-2010
20100227817METABOLIC AND CARDIOPROTECTION BY THE MYOKINE FOLLISTATIN-LIKE 1 POLYPEPTIDE - Described herein are methods and compositions related to the discovery that the Follistatin-like 1 protein (Fstl-1) has metabolic and cardioprotective effects in vivo. Fstl-1 and portions and derivatives or variants thereof can be used to treat or prevent metabolic diseases or disorders and to treat or prevent cardiac damage caused by interrupted cardiac muscle blood supply.09-09-2010
20100222272Pharmaceutical Compositions for the Treatment of TNF-Alpha Related Disorders - The invention relates to a pharmaceutical composition comprising a variant TNF-α protein that inhibits the activity of soluble TNF-α while substantially maintaining the activity of transmembrane TNF-α, a buffer, and a tonicity agent, wherein said composition has a pH from approximately 5.0 to 8.0.09-02-2010
20100216704NOVEL GENES AND PROTEINS THAT HOME TO DEVELOPING MICROVESSELS - Described herein are polypeptides that home to developing microvasculature, (also referred to as developing microvessels), such as newly developing microvasculature in mammals, particularly in humans, and to DNA that encodes such polypeptides. These polypeptides are referred to herein as developing microvasculature homing polypeptides. In a specific embodiment, the homing peptides are collateral vessel endothelia (CVE) homing polypeptides, which have been shown to home to collateral vessel endothelia after ischemia.08-26-2010
20100240590PEPTIDES AND RELATED MOLECULES THAT BIND TO TALL-1 - The present invention concerns therapeutic agents that modulate the activity of TALL-1. In accordance with the present invention, modulators of TALL-1 may comprise an amino acid sequence Dz09-23-2010
20100240586PEG MODIFIED EXENDIN OR EXENDIN ANALOG AND COMPOSITIONS AND USE THEREOF - Exendins or exendin analogs modified by one or more PEG derivatives that may be linked to one or more amino acids of the exendins or exendin analogs are provided. The PEG derivatives may have branched structure set forth in any one of formulas I-IV. Compositions including the PEG derivative modified exendin or exendin analog, methods of making or administering the modified exendin or exendin analog, and various uses thereof are also provided.09-23-2010
20100240583SOLUBLE PROTEIN AND UTILIZATION OF THE SAME - The present invention relates to a method for screening a medicine using a protein, and a compound obtained by the screening method.09-23-2010
20100240588COMPOUND FOR USE IN THE TREATMENT OF PERIPHERAL NEUROPATHIES - The present invention relates to a compound of the following formula (I):09-23-2010
20100144624PROCESS FOR THE PREPARATION OF COMPOSITIONS OF AT1 RECEPTOR ANTAGONIST AND ANGIOTENSIN-(1-7) - We describe preparation of compounds of an AT1 receptor antagonist(s) and Angiotensin (1-7), for example, Angiotensin-(1-7) losartanate and analogues thereof, and/or mixtures of these systems, pharmaceutical compositions thereof and use of their derivative products. Cyclodextrins and derivatives thereof may be used for the micro-encapsulation of compounds, for example, Angiotensin (1-7) losartanate, liposomes and biodegradable polymers and/or mixtures of these systems and/or derivative products for the obtainment of nano- or microparticles as controlled or sustained release devices of Ang-(1-7) losartanate and analogues and/or mixtures thereof. The compounds may be used as agents for treating or preventing hypertension, cardiovascular diseases, heart hypertrophy, heart failure, coronary diseases, such as angina pectoris, endothelial disorder or endothelial lesions, as a consequence, for example, of atherosclerosis processes or in association with diabetes mellitus. They may also be used in the study and therapy of cardiovascular, renal, reproductive, dermatological, neoplastic, blood and cerebral diseases, and when formulated in controlled release systems, encapsulated or not in cyclodextrins, for use in stent, with a view to modulate the growth of the neointima after catheterization procedures.06-10-2010
20100222264USE OF RGD-ENRICHED GELATINE-LIKE PROTEINS FOR INHIBITION OF CANCER METASTASIS - The invention concerns a cell support comprising an RGD-enriched gelatine that has a more even distribution of RGD sequences than occurring in a natural gelatine and with a minimum level of RGD sequences. More precise the percentage of RGD sequences related to the total number of amino acids is at least 0.4 and if the RGD-enriched gelatine comprises 350 amino acids or more, each stretch of 350 amino acids contains at least one RGD motif. Preferably the RGD-enriched gelatines arc prepared by recombinant technology, and have a sequence that is derived from a human gelatine or collagen amino acid sequence. The invention also relates to RGD-enriched gelatines that are used for attachment to integrins. In particular The RGD-enriched gelatines of the invention are suitable for coating a cell culture support for growing anchor-dependant cell types. Further, the RGD-enriched gelatines of the invention may find use in medical applications, in particular as a coating on implant or transplant material or as a component of drug delivery systems.09-02-2010
20100210521Compositions and methods for modulating ampa receptor-mediated excitotoxicity - The present invention provides AMPAR excitotoxicity mediating polypeptides comprising the GluR2 NT1-3-2 (Y142-K172) amino acid sequence (SEQ ID NO:1) or the GAPDH(2-2-1-1) (I221-E250) amino acid sequence (SEQ ID NO:2). Also disclosed are nucleotide sequences encoding the polypeptides, methods of inhibiting GAPDH association with the GluR2 subunit or p53. Methods of inhibiting AMPA receptor mediated excitotoxicity using the polypeptides and nucleic acids are also disclosed.08-19-2010
20100210548Novel Bacillus Thuringiensis Crystal Polypeptides, Polynucleotides, and Compositions Thereof - The present invention provides insecticidal polypeptides related to 08-19-2010
20100210552HUMAN GLUCAGON-LIKE PEPTIDE-1 MIMICS AND THEIR USE IN THE TREATMENT OF DIABETES AND RELATED CONDITIONS - The present invention provides novel human glucagon-like peptide-1 (GLP-1) peptide mimics that mimic the biological activity of the native GLP-1 peptide and thus are useful for the treatment or prevention of diseases or disorders associated with GLP activity. Further, the present invention provides novel, chemically modified peptides that not only stimulate insulin secretion in type II diabetics, but also produce other beneficial insulinotropic responses. These synthetic peptide GLP-1 mimics exhibit increased stability to proteolytic cleavage making them ideal therapeutic candidates for oral or parenteral administration.08-19-2010
20100210549Novel Bacillus Thuringiensis Crystal Polypetides, Polynucleotides, and Compositions Thereof - The present invention provides insecticidal polypeptides related to 08-19-2010
20100210532USE OF NEUROPEPTIDE SF, ALONE OR IN COMBINATION WITH GLP-2, AS A THERAPEUTIC AGENT - The present invention is directed to the use of the peptide compound Ser-Gln-Ala-Phe-Leu-Phe-Gln-Pro-Gln-Arg-Phe-NH2 as a therapeutic agent for the prophylaxis and/or treatment of cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurodegenerative diseases, infectious diseases, lung diseases, heart and vascular diseases and metabolic diseases. Moreover the present invention relates to pharmaceutical compositions preferably in form of a lyophilisate or liquide buffer solution or artificial mother milk formulation or mother milk substitute containing the peptide Ser-Gln-Ala-Phe-Leu-Phe-Gln-Pro-Gln-Arg-Phe-NH2 optionally together with at least one pharmaceutically acceptable carrier, cryoprotectant, lyoprotectant, excipient and/or diluent.08-19-2010
20100210528Compositions, methods and uses for inhibition and/or treatment of influenza infection - Embodiments of the present invention illustrate methods and compositions for treating medical disorders. In certain embodiments, compositions and methods relate to reducing or inhibiting a the onset or development of a viral disorder.08-19-2010
20100210522METHOD FOR DETERMINING PRESENCE OF CANCER IN A SAMPLE BY ASSAYING FOR EXPRESSION OF DPPA-2 NUCLEOTIDE SEQUENCES - The invention relates to the discovery of known molecule “ESCA/DPPA-2” and a so-called “cancer-testis antigen.” ESCA/DPPA-2 is also a possible cancer stem cell marker. One can determine presence of cancer by assaying for the molecule, and also prevent or treat cancer via administration of the molecule.08-19-2010
20100144628HEPATOPOIETIN AND USE THEREOF - Provided are a hepatopoietin PCn (HPPCn) and its homologous proteins, which can promote hepatocyte proliferation in vitro, promote liver regeneration in vivo, inhibit the growth of tumor cells and promote the apoptosis of tumor cells. The hepatopoietin PCn (HPPCn) and its homologous proteins are useful for the treatment of acute and chronic liver injury, or the treatment of liver fibrosis.06-10-2010
20100144615NUCLEOTIDE SEQUENCE ENCODING A MODULATOR OF NF-KB - The present invention relates to nucleotide sequences encoding a modulator of NF-κB, and to the polypeptides encoded by the nucleotide sequences. In particular, the invention relates to nucleotide sequences and the polypeptides encoded thereby, wherein the polypeptides are involved in the response to NF-κB-activating stimuli, including HTLV-1 Tax, LPS, PMA and IL-1. The invention also relates to antibodies to the modulator of NF-κB, methods of detecting modulator of NF-κB using the antibodies, methods of treatment associated with NF-κB activation and to methods of identifying compounds which modulate the activity of the modulator of NF-κB.06-10-2010
20090093405Non-Natural Amino Acid Polypeptides Having Modified Immunogenicity - Non-naturally encoded amino acid polypeptides with modulated immunogenicity and uses thereof are provided.04-09-2009
20090054336Binding Agent - Agents which bind to cell surface receptors; methods to manufacture such agents; therapeutic compositions comprising such agents; and screening methods to identify novel agents.02-26-2009
20090042799CLOSTRIDIAL TOXIN DERIVATIVES AND METHODS FOR TREATING PAIN - Agents for treating pain, methods for producing the agents and methods for treating pain by administration to a patient of a therapeutically effective amount of the agent. The agent can include a clostridial neurotoxin, or a component or fragment or derivative thereof, attached to a targeting moiety, wherein the targeting moiety is selected from a group consisting of transmission compounds which can be released from neurons upon the transmission of pain signals by the neurons, and compounds substantially similar to the transmission compounds.02-12-2009
20090042798T CELL RECEPTORS AND RELATED MATERIALS AND METHODS OF USE - The invention provids an isolated or purified T cell receptor (TCR) having antigenic specificity for a cancer antigen, e.g., a renal cell carcinoma antigen, wherein the TCR recognizes the cancer antigen in a major histocompatibility complex (MHC)-independent manner. Also provided are related polypeptides, proteins, nucleic acids, recombinant expression vectors, isolated host cells, populations of cells, antibodies, or antigen binding portions thereof, and pharmaceutical compositions. The invention further provides a method of detecting the presence of cancer in a host and a method of treating or preventing cancer in a host using the inventive TCRs or related materials.02-12-2009
20090042797GAMMA-HEREGULIN - A novel member of the heregulin superfamily has been identified which is designated “γ-HRG”. This molecule, secreted by human breast cancer MDA-MB-175 cells, leads to the formation of a constitutive active receptor complex and stimulates the growth of these cells in an autocrine manner. γ-HRG polypeptide and nucleic acid are disclosed, together with various uses therefor (e.g. use of γ-HRG nucleic acid for the recombinant production of γ-HRG). γ-HRG antagonists (e.g. neutralizing antibodies and antisense nucleic acid molecules) as well as uses therefor are also described.02-12-2009
20090042795Cardiac stem cell proliferation proteins, fragments thereof and methods of modulating stem cell proliferation and differentiation - The present invention provide cardiac stem cell proliferation proteins and fragments thereof that promote proliferation and/or differentiation of cardiac stem cells. Also provided are methods of treating subjects with heart disease or defects, the methods comprising administering a cardiac stem cell proliferation protein or a fragment thereof to the subject in need of such treatment.02-12-2009
20090042789Method for Improving Symptom of Mood Disorder - The present invention relates to a method for improving symptom of mood disorder or its related disorder comprising a step of allowing activated-type Gm1 protein and the like to be excessively present in a brain of a mammal, and a non-human mammal, to which the method has been applied, and the like.02-12-2009
20090042776Fungal immunomodulatory protein (fip) prepared by microorganisms and uses thereof - The invention relates to an improved nucleic acid molecule encoding fungal immunomodulatory protein (FIP) that is better expressed in fungi, to vectors comprising the nucleic acid molecule, to hosts transformed with said vectors, to processes of expressing the protein of the invention in said transformed hosts, to the protein of the invention produced by said processes, to uses of said hosts comprising the protein of the invention and to a process of purifying FIP. The protein of the invention has wide immunomodulatory activity. Thus, the present invention further relates to uses of the protein of the invention in cosmetic or pharmaceutical compositions and to food or feed additives comprising the protein of the invention. Finally, the invention relates to the method of modulating immunological activities by orally administering FIP or proteins fused with FIP to a subject.02-12-2009
20090042775Defensin Proteins - This invention relates to novel proteins, termed INSP 108 and INSP 109, herein identified as members of the defensin family of proteins and to the use of these proteins and nucleic acid sequences from the encoding genes in the diagnosis, prevention and treatment of disease.02-12-2009
20090163412Compositions and Methods of Topical Application and Transdermal Delivery of Botulinum Toxins with Reduced Non-Toxin Proteins - This invention relates to novel compositions of 06-25-2009
20100144635METHODS AND COMPOSITIONS TO TREAT MYOCARDIAL CONDITIONS - Methods, devices, kits and compositions to treat a myocardial infarction. In one embodiment, the method includes the prevention of remodeling of the infarct zone of the ventricle. In other embodiments, the method includes the introduction of structurally reinforcing agents. In other embodiments, agents are introduced into a ventricle to increase compliance of the ventricle. In an alternative embodiment, the prevention of remodeling includes the prevention of thinning of the ventricular infarct zone. In another embodiment, the prevention of remodeling and thinning of the infarct zone involves the cross-linking of collagen and prevention of collagen slipping. In other embodiments, the structurally reinforcing agent may be accompanied by other therapeutic agents. These agents may include but are not limited to pro-fibroblastic and angiogenic agents.06-10-2010
20100144640MOLECULES DESIGNATED B7L-1 - The invention is directed to B7L-1 as a purified and isolated protein, the DNA encoding the B7L-1, host cells transfected with cDNAs encoding B7L-1 and processes for preparing B7L-1 polypeptides.06-10-2010
20100144633CHLOROPLAST EXPRESSION OF MEMBRANE PROTEINS - Disclosed herein are chloroplast transformation vectors constructed to enable expression and hyperaccumulation of membrane proteins in chloroplasts. Another embodiment relates to plants transformed with such vectors. Another embodiment relates to seeds and other plant tissues transformed with such vectors. Another embodiment relates to a method of increasing expression of membrane proteins in chloroplasts including transforming a plant cell with vectors described herein.06-10-2010
20100144629METHOD TO TREAT INFLAMMATION - The present invention relates generally to the fields of pharmacology, and particularly to a method for treating inflammation, particularly inflammation of the respiratory system. The invention provides a method to reduce or ameliorate inflammation, by administering an effective amount of a protein factor originally isolated from thymic tissue, and referred to as T4 immune stimulating factor (TISF).06-10-2010
20100144617Oxyntomodulin Derivatives - Modified oxyntomodulin derivatives. Such derivatives can be used for the treatment of metabolic diseases such as diabetes and obesity.06-10-2010
20100222261PEPTIDIC ANTAGONISTS OF CLASS III SEMAPHORINS/NEUROPILINS COMPLEXES - The present invention concern a peptidic antagonist of class III semaphorins/neuropilins complexes comprising an amino acid sequence, which is derived from the transmembrane domain of a protein selected in the group consisting of neuropilin-1, neuropilin-2, plexin-A1, plexin-A2, plexin-A3, plexin-A4, Nr-CAM, L1-CAM, integrin Beta 1 and integrin beta 2, and including at least a GxxxG motif, eventually fused to an heterologous sequence; a nucleic acid encoding for said peptidic antagonist, a pharmaceutical composition comprising such a peptidic antagonist or a nucleic acid encoding thereof and uses thereof.09-02-2010
20100222279COMPOSITION FOR ANIMAL CONSUMPTION AND METHOD FOR REDUCING MAP KINASE ACTIVITY - This invention is directed generally to compositions (including foods nutritional supplements, treats, and toys) for animal consumption, particularly compositions that comprise omega-3 and omega-6 polyunsaturated fatty acids, and particularly compositions that tend to aid in reducing mitogen-activated-protein (“MAP”) kinase activity in animals. This invention also is directed generally to methods for using such compositions, particularly to methods for using such compositions to reduce MAP kinase activity in animals, and particularly to methods for using such compositions to treat a cancer or tissue hyperplasia. This invention is further directed generally to processes for making such compositions.09-02-2010
20090075894Novel Bacillus Thuringiensis Gene with Coleopteran Activity - The invention provides nucleic acids, and variants and fragments thereof, obtained from strains of 03-19-2009
20090075893Inhibition of Angiogenesis by Neutrophil Alpha-Defensins - The present invention relates to the inhibition of angiogenesis by neutrophil alpha-defensins. Further, the present invention relates to methods involving the inhibition of endothelial cell adhesion to the extracellular matrix, endothelial cell apoptosis, and endothelial cell angiogenesis mediated by alpha-defensins.03-19-2009
20090075891Methods and dressings for sealing internal injuries - Disclosed are solid and frozen haemostatic materials and dressings consisting essentially of a fibrinogen component and a fibrinogen activator. Also disclosed are methods of treating internal wounded tissue in a mammal by applying one or more of these haemostatic materials and dressings.03-19-2009
20090075888Cardiovascular and Brain Cell Therapy Using Intracellular Ryanodine Receptor Modulation by the Estrogen Receptor Beta - The present invention includes compositions and methods for screening for a candidate substance with ryanodine receptor (RyR)-modulatory activity, the method including: determining the ion-conducting ability and ability to change the concentration of the free cytoplasmic intracellular Ca03-19-2009
20090075887Treatment with Kallikrein Inhibitors - Methods, kits and compositions are disclosed that include a non-naturally occurring kallikrein inhibitor and optionally a viscosupplement for the treatment of joint pathology.03-19-2009
20090075886Dendritic cell stimulatory factor - Flt3-ligand can be used to generate large numbers of dendritic cells from hematopoietic progenitor and stem cells. Flt3-ligand can be used to augment immune responses in vivo, and expand dendritic cells ex vivo. Such dendritic cells can then be used to present tumor, viral or other antigens to naive T cells, can be useful as vaccine adjuvants.03-19-2009
20090075884HUMAN IL-17F AND OTHER IL-17F-RELATED PROTEINS AND METHODS RELATED THERETO - Polynucleotides encoding human CTLA-8 and related proteins are disclosed. Human CTLA-8 proteins and methods for their production are also disclosed. Methods of treatment using human CTLA-8 proteins, rat CTLA-8 proteins and herpesvirus herpes CTLA-8 proteins are also provided.03-19-2009
20090075885ANTITUMOR EFFECT OF MUTANT BIK - The present invention regards mutant forms of Bik that comprise anti-cell proliferation and/or pro-apoptotic activities. In particular embodiments, the Bik polypeptides comprise a substitution at Thr33 and Ser35 and, in some embodiments, phosphorylation at these sites is inhibited. In more particular embodiments, these forms are useful for cancer therapy, particularly when administered in combination with liposomes. In embodiments wherein a mutant Bik polynucleotide is administered for cancer therapy, the polynucleotide may be regulated in a tissue-specific manner.03-19-2009
20090075881FIBRIN GEL FOR CONTROLLED RELEASE OF PDGF AND USES THEREOF - The present invention relates, in general, to fibrin sealants, which contain platelet derived growth factor (PDGF) for controlled release in situ for therapeutic applications, including musculoskeletal disorders, soft tissue disorders and vascular diseases.03-19-2009
20090075882RECEPTOR-MEDIATED UPTAKE OF AN EXTRACELLULAR BCL-XL FUSION PROTEIN INHIBITS APOPTOSIS - Apoptosis-modifying fusion polypeptides, and the corresponding nucleic acid molecules, are disclosed. Pharmaceutical compositions comprising these polypeptides, and the use of these polypeptides to modify apoptosis, are also provided.03-19-2009
20090075876Altered insulin-like growth factor binding proteins - Altered IGFBPs are able to bind IGF, but the release is inhibited by resistance to protease cleavage and/or reduced binding to extracellular matrix (ECM). Alterations have been made in IGFBP-2 to the linker domain in particular and to two amino acid motifs found to be important for ECM binding. IGF-1 mediated proliferation of cancer cells have been inhibited by use of the altered IGFBPs.03-19-2009
20090075875PROTECTION AGAINST LUNG FIBROSIS BY UP-REGULATING THE FUNCTION OR EXPRESSION OF CAVEOLIN-1 - Disclosed are compositions and methods for the treatment of fibrosis. Also disclosed are methods of screening for agents that treat fibrosis.03-19-2009
20090075878Methods for Generating and Screening Fusion Protein Libraries and Uses Thereof - The invention provides methods for generating fusion protein libraries, such as immunotoxin libraries. The invention also relates to libraries of recombinant cells encoding nucleic acid sequences comprising fusion proteins. In addition, the invention relates to the libraries themselves and the use of the libraries to screen for fusion proteins that are specific for target cells, such as cancer cells. Further, the invention relates to methods of improving fusion proteins and to the improved fusion proteins.03-19-2009
20090075877Methods and materials relating to stem cell growth factor-like polypeptides and polynucleotides - The invention provides novel polynucleotides and polypeptides encoded by such polynucleotides and mutants or versants thereof that correspond to a novel human secreted stem cell growth factor-like polypeptides. Other aspects of the invention include vectors containing processes for producing novel human secreted stem cell growth factor-like polypeptides, and antibodies specific for such polypeptides.03-19-2009
20090075874Methods for construction and screening of libraries of chemokine variants - The present invention provides a method for the design and/or the selection of agonist or antagonist chemokine variants combining a phage display technology and a screening on living cells expressing the receptor of the corresponding native chemokine. It also provides RANTES variants having agonist properties towards said receptor, and methods for preventing and/or curing viral diseases, as well as clues for preventing and/or curing inflammatory or malignant diseases.03-19-2009
20090075873Gastrin compositions and formulations, and methods of use and preparation - The present invention concerns six novel variants of alternative splicing of the CD40 receptor.03-19-2009
20100113360PARATHYROID HORMONE RECEPTOR ACTIVATION AND STEM AND PROGENITOR CELL EXPANSION - The invention relates to methods for manipulating hematopoietic stem or progenitor cells, mesenchymal stem cells, epithelial stem cells, neural stem cells and related products through activation of the PTH/PTHrP receptor in neighboring cells.05-06-2010
20090075872METHODS AND MEANS - This invention relates to methods and means for the stimulation of phagocytosis and in particular to the phagocytosis of apoptotic cells, and discloses a role for the protein product of the apoE gene (apolipoproteinE) as a regular of apoptotic cell clearance. ApoE mimetics and other compounds which stimulate the clearance of apoptotic cells may be useful in the treatment of a range of disorders. One aspect of the invention provides a method of identifying and/or obtaining a compound for the treatment of a condition associated with decreased endogenous apoE activity in an individual comprising: determining the ingestion of apoptic cells by a macrophage in the presence of a test compound. An increase in apoptic cell ingestion in the presence relative to the absence of test compound may be indicative that the compound may be useful in the treatment of a condition associated with decreased endogenous apoE activity.03-19-2009
20090075871Modified Thioredoxin - The present invention relates to a human modified thioredoxin composed of any of the following polypeptides: (a) a polypeptide modified by alteration or chemical modification of a cysteine residue at position 35 with another amino acid in an amino acid sequence of SEQ ID NO:2; and (b) a polypeptide having an amino acid sequence having one or more substituted, deleted, inserted or added amino acids in positions except for positions 32 and 35, preferably positions 32 to 35 in the amino acid sequence of SEQ ID NO:2, and having an apoptosis-inducing activity. 03-19-2009
20100210541Biomarkers for Appetite Regulation - The invention provides compositions and methods for characterizing appetite regulation in a subject. In one embodiment, the composition comprises a solid support comprising probes for measuring a biomarker panel comprising, for example, total ghrelin, obestatin, cholecystokinin, GLP-1(6-37)-NH08-19-2010
20100210544PEPTIDES AND PHARMACEUCAL COMPOSITIONS FOR TREATING CONNECTIVE TISSUE - Provided is a pharmaceutical composition for sequestering cells in connective tissue. The composition includes a biocompatible scaffolding to which one or more peptides or proteins are linked. The peptides or proteins have an amino acid sequence that is a subsequence of human ficolin and are capable of binding the cells to be sequestered. The pharmaceutical composition can be used in the treatment of connective tissue, and can be used as a dermal filler.08-19-2010
20100210531AGENTS WITH ANGIOGENIC AND WOUND HEALING ACTIVITY - The invention relates to the use of angiogenic crystallin proteins to promote angiogenesis, wound healing and/or endothelial cell migration. Alpha A crystallin and βB2 crystallin have particular application in these methods. The crystallins will usually be in monomeric form. Typically, truncated form(s) of βB2 crystallin protein are utilized as can be prepared by partial hydrolysis of the protein by a protease enzyme such as elastase I. Methods for the purification of crystallin proteins from eye tissue are also described.08-19-2010
20100210523MODULATION OF ACTIVITY OF PRONEUROTROPHINS - The present invention provides agents for inhibiting binding of a pro-neurotrophin to a Vps10p-domain receptor, in particular the binding of a pro-NGF or a pro-BDNF to a Sortilin receptor. The invention thus provides agents for the manufacture of a medicament, for treating and/or preventing disease or disorders such as but not limited to neurological, neuropsychiatric and ocular diseases, disorders, and degeneration as well as obesity, diabetes, pain and/or nociception in an individual.08-19-2010
20100210527PRO- AND ANTI-ANGIOGENIC TREATMENTS - The invention provides a method of selectively pro-oranti-angiogenic treatment of a mammalian subject, comprising site-specific control of alternative splicing during processing of VEGF pre-mRNA transcribed from the C terminal exon 8 of the VEGF gene using controlling agents for the splicing, wherein one or more controlling agent which favours proximal splice site (PSS) splicing in said processing is used in the pro-angiogenic treatment and one or more controlling agent which favours distal splice site (DSS) splicing in said processing is used in the anti-angiogenic treatment.08-19-2010
20100210536USE OF LEPTIN (22-56 ) AS A THERAPEUTIC AGENT - The present invention is directed to the use of the peptide compound Val-Pro-Ile-Gln-Lys-Val-Gln-Asp-Asp-Thr-Lys-Thr-Leu-Ile-Lys-Thr-Ile-Val-Thr-Arg-Ile-Asn-Asp-Ile-Ser-His-Thr-Gln-Ser-Val-Ser-Ser-Lys-Gln-Lys-OH as a therapeutic agent for the prophylaxis and/or treatment of cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurodegenerative diseases, infectious diseases, lung diseases, heart and vascular diseases and metabolic diseases. Moreover the present invention relates to pharmaceutical compositions preferably in form of a lyophilisate or liquid buffer solution or artificial mother milk formulation or mother milk substitute containing the peptide Val-Pro-Ile-Gln-Lys-Val-Gln-Asp-Asp-Thr-Lys-Thr-Leu-Ile-Lys-Thr-Ile-Val-Thr-Arg-Ile-Asn-Asp-Ile-Ser-His-Thr-Gln-Ser-Val-Ser-Ser-Lys-Gln-Lys-OH optionally together with at least one pharmaceutically acceptable carrier, cryoprotectant, lyoprotectant, excipient and/or diluent.08-19-2010
20100210543Aldehyde-Tagged Protein-Based Drug Carriers and Methods of Use - The disclosure provides aldehyde-tagged protein carriers that can be covalently and site-specifically bound to drug to provide a drug-containing scaffold. The invention also encompasses methods of production of such drug-containing scaffolds and intermediates, as well as methods of use.08-19-2010
20100210535THERAPEUTIC USE OF NEUROPEPTIDE EI AND ACTH 7-38 AND COMPOSITIONS THEREOF - The present invention is directed to the use of the peptide compound Glu-Ile-Gly-Asp-Glu-Glu-Asn-Ser-Ala-Lys-Phe-Pro-Ile-NH08-19-2010
20100210530EXTRACELLULAR MATRIX COMPOSITIONS - The present invention is directed to a method of producing compositions including embryonic proteins. The method includes culturing cells under hypoxic conditions on a biocompatible three-dimensional surface in vitro. The culturing method produces both soluble and non-soluble fractions, which may be used separately or in combination to obtain physiologically acceptable compositions useful in a variety of medical and therapeutic applications.08-19-2010
20100210533USE OF UROCORTIN AND CORTICOTROPIN-RELEASING FACTOR AS THERAPEUTIC AGENTS - The present invention is directed to the use of the peptide compound Asp-Asn-Pro-Ser-Leu-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Thr-Leu-Leu-Glu-Leu-Ala-Arg-Thr-Gln-Ser-Gln-Arg-Glu-Arg-Ala-Glu-Gln-Asn-Arg-Ile- Ile-Phe-Asp-Ser-Val-NH08-19-2010
20100210537USE OF A DEFENSIN PEPTIDE AS A THERAPEUTIC AGENT - The present invention is directed to the use of the peptide compound Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys-OH as a therapeutic agent for the prophylaxis and/or treatment of cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurodegenerative diseases, infectious diseases, lung diseases, heart and vascular diseases and metabolic diseases. Moreover the present invention relates to pharmaceutical compositions preferably in form of a lyophilisate or liquide buffer solution or artificial mother milk formulation or mother milk substitute containing the peptide Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-AIa-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys-OH optionally together with at least one pharmaceutically acceptable carrier, cryoprotectant, lyoprotectant, excipient and/or diluent.08-19-2010
20100210524NOVEL ESTROGEN RECEPTOR LIGANDS - The invention provides a compound of formula (I) or a pharmaceutically acceptable ester, amide, solvate or salt thereof, including a salt of such an ester or amide, and a solvate of such an ester, amide or salt, wherein W, X, Y, Z, R08-19-2010
20100210546COMBINATION CHEMOTHERAPY WITH CHLOROTOXIN - This invention includes compositions and methods for combination chemotherapy, particularly involving at least one chemotherapeutic agent used in combination with chlorotoxin or a derivative thereof.08-19-2010
20100210525COMBINED PREPARATION OF A THIAZIDE DIURETIC AND A LOOP DIURETIC - The specific molecular basis of the interaction between talin and integrin β08-19-2010
20100210520REGULATION OF FUNCTION OF ANGIOPOIETIN - Pharmaceutical compositions that comprise a pharmaceutically acceptable carrier and either a therapeutically effective amount of an ECM-binding fragment of Ang-1 protein that comprises SEQ ID NO:1 and/or SEQ ID NO:2 or a homologous peptide thereof and pharmaceutical compositions that comprise a pharmaceutically acceptable carrier and a vector comprising a nucleic acid molecule that comprises the nucleotide sequence that encodes an ECM-binding fragment of Ang-1 protein that comprises SEQ ID NO:1 and/or SEQ ID NO:2 or a homologous peptide thereof are disclosed. Methods of using such compositions to treat individuals suspected of having coronary artery disease, vascular disease or a condition involving ischemia and to promote angiogenesis, endothelial survival and maintaining vascular integrity are disclosed. Methods to identify compounds that modulates binding of Ang-1 to ECM are disclosed. Pharmaceutical compositions which comprise a therapeutically effective amount of Ang-2 protein and/or a vector comprising a nucleic acid molecule that comprises the nucleotide coding sequence of Ang-2 and methods of using such compositions to treat individuals suspected of having cancer are disclosed.08-19-2010
20090291892SlpA as a tool for recombinant protein and enzyme technology - Disclosed are a recombinant DNA molecule encoding a fusion protein comprising a SlpA chaperone and a target polypeptide wherein human FK506 binding proteins (FKBPs) are excluded as target polypeptides, a corresponding expression vector encoding said fusion protein as well as host cells transformed with said expression vector. Also disclosed are a method for producing the fusion protein, a recombinantly produced fusion protein comprising a SlpA chaperone and a target polypeptide. A further aspect of the invention is the use of the recombinantly produced fusion protein, and a reagent kit containing a recombinantly produced fusion protein comprising a SlpA chaperone and a target polypeptide.11-26-2009
20100222258TNF antagonist and TNF inhibitor containing it as an effective ingredient - The present invention has an object to provide a tumor necrosis factor mutant protein, particularly, a tumor necrosis factor mutant protein specific to TNF-R1 or TNF-R2; tumor necrosis factor inhibitor; or tumor necrosis factor preparation containing it as an effective ingredient, and the object is solved by providing a tumor necrosis factor mutant protein where one or more amino acid residues selected from the group consisting of 29th, 31st, 32nd, 145th, 146th and 147th, or the group consisting of 84th to 89th from the N-terminal of the amino acid sequence of SEQ ID NO:1 is/are replaced with other amino acid residue(s); a tumor necrosis factor inhibitor; and a tumor necrosis factor preparation containing it as an effective ingredient.09-02-2010
20100222278USE OF LEPTIN FOR THE PREVENTION OF EXCESS BODY WEIGHT AND COMPOSITION CONTAINING LEPTIN - The invention relates to the use of leptin in the preparation of an ingestible composition for children from nursing infants to adolescents, comprising leptin at a concentration greater than 50 ng/kg for the prevention of excess weight and/or the complications associated therewith. The invention comprises the use of a fully- or partially-hydrolyzed recombinant leptin. Said ingestible composition is a supplement for developmental nutrition, contains between 0.1 and 30 micrograms/liter leptin, provides a daily dose of leptin of more than 25 ng and can take the form of a solid, i.e. a tablet, capsule or reconstitutable powder, or a liquid, i.e. a syrup or drink.09-02-2010
20100222263ATAP PEPTIDES, NUCLEIC ACIDS ENCODING THE SAME AND ASSOCIATED METHODS OF USE - Disclosed herein are nucleic acid sequences that encode pro-apoptotic polypeptides. Also disclosed are polypeptides encoded by these nucleic acid sequences, and antibodies, which immunospecifically-bind to the polypeptide, as well as derivatives, variants, mutants, or fragments of the aforementioned polypeptide, polynucleotide, or antibody. The invention further discloses therapeutic, diagnostic and research methods for diagnosis, treatment, and prevention of proliferative disorders and bacterial infections using the nucleic acids and proteins of the invention.09-02-2010
20100222266A METHOD OF USING INTERFERON-LIKE PROTEIN ZCYTO21(IL-29) TO TREAT HEPATITIS B - The present invention relates to polynucleotide and polypeptide molecules for Zcyto21, an interferon-like protein, which is most closely related to interferon-a at the amino acid sequence level. The present invention also includes antibodies to the Zcyto21 polypeptides, and methods of using the polynucleotides and polypeptides.09-02-2010
20100222273MODIFIED CRY35 PROTEINS - This invention provides modified, insecticidal Cry35 proteins with enhanced properties as compared to wild-type Cry35 proteins. The modifications to these proteins were based in part on analysis of the atomic coordinates and three-dimensional (3D) structure of the ˜45 kDa 149B1 protein and other proteins in the Cry35 class. The subject invention also includes polynucleotides that encode these modified proteins, and transgenic plants that produce these modified proteins. This invention further provides methods of controlling plant pests, including rootworms, with these modified proteins. The modified proteins of the subject invention include chimeric toxins involving exchanged segments, domains, and motifs as discussed herein. The subject invention also provides methods of modifying Cry35 proteins.09-02-2010
20100113353Method and composition for inhibiting cardiovascular cell proliferation - Cardiovascular cell proliferation in a blood vessel subjected to trauma, such as angioplasty, vascular graft, anastomosis, or organ transplant, can be inhibited by contacting the vessel with a polymer consisting of from 6 to about 30 amino acid subunits, where at least 50% of the subunits are arginine, and the polymer contains at least six contiguous arginine subunits. Exemplary polymers for this purpose include arginine homopolymers 7 to 15 subunits in length.05-06-2010
20100099624CROSS-LINKED COLLAGEN AND USES THEREOF - The present invention discloses collagen cross-linked in a micro to non-fibrillar form and at a high concentration. The cross-linked collagen gel has improved volume stability or persistence than collagen cross-linked at a neutral pH. Also disclosed are methods for preparing the inventive cross-linked collagen and using such for augmenting soft tissues in mammals.04-22-2010
20090286722Analogs of Gastric Inhibitory Polypeptide as a Treatment for Age Related Decreased Pancreatic Beta Cell Function - Peptide analogues and methods are provided for treating age-related symptoms of decreased pancreatic beta-cell function, including glucose intolerance, type 2 diabetes, beta-cell glucose insensitivity, insulin resistance and reduced insulin secretion.11-19-2009
20100197576Polypeptides or fusion proteins thereof inhibiting transmigration of leucocytes or growth and/or metastasis of cancer cells - The present invention provides a polypeptide or its fusion protein derived from a paired immunoglobulin-like receptor α or β (PILRα or PILRβ), one of the transmembrane proteins, which inhibits the transmigration of leukocytes or the growth and/or metastasis of cancer cells. The present invention also provides a polynucleotide encoding the polypeptide or its fusion protein, a vector including the polynucleotide, and a transformant transformed with the vector. The present invention also provides a pharmaceutical composition for the prevention or treatment of inflammatory diseases including the polypeptide or a fusion protein thereof. The present invention also provides a pharmaceutical composition for inhibiting the growth and/or metastasis of cancer cells including the polypeptide or a fusion protein thereof.08-05-2010
20100222277Regulation of Food Preference Using GLP-1 Agonists - GLP-1 agonists selectively decrease the amount of food intake, wherein the food has a high glycemic index or wherein the amount of mono- and di-saccharides together constitute a large proportion of the total amount of carbohydrates.09-02-2010
20100222271Formulation to Improve Gastrointestinal Function - The subject invention provides compositions, and uses thereof, that improve gastrointestinal function. The compositions and methods of the subject invention are particularly advantageous for use with neonates because they can be used to stimulate development of the immature intestine in order to provide an enhanced ability to absorb nutrients and attain a stronger barrier function.09-02-2010
20100222274GLYCOSYLATION-DEFICIENT HEPATOCYTE GROWTH FACTOR - The invention provides a modified glycosylation-deficient HGF and a production method thereof. The glycosylation-deficient HGF is produced by introducing amino acid mutation(s) so that no glycosylation take place at at least one glycosylation site of hepatocyte growth factor.09-02-2010
20100222270HETEROCYCLIC COMPOUNDS AS CRTH2 RECEPTOR ANTAGONISTS - This application relates to a compound of Formula ! (or a pharmaceutically acceptable salt thereof) as defined herein, pharmaceutical compositions thereof, and its use as an antagonist of receptor CRTH2, as well as a process for its preparation and intermediates therefor.09-02-2010
20090281023Mixtures Of Calcitonin Drug-Oligomer Conjugates And Methods Of Use In Pain Treatment - A mixture of conjugates in which each conjugate in the mixture comprises a calcitonin drug coupled to an oligomer that includes a polyalkylene glycol moiety is disclosed. The mixture may lower serum calcium levels in a subject by 10, 15 or even 20 percent or more. Moreover, the mixture may be more effective at surviving an in vitro model of intestinal digestion than non-conjugated calcitonin. Furthermore, the mixture may exhibit a higher bioavailability than non-conjugated calcitonin. The compositions of this invention are useful in the treatment of various bone disorders and pain. 11-12-2009
20100062980THERAPEUTIC USES OF BETA-ANTAGONISTS - Polypeptides derived from 03-11-2010
20100048476NOVEL USE OF BACTERIOCIN DERIVED FROM ENTEROCOCCUS FAECALIS SL-5 - The present invention relates to novel use of bacteriocin derived from 02-25-2010
20100197595TREATMENT OF MELANOMA WITH ALPHA THYMOSIN PEPTIDES - A method of treating melanoma or a metastasis thereof in a human patient by administering a melanoma-treating effective amount of an alpha thymosin peptide to a human melanoma patient, wherein the human melanoma patient does not have a substantially elevated LDH blood level.08-05-2010
201001975904-AMINO-7,8-DIHYDROPYRIDO[4,3-d]PYRIMIDIN-5(6H)-ONE DERIVATIVES - The invention provides compounds of Formula (Ia)08-05-2010
20100197597Coagulation Factor VII Polypeptides - The present invention relates to novel coagulation Factor VII polypeptides, polynucleotide constructs encoding such polypeptides, as well as vectors and host cells comprising and expressing the polynucleotide, pharmaceutical compositions, uses and methods of treatment.08-05-2010
20100197587USE OF A PEPTIDE AS A THERAPEUTIC AGENT - The present invention is directed to the use of the peptide compound His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg-OH as a therapeutic agent for the prophylaxis and/or treatment of cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurodegenerative diseases, infectious diseases, lung diseases, heart and vascular diseases and metabolic diseases. Moreover the present invention relates to pharmaceutical compositions preferably in form of a lyophilisate or liquide buffer solution or artificial mother milk formulation or mother milk substitute containing the peptide His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg-OH optionally together with at least one pharmaceutically acceptable carrier, cryoprotectant, lyoprotectant, excipient and/or diluent.08-05-2010
201001975914-AMINO-7,8-DIHYDROPYRIDO[4,3-d]PYRIMIDIN-5(6H)-ONE DERIVATIVES - The invention provides compounds of the general Formula (I)08-05-2010
20100197577NITRIC OXIDE SYNTHASE ACTIVATOR - The object is to find a nitric oxide synthase activator, a method for the administration of the activator, and the amount of the activator to be administered. Disclosed is a nitric oxide synthase activator comprising a midkine family protein or a midkine derivative as an active ingredient. Specifically disclosed is a nitric oxide synthase activator which is intended to be administered through the blood, a coronary artery or a vein and which comprises a midkine family protein or a midkine derivative as an active ingredient.08-05-2010
20100197583Glycosaminoglycan-antagonising MCP-1 Mutants and Methods of Using Same - Novel mutants of human monocyte chemoattractant protein 1 (MCP-1) with increased glycosaminoglycan (GAG) binding affinity and knocked-out or reduced GPCR activity compared to wild type MCP-1, and their use for therapeutic treatment of inflammatory diseases.08-05-2010
20100197575SOLUBLE INTERLEUKIN-20 RECEPTOR - A soluble receptor to IL-20 having two polypeptide subunits, IL-20RA (formerly called ZcytoR7) and IL-20RB (formerly called DIRS1). The two subunits are preferably linked together. In one embodiment one subunit is fused to the constant region of the light chain of an immunoglobulin, and the other subunit is fused to the constant region of the heavy chain of the immunoglobulin. The light chain and the heavy chain are connected via a disulfide bond.08-05-2010
20100197579Corticotropin Releasing Factor 2 Receptor Agonists - Isolated corticotropin releasing factor derivatives, and nucleic acids encoding the same, are effective for treating corticotropin releasing factor 2 receptor modulated disorders such as muscular dystrophy.08-05-2010
20100197592VARIANT AXMI-R1 DELTA ENDOTOXIN GENES AND METHODS FOR THEIR USE - Compositions and methods for conferring pesticidal activity to bacteria, plants, plant cells, tissues and seeds are provided. Compositions comprising a coding sequence for pesticidal polypeptides are provided. The coding sequences can be used in DNA constructs or expression cassettes for transformation and expression in plants and bacteria. Compositions also comprise transformed bacteria, plants, plant cells, tissues, and seeds. In particular, nucleic acid molecules encoding variant AXMI-R1 sequences are provided. Additionally, amino acid sequences corresponding to the polynucleotides are encompassed.08-05-2010
20100197574AQUARETIC AND NATRIURETIC POLYPEPTIDES LACKING VASODILATORY ACTIVITY - This document provides aquaretic and natriuretic polypeptides. For example, this document provides polypeptides having aquaretic and/or natriuretic activities. In some cases, a polypeptide provided herein can have aquaretic and natriuretic activities, while lacking the ability to lower blood pressure. This document also provides methods and materials for inducing aquaretic and/or natriuretic activities within a mammal.08-05-2010
20100197593Modulators of the ABC Transporter Family and Methods for their Use - An isolated factor derived from the bacterium 08-05-2010
20100197585USE OF A RGD-PEPTIDE AND/OR PARATHYROID HORMONE (1-34) AS ANTI-HIV AGENT - The present invention is directed to the use of the peptide compound Gly-Arg-Gly-Asp-Asn-Pro as a therapeutic agent for the prophylaxis and/or treatment of cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurodegenerative diseases, infectious diseases, lung diseases, heart and vascular diseases and metabolic diseases. Moreover the present invention relates to pharmaceutical compositions preferably in form of a lyophilisate or liquid buffer solution or artificial mother milk formulation or mother milk substitute containing the peptide Gly-Arg-Gly-Asp-Asn-Pro optionally together with at least one pharmaceutically acceptable carrier, cryoprotectant, lyoprotectant, excipient and/or diluent.08-05-2010
20090325867RECEPTOR-SPECIFIC TUMOUR NECROSIS FACTOR-RELATED APOPTOSIS-INDUCING LIGAND (TRAIL) VARIANTS - The invention relates to a tumour necrosis factor- (TNF-) related apoptosis-inducing ligand (TRAIL) which is capable of selectively signalling through death receptor 4 (DR4), comprising Y at position 189. Preferably the TRAIL further comprises 19 IL and/or 199V; preferably also 201R, 213W and 215D, and/or preferably further comprises 193S. The invention also relates to uses of such TRAIL mutants which are capable of selectively signalling through DR4 in the treatment of cancer, and in the manufacture of medicaments for use in treatment of cancer. Preferably the cancer is chronic lymphocytic leukaemia, mantle cell lymphoma or non-Hodgkin's lymphoma. The invention also relates to kits comprising same.12-31-2009
20090253621ARABINOGALACTAN PROTEIN HAVING THE PROPERTY OF ABSORBING FATS AND METHOD FOR OBTAINING THIS ARABINOGALACTAN PROTEIN - The invention relates, firstly, to a method for eliminating ingested dietary fats before they are assimilated by the body, using an AGP extracted from cactus mucilage. Said AGP can be in any galenic or commercial form which is solid or dissolved in water. The invention also discloses the method of extracting this AGP from the mucilage of a cactus of the 10-08-2009
20090018070Fsh Mutants - FSH mutants with increased glycosylation and longer half-lives are described. The use of FSH mutants for inducing folliculogenesis in human patients is also described.01-15-2009
20090221481STIMULATORY AUTO-ANTIBODIES TO THE PDGF RECEPTORS AS PATHOLOGY MARKER AND THERAPEUTIC TARGET - An in vitro method for detecting the presence in a body sample of auto-antibodies for the PDGF receptor suitable for the diagnosis and prognosis of autoimmune diseases, in particular the systemic sclero-is and related diagnostic kits. Use of an inhibitor of ROS and/or Ras-ERK1/2 for the preparation of a medicament for therapeutic treatment of autoimmune diseases or of treating the Graft-Versus-Host-Reaction (GVHR). Pharmaceutical composition comprising an effective amount of an inhibitor of ROS and/or Ras-ERK1/2, and proper diluents, and/or excipients, and/or adjuvants.09-03-2009
20090258825HOPM1 Mediated disease resistance to Pseudomonas syringae in Arabidopsis - The present invention relates to compositions and methods for enhancing plant defenses against pathogens. More particularly, the invention relates to enhancing plant immunity against bacterial pathogens, wherein HopM110-15-2009
20090253624Pharmacologically active antiviral peptides and methods of use - This invention relates to peptides having antiviral properties. The antiviral peptides comprise membrane transiting peptides, and active fragments and derivatives of such peptides. The antiviral peptides exhibit activity against a broad spectrum of viruses, including enveloped and nonenveloped viruses, and are used in pharmaceutical compositions to prevent and/or treat viral infections.10-08-2009
20090209466PEPTIDES WITH ANTI-PROLIFERATIVE ACTIVITY - The present invention relates to peptides with anti-proliferative activity, of sequence SEQ ID No. 1, SEQ ID No. 2 or SEQ ID No. 3.08-20-2009
20090203590METHOD FOR THE INHIBITION OF ANGIOGENESIS - The present invention is based on the discovery that Matrilin-1 has antiangiogenic and anticancer properties. The invention is directed to a method of treating a disease that responds to an inhibition of angiogenesis. Additionally, the invention can be applied to those at risk for developing a disease that responds to an inhibition of angiogenesis. The methods comprise administering to a mammal an effective angiogenesis-inhibiting amount of an Matrilin-1 consisting of Matrilin-1, Matrilin-1 fragment, analog, or derivative that is administered in a composition substantially free of other cartilage proteins.08-13-2009
20090318360Use of the neurotoxic component of a botulinum toxin for treating arthritis - A method and composition for treating a patient suffering from a disease, disorder or condition and associated pain include the administration to the patient of a therapeutically effective amount of a neurotoxin selected from a group consisting of Botulinum toxin types A, B, C, D, E, F and G.12-24-2009
20090318356METHODS AND COMPOSITIONS FOR CONTROL OF FETAL GROWTH VIA MODULATION OF RELAXIN - The invention relates to the method for treatment, diagnosis and prevention of diseases related to fetal growth and placental insufficiency and comprises methods including inhibiting or increasing relaxin synthesis, relaxin receptor synthesis, relaxin binding to the relaxin receptor, and relaxin receptor activity. The invention also relates to screening assays to identify compounds that modulate relaxin and/or relaxin receptor activity. The invention further relates to gene therapy methods utilizing relaxin and relaxin-related sequences for the treatment and prevention of diseases related to fetal growth and placental insufficiency.12-24-2009
20090197802Analogues of GLP-1 - The present invention is directed to peptide analogues of glucagon-like peptide-1, the pharmaceutically-acceptable salts thereof, to methods of using such analogues to treat mammals and to pharmaceutical compositions useful therefor comprising said analogues.08-06-2009
20090149376Pharmaceutical and Therapeutic Applications Relating to a Type 9 Adenylyl Cyclase Polymorphism in Asthma and Reversible Bronchial Obstruction - A pharmaceutical composition comprising an expression product of a Type Nine adenylyl cyclase gene polymorphism, along with a suitable physiological carrier, are provided. In addition, methods related to treating patients having asthma or a reversible bronchial obstruction, kits for determining the responsiveness of an individual to treatment regimens, and assays for screening pharmaceutical for efficacy in treatment are also provided.06-11-2009
20100197582GROWTH HORMONE FUSION PROTEINS - We disclose growth hormone fusion proteins that have increased in vivo stability and activity; nucleic acid molecules encoding said proteins and methods of treatment of growth hormone deficiency that use said proteins.08-05-2010
20090131313LKKTET AND/OR LKKTNT PEPTIDE COMPOSITIONS AND METHODS FOR TREATING OR PREVENTING TISSUE DETERIORATION, INJURY OR DAMAGE - A pharmaceutical, ophthalmic or cosmetic combination or method utilizes a peptide agent include amino acid sequence LKKTET or LKKTNT, a conservative variant thereof, or a stimulating agent that stimulates production of an LKKTET or LKKTNT peptide, or a conservative variant thereof, and further utilizes a quaternary ammonium salt, wherein the agent and the salt can be administered to a subject separately or together.05-21-2009
20090131316GLUCAGON-LIKE PEPTIDE-1 SECRETAGOGUE, GLUCAGON-LIKE PEPTIDE-1 SECRETAGOGUE FOOD OR DRINK, INHIBITOR OF POSTPRANDIAL RISE IN BLOOD GLUCOSE, AND INHIBITORY FOOD OR DRINK OF POSTPRANDIAL RISE IN BLOOD GLUCOSE - The invention relates to a GLP-1 secretagogue and an inhibitor of postprandial rise in blood glucose, containing κ-casein as an active ingredient, and a food or drink for promoting GLP-1 secretion and an inhibitory food or drink of postprandial rise in blood glucose, containing a milk-derived casein protein wherein κ-casein accounts for 60% by mass or more of the milk-derived casein.05-21-2009
20090149382Modulation of lipid rafts - The present invention relates to the use of an antisecretory protein, derivative, homologue, and/or fragment thereof, having equivalent activity, and/or a pharmaceutically active salt thereof, for the manufacture of a pharmaceutical composition and/or a medical food for the treatment and/or prevention of dysfunction, e.g. abnormal function, hypo- or hyper-function of lipid rafts, receptors and/or caveolae. A dysfunction of lipid rafts, receptors and/or caveolae may be caused by or be a cause of a variety of other conditions, which are also encompassed by the present invention, such as vascular, and lung dysfunctions, and/or endocrine disorders, e.g. diabetes and related disorders. Furthermore, the invention relates to a method for the treatment and/or prevention of dysfunction of lipid rafts and/or caveolae in a mammal in need thereof.06-11-2009
20090111748FIBROBLAST GROWTH FACTOR-2 PROMOTES NEUROGENESIS AND NEUROPROTECTION AND PROLONGS SURVIVAL IN HUNTINGTON'S DISEASE - This invention pertains to the discovery that fibroblast growth factor 2 (FGF2) stimulates neurogenesis, induces migration of newborn cells into the striatum and cortex, is neuroprotective, and significantly extends the lifespan mammals suffering from neurodegenerative conditions (e.g., Huntington's disease, Parkinson's disease, etc.). In certain embodiments this invention provides a method of promoting neurogenesis, neuroprotection and/or survival in a mammal having a neurodegenerative disease by upregulating expression or availability of endogenous fibroblast growth factor 2 (FGF2) in said mammal; and/or administering FGF2 or an FGF2 mutein to the mammal in an amount sufficient to promote neurogenesis, neuroprotection and/or survival of the mammal.04-30-2009
20090111751Method of Removing a Non-Metallic Protein Inhibitor From a Liquid Pharmaceutical Preparation - The invention relates to a method for removing a protein inhibitor from a liquid pharmaceutical preparation, said method comprising the steps of: (a) providing a sealed container comprising an initial liquid pharmaceutical preparation comprising (i) a protein belonging to the group of serine proteases/Vitamin K-dependent proteins and (ii) a non-metallic inhibitor for said protein; (b) contacting said pharmaceutical preparation with a solid phase polymeric material capable of retaining at least a substantial portion of said inhibitor; and (c) separating said liquid pharmaceutical preparation from said solid phase polymeric material so as to obtain a resulting liquid pharmaceutical preparation having a reduced concentration of said inhibitor compared to the initial liquid pharmaceutical preparation.04-30-2009
20090111745Plad Domain Peptides With Increased Serum Half Life Due To Conjugation To Domain Antibodies - Drug fusions and conjugates that contain a therapeutic or diagnostic agent that is fused or conjugated to an antigen-binding fragment of an antibody that binds serum albumin. The conjugates and fusion have a longer in vivo half life in comparison with the unconjugated or unfused therapeutic or diagnostic agent.04-30-2009
20080312154ADMINISTRATION OF ADIPOCYTOKINE AND ADIPONECTIN FOR TREATING HEADACHE AND METHODS OF DIAGNOSING HEADACHE BY MEASURING ADIPONECTIN - Methods for treating a headache, such as a migraine, in a subject comprising administering a therapeutically effective amount of an adipocytokine, for example, adiponectin, to the subject are disclosed. Pharmaceutical compositions comprising adipocytokine, for example, adiponectin, are disclosed. Methods of diagnosing the presence or absence of a headache in a subject, such as a migraine, by assessing the level of adiponectin in the subject are disclosed.12-18-2008
20080305998Ligand to GPR8 and DNA thereof - The present invention aims at providing a ligand to GPR8, its DNA, etc., and more particularly, a polypeptide capable of binding to GPR8 or its amides or esters, or salts thereof, as well as its DNA, etc.12-11-2008
20080293638ALBUMIN-FUSED CILIARY NEUROTROPHIC FACTOR - The invention relates to a fusion protein comprising an albumin, or a fragment or a variant or a derivative thereof and at least one biologically active peptide which activates the ciliary neurotrophic factor (CNTF) receptor, or a fragment or variant or a derivative thereof.11-27-2008
20080293636Protein Constructs Designed for Targeting and Lysis of Cells - The invention relates to a protein construct, comprising (i) a targeting moiety that is capable of binding to a target cell, and (ii) an effector immunogenic moiety that is capable of triggering an existing, vaccine-induced or natural, immune response. The protein construct, that is preferably in the form of a heteromultimeric protein, is useful for redirecting an immune response that was pre-existing in a patient, toward an undesired target cell.11-27-2008
20080280831Chimeric proteins with phosphatidylserine binding domains - Chimeric proteins comprising soluble Tissue Factor (sTF) and another subunit (e.g., annexin V) are described. The proteins promote blood clotting and/or inhibit cancer by targeting sTF to specific receptors such as phosphatidylserine (PS) on activated cells. These chimeric proteins are useful in treating patients with excessive bleeding due to inborn problems, drug therapy, trauma or surgery and/or as an anti-cancer therapy, for example by causing blood vessels feeding cancers to become clotted, thereby preventing adequate flow of blood to a tumor, which in turn will lead to tumor inhibition and death or may be used in a therapy to cause clotting within blood vessels that pose a threat in the subject in non-cancerous conditions.11-13-2008
20080280830FUSION PROTEIN COMPRISING FK506 BINDING PROTEIN AND METHOD OF MAKING AND USING THE SAME - Disclosed is a fusion protein containing a FK506 binding protein and a cell-transducing domain. Also, disclosed is a method of making the fusion protein and use of the fusion protein in a pharmaceutical or cosmetic composition. The cell-transducing domain is, for example, a PEP-1.11-13-2008
20100222260Uses of pegylated albumin - The present invention is directed to uses of PEGylated albumins which include methods of treating reduced functional capillary density, reduced blood volume, septic shock and cardiac arrhythmia in a subject, which comprise administering to the subject a therapeutically effective amount of a PEGylated albumin.09-02-2010
20100222268ANTIBIOTIC PEPTIDES - This invention concerns novel antibiotic peptide and peptide derivates, especially for use in medicine. Further, the invention relates to compositions and methods for killing microbes, like bacteria or fungus, and methods to treat microbial infections. The invention further relates to a method for drug screening analysis. The peptides and peptide derivates have the general formula Sub09-02-2010
20100222267RECOMBINANT TRANSFERRIN MUTANTS - The present invention provides a recombinant protein comprising the sequence of a transferrin mutant, wherein Ser415 is mutated to an amino acid which does not allow glycosylation at Asn413 and/or wherein Thr613 is mutated to an amino acid which does not allow glycosylation as Asn611. It also provides polynucleotides encoding the same and methods of making and using said recombinant protein.09-02-2010
20090111752Stable Formulation of Modified GLP-1 - Pharmaceutical formulations of GLP-1 compounds and methods for preparation thereof.04-30-2009
20090111744Human Growth Gene and Short Stature Gene Region - Subject of the present invention is an isolated human nucleic acid molecule encoding polypeptides containing a homeobox domain of sixty amino acids having the amino acid sequence of SEQ ID NO: 1 and having regulating activity on human growth. Three novel genes residing within the about 500 kb short stature critical region on the X and Y chromosome were identified. At least one of these genes is responsible for the short stature phenotype. The cDNA corresponding to this gene may be used in diagnostic tools, and to further characterize the molecular basis for the short stature-phenotype. In addition, the identification of the gene product of the gene provides new means and methods for the development of superior therapies for short stature.04-30-2009
20090111747Anti-Diabetic or Anti-Hypertensive Dietary Supplement - An anti-diabetic or anti-hypertensive fish protein hydrolysate is provided, in which the fish is of the genus 04-30-2009
20090111746MODULATING TOLL-LIKE RECEPTOR ACTIVITY - This description provides methods and materials related to modulating Toll-like receptor activity. For example, methods and materials for increasing or decreasing the responsiveness of a TLR4 polypeptide are provided.04-30-2009
20090105138METHODS FOR TREATING IMMUNE MEDIATED NEUROLOGICAL DISEASES - Polypeptides and other compounds that can bind specifically to the C04-23-2009
20090054323Specific Binding Agents of Human Angiopoietin-2 - Disclosed are peptides that bind to Ang-2. Also disclosed are peptibodies comprising the peptides, methods of making such peptides and peptibodies, and methods of treatment using such peptides and peptibodies.02-26-2009
20080221028Compositions and Methods for Treating Atherosclerosis - Peptides and mimetics of selected domains of mammalian serum amyloid A isoform 2.1 (SAA2.1) and compounds and compositions thereof are provided that enhance the effect on macrophage cholesterol ester hydrolase activity and/or inhibit acyl CoA:cholesterol acyl transferase activity. Methods of using these compositions in the treatment and/or prevention of atherosclerosis as well as coronary heart disease and cardiovascular disease are also provided.09-11-2008
20090082276SELECTIVE VPAC2 RECEPTOR PEPTIDE AGONISTS - The present invention encompasses peptides that selectively activate the VPAC2 receptor and are useful in the treatment of diabetes.03-26-2009
20090069240METHOD OF PREVENTING AND TREATING ENDOCRINE SYSTEM DISTURBANCES - The inventive medicinal agent for preventing and treating endocrine system disturbances appears as a powder prepared from ossified reindeer horns and contains 120 IU/g of luteinizing hormone, and 54 IU/g of follicle-stimulating hormone, 2,1 IU/g of prolactin, 203 pg/g of adrenocorticotropic hormone, 2,2 ng of somatotropic hormone, thyroidal hormones including 54 fmol/g of free thyroxin, 8 fmp/g of free triiodothyronine, 4,.5 μU/g of thyreotropic hormone, and 25 pmol/g of cortisol.03-12-2009
20090069239Use of Iridoptin to Induce Toxicity in Insects - Improved methods and compounds to control insects, involving a biological control method to induce toxicity in targeted insects using iridoptin. The present invention induces high levels of apoptosis and inhibition of host protein synthesis in insect cells. It is the first viral toxin against non-lepidopteran insects and is distinct from existing bacterial toxins, such as 03-12-2009
20090069238ACTIVATABLE CLOSTRIDIAL TOXINS - Compositions comprising activatable recombinant neurotoxins and polypeptides derived therefrom. The invention also comprises nucleic acids encoding such polypeptides, and methods of making such polypeptides and nucleic acids.03-12-2009
20090069229PLANT-MADE WEST NILE VIRUS (WNV) VACCINES, VECTORS AND PLANT CODON OPTIMIZED SEQUENCES - The subject application provides various compositions of matter directed to West Nile virus (WNV) polypeptides and fragments thereof and polynucleotides, vectors and transformed host cells that encode, direct the expression of, or produce WNV polypeptides as set forth herein. Methods of using the polypeptides and polynucleotides for the production of immune responses in individuals or detecting the presence of WNV specific or neutralizing antibodies are also provided herein.03-12-2009
20090069226Transmucosal delivery of peptides and proteins - Provided are methods and compositions for enhancing the transmucosal absorption of bioactive peptides and proteins. More particularly, the invention provides compositions for enhancing the transmucosal absorption of bioactive peptides and proteins, such as exendin-4, PYY, PYY3-36, and GLP-1 and their analogs and derivatives, wherein the compositions comprise an absorption enhancing mixture of a cationic polyamino acid, at least one additional absorption enhancing agent, and a buffer that is compatible with the polyamino acid. Also provided are methods for enhancing the transmucosal absorption and bioavailability of bioactive peptides and proteins using such compositions.03-12-2009
20090069227Use of HMGB1 to promote stem cell migration and/or proliferation - It is described a method to promote stem cell migration and/or proliferation in cell culture or in vivo comprising the step of exposing such cells to an effective amount of the HMGB1 protein or its active fragment. 03-12-2009
20090286734Pharmaceutical Use of Alpha Antigen or Alpha Antigen Gene - The α antigen-encoding gene and the α antigen protein suppress the production of interleukin-4 etc., improve the Th2 type cytokine-dominant state, and furthermore inhibit various conditions of allergic diseases such as IgE production, histamine release and eosinophil infiltration, and therefore they are very effective for the prevention or treatment of atopic diseases such as atopic dermatitis, asthma, allergic rhinitis, and allergic conjunctivitis, and more broadly allergic diseases.11-19-2009
20090036379INHIBITORS OF PROTEINS FROM THE RHO-GEF FAMILY - A method for screening peptides with an aptamer library for determining inhibitors of any one of the proteins from the Rho-GEFs family.02-05-2009
20090036381TREATMENT OF DIABETES - Compositions and methods are provided for islet neogenesis therapy comprising a member of a group of factors that complement a gastrin/CCK receptor ligand, with formulations, devices and methods for sustained release delivery and for local delivery to target organs.02-05-2009
20090036377AXMI-028 AND AXMI-029, A FAMILY OF NOVEL DELTA-ENDOTOXIN GENES AND METHODS FOR THEIR USE - Compositions and methods for conferring pesticidal activity to bacteria, plants, plant cells, tissues and seeds are provided. Compositions comprising a coding sequence for a delta-endotoxin polypeptide are provided. The coding sequences can be used in DNA constructs or expression cassettes for transformation and expression in plants and bacteria. Compositions also comprise transformed bacteria, plants, plant cells, tissues, and seeds. In particular, isolated delta-endotoxin nucleic acid molecules are provided. Additionally, amino acid sequences corresponding to the polynucleotides are encompassed. In particular, the present invention provides for isolated nucleic acid molecules comprising nucleotide sequences encoding the amino acid sequence shown in SEQ ID NO:2, 4, 15, 17, or 19, or the nucleotide sequence set forth in SEQ ID NO:1, 3, 14, 16, or 18, as well as variants and fragments thereof.02-05-2009
20090036374HEPATOCYTE GROWTH FACTOR RECEPTOR SPLICE VARIANTS AND METHODS OF USING SAME - Novel polypeptides that are splice variants of c-Met, the receptor for hepatocyte growth factor and polynucleotides encoding same are provided. Methods and pharmaceutical compositions which can be used to treat various disorders such as cancer, immunological-related, blood-related and skin-related disorders using the polypeptides and polynucleotides of the present invention, are also provided.02-05-2009
20090036373Compositions useful for and methods of modulating angiogenesis - Compositions and methods for treating subjects with disorders characterized by aberrant vascular endothelial cell growth are provided. The compositions comprise agents that are combinations of a Wnt pathway stimulator component and a Tie2 pathway repressor component. Particularly useful Wnt pathway stimulators include, but are not limited to, Wnt7b-like molecules. Particularly useful Tie2 pathway repressor components include, but are not limited to, Ang2-like molecules. The methods allow for modulation of vascular endothelial cells, vascular endothelial cell vessels, capillary bed development, and angiogenesis.02-05-2009
20090036370Leukocyte Adhesion Inhibitor-1 (LAI-1) - There are disclosed therapeutic compositions and methods using isolated nucleic acid molecules encoding a human chemokine beta-11 (Ck beta-11) polypeptide and a human leukocyte adhesion inhibitor-1 (LAI-1) polypeptide (previously termed chemokine α1 (CKα1 or cka-1), as well as Ck beta-11 and/or LAI-1 polypeptides themselves, as are vectors, host cells and recombinant methods for producing the same.02-05-2009
20090036367Novel peptides of the respiratory syncytial virus (RSV) G protein and their use in a vaccine - The present invention relates to the Respiratory Syncytial Virus, and more particularly to the identification of novel antigens which are useful in particular for the therapeutic and prophylactic treatment of conditions caused by this virus. The present invention relates to methods of generating and/or increasing an immunogenic response directed against Respiratory Syncytial Virus, including subgroups A and B.02-05-2009
20090036363Peptides as cell penetrating carriers - Compounds of formula (I) or their pharmaceutically or biologically acceptable salts are useful as cell penetrating carriers. According to formula (I), below, Val is L-Val or D-Val; Arg is L-Arg, D-Arg or L-(N-methyl)Arg; Pro is L-Pro or D-Pro; Leu is L-Leu or D-Leu; x is an integer from 1 to 20, preferably 3; L02-05-2009
20090036365INHIBITORS OF HUMAN PLASMIN DERIVED FROM THE KUNITZ DOMAINS - This invention provides: novel proteins, which are homologous to the first Kunitz domain (K1) of lipoprotein-associated coagulation inhibitor (LACI), and which are capable of inhibiting plasmin; uses of such novel proteins in therapeutic, diagnostic, and clinical methods; and polynucleotides that encode such novel proteins.02-05-2009
20100227804GEL-FORMING COMPOSITION FOR MEDICAL USE, ADMINISTRATION DEVICE FOR THE COMPOSITION, AND DRUG RELEASE CONTROLLING CARRIER - It is an object of the present invention to provide a gel-forming composition which permits on-site administration and can form a gel exhibiting prescribed strength and sustained drug release, devices for the administration thereof, and a kit for medical use. A gel-forming composition which is composed of the first composition comprising a drug, a first gelling agent represented by the general formula (I) and the like, and the first diluent and the second composition comprising the second gelling agent represented by the general formula (I) and the like and the second diluent; and application devices and kits for medical use, which can hold the gel-forming composition. X09-09-2010
20100197589MODIFIED GROWTH HORMONE POLYPEPTIDES - We describe modified growth hormone fusion proteins and dimers comprising said fusion proteins; nucleic acid molecules encoding said proteins and methods of treatment that use said proteins in the treatment of conditions that result from growth hormone excess.08-05-2010
20090011987Use of Glp-2 for the Treatment of Ischemia-Reperfusion Injury - The present invention relates, inter alia, to the use of GLP-2 compounds in the treatment of ischemia-reperfusion injury in a subject.01-08-2009
20090011992Human Coagulation Factor VII Polypeptides - The present invention relates to novel human coagulation Factor VIIa variants having coagulant activity as well as polynucleotide constructs encoding such variants, vectors and host cells comprising and expressing the polynucleotide, pharmaceutical compositions, uses and methods of treatment.01-08-2009
20100179092HUMAN COMPLEMENT C3 DERIVATIVES WITH COBRA VENOM FACTOR-LIKE FUNCTION - The invention provides modified human complement C3 proteins, comprising a human C3 protein, wherein amino acid residues in the human C3 protein are substituted with a corresponding portion of a Cobra Venom Factor (CVF) protein, and wherein one or more amino acid residues in the CVF portion of the modified human complement C3 protein are further modified.07-15-2010
20100160219Novel Polypeptides Inducing Dendritic Cell Migration, as Well as Medicines and Pharmaceutical Compositions Containing Same - The invention concerns a polypeptide corresponding to amino acids 26 to 75 of the sequence of GRA5-RH protein of SEQ ID No 1: MASVKRVWAVMIVNVLALIFVGVAGSTRDVGSGGDDSEGARGRE QQQVQQHEQNEDRSLFERGRAAVT-GHPVRTAVGLAAAWAWSLL RLLKRRRRRAIQEESKESATAEEEEVAEEE, its variants acting on dendritic cell migration, homologues acting on dendritic cell migration, and fragments thereof acting on dendritic cell migration, as well as the pharmaceutical compositions thereof comprising such polypeptides and their use for making a medicine for preventing or treating skin and mucous membrane conditions involving dendritic cells or Langerhans cells.06-24-2010
20090143286Methods and Compositions for Regenerating Articular Cartilage - Methods and compositions are described to regenerate cartilage in a partial thickness defect or area of reduced volume of articular cartilage comprising an infiltration suppressor agent and a columnar growth promoting agent.06-04-2009
20100016234SIGNAL PEPTIDES, NUCLEIC ACID MOLECULES AND METHODS FOR TREATMENT OF CARIES - Compounds that competitively inhibit binding of CSP to 01-21-2010
20100029564NOVEL PROCESS OF SOLUBILIZING PROTEIN FROM A PROTEINACEOUS MATERIAL AND COMPOSITIONS THEREOF - The process for solubilizing proteinaceous material of the present invention includes subjecting the proteinaceous material to a sufficient amount of a basic solution to obtain a supernatant that has a basic pH and exposing the supernatant to the basic solution for a sufficient length of time and temperature for hydrolysis to occur. The process also includes cooling the mixture of the supernatant and proteinaceous material and optionally acidifying the mixture. This process may also include recovering the solubilized protein from the supernatant for use in various applications. Also provided herein is a composition of solubilized proteins from eggshell membrane obtained using processes of the present invention.02-04-2010
20100029563DERIVATIVES OF GROWTH HORMONE AND RELATED PROTEINS, AND METHODS OF USE THEREOF - The growth hormone supergene family comprises greater than 20 structurally related cytokines and growth factors. A general method is provided for creating site-specific, biologically active conjugates of these proteins. The method involves adding cysteine residues to non-essential regions of the proteins or substituting cysteine residues for non-essential amino acids in the proteins using site-directed mutagenesis and then covalently coupling a cysteine-reactive polymer or other type of cysteine-reactive moiety to the proteins via the added cysteine residue. Disclosed herein are preferred sites for adding cysteine residues or introducing cysteine substitutions into the proteins, and the proteins and protein derivatives produced thereby. Also disclosed are therapeutic methods for using the cysteine variants of the invention.02-04-2010
20090286726USE OF THE LONG PENTRAXIN PTX3 FOR THE PREVENTION OR TREATMENT OF VIRAL DISEASES - It is described the use of the long pentraxin PTX3 (PTX3) or one of its functional derivatives, for the preparation of a medicament for the prevention or treatment of viral diseases and/or for inhibiting virus activation.11-19-2009
20090221490Endothelin Receptors In Morphine Withdrawal - The present invention relates to compositions and methods for managing opioid tolerance and reducing opioid withdrawal. More specifically, the present invention provides for endothelin, endothelin receptors, and endothelin receptor antagonists and agonists as a means for managing G-protein activity in the context of opioid tolerance and withdrawal.09-03-2009
20100227811FARNESYLAMINE DERIVATIVES AND METHODS OF USE - The present invention concerns farnesylamine derivatives, compositions containing these compounds, and methods of using these compounds and compositions as inhibitors of ras-mediated signal transduction and inhibitors of aberrant cell growth, e.g., as anti-cancer agents, as well as anti-fungal agents. Other non-malignant diseases characterized by proliferation of cells that may be treated using the farneylamine derivatives of the include, but are not limited to, cirrhosis of the liver; graft rejection; restenosis; and disorders characterized by a proliferation of T cells such as autoimmune diseases, e.g., type 1 diabetes, lupus and multiple sclerosis.09-09-2010
20100222259Compositions for enhancing the production of PPAR and/or PPAR-associated factors - The present inventors focused on certain nutritional compositions known to have activity of controlling blood glucose levels. These foods were administered to rats for long periods, and real-time PCR was used to analyze the expression of genes associated with lipid metabolism in the liver and adipose tissues. As a result, the present inventors found that the expression of the PPARα gene is enhanced by these foods, and that this is accompanied by suppressed expression of fatty acid synthase and enhanced expression of a group of PPARα target genes associated with fatty acid metabolism. The present inventors also confirmed the effect of these foods in enhancing the expression of PPARγ and adiponectin, and discovered that these foods have the activity of enhancing the production of PPAR and PPAR-associated factors.09-02-2010
20100222265HEPARIN BINDING EPIDERMAL GROWTH FACTOR (HB-EGF) FOR USE IN METHODS OF TREATING AND PREVENTING INTESTINAL INJURY RELATED TO HEMORRHAGIC SHOCK AND RESUSCITATION - The invention is related to methods of protecting, preventing and reducing intestinal injury in a human subject suffering from or at risk for shock, hemorrhagic shock or hemorrhagic shock and resuscitation (HS/R) comprising administering heparin binding epidermal growth factor (HB-EGF). The invention is also related to methods of inhibiting deterioration of intestinal blood flow and methods of preserving and increasing intestinal blood flow by administering HB-EGF to a human subject. In addition, the methods of the invention should improve the clinical outcome of human subject suffering from or at risk for shock, hemorrhagic shock or hemorrhagic shock and resuscitation.09-02-2010
20100197588USE OF A PEPTIDE AS A THERAPEUTIC AGENT - The present invention is directed to the use of the peptide compound His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH08-05-2010
20100197581NATIVE GP41 ASSAY - The present invention concerns a method for identifying compounds that decrease the ability of Human Immunodeficiency Virus (HIV) to enter previously uninfected cells.08-05-2010
20100197573Transglutaminase Mediated Conjugation of Growth Hormone - A method for PEGylating growth hormone, said method comprising reacting growth hormone with an amine comprising nucleophile which further comprises a first functional group in the presence og TGase to form a transaminated growth hormone, followed by a reaction of said transaminated growth hormone with a PEG which has been functionalised with a second functional group, wherein said first and second functional groups are selected so that they react to form a covalent bond.08-05-2010
20090105140Albumin Fusion Proteins - The present invention encompasses albumin fusion proteins. Nucleic acid molecules encoding the albumin fusion proteins of the invention are also encompassed by the invention, as are vectors containing these nucleic acids, host cells transformed with these nucleic acids vectors, and methods of making the albumin fusion proteins of the invention and using these nucleic acids, vectors, and/or host cells. Additionally the present invention encompasses pharmaceutical compositions comprising albumin fusion proteins and methods of treating, preventing, or ameliorating diseases, disorders or conditions using albumin fusion proteins of the invention.04-23-2009
20100184669COMPOSITIONS AND METHODS FOR CANCER TREATMENT USING TARGETED CARBON NANOTUBES - The present invention is a method for detecting and destroying cancer tumors. The method is based on the concept of associating a linking protein or linking peptide such as, but not limited to, annexin V or other annexins to carbon nanotubes such as single-walled carbon nanotubes (SWNTs) to form a protein-CNT complex. Said linking protein or peptide can selectively bind to cancerous cells, especially tumor vasculature endothelial cells, rather than to healthy ones by binding to cancer-specific external receptors such as anionic phospholipids including phosphatidylserine expressed on the outer surfaces of cancer cells only. Irradiation of bound CNTs with one or more specific electromagnetic wavelengths is then used to detect and destroy those cells to which the CNTs are bound via the linking protein or peptide thereby destroying the tumor or cancer cells and preferably an immunostimulant is provided to the patient to enhance the immune response against antigens released from the tumor or cancer cells.07-22-2010
20090258832Cytokines and Cytokine Receptors With Reduced Immunocencity - The present invention provides methods for the identification of CD410-15-2009
20100035817METHOD FOR THE PRODUCTION OF CONJUGATES OF INSULIN-LIKE GROWTH FACTOR-1 AND POLY(ETHYLENE GLYCOL) - The present invention relates to a fusion protein comprising IGF-I or an IGF-I variant N-terminally linked to the C-terminus of a propeptide. The invention relates also to a method involving the use of the aforementioned fusion protein in the production of a lysine-PEGylated IGF-I or IGF-I variant. The method comprises the steps of cultivating a prokaryotic host cell comprising an expression vector containing a nucleic acid encoding the fusion protein and causing the cell to express the fusion protein, recovering and PEGylating said fusion protein, cleaving said PEGylated fusion protein with IgA protease, and recovering lysine-PEGylated IGF-I or IGF-I variant. The invention relates also to a lysine-PEGylated IGF-I or IGF-I variant produced using the above method. In addition, the invention relates to a method for treating a neurodegenerative disorders like Alzheimer's Disease using the lysine-PEGylated IGF-I or IGF-I variant and a composition comprising the lysine-PEGylated IGF-I or IGF-I variant.02-11-2010
20090227505Methods and uses for protein breakdown products - Where it was generally thought that the smallest breakdown products of proteins had no specific biological function on their own, it now emerges that the body may utilize the normal process of proteolytic breakdown to generate important compounds such as gene-regulatory compounds. For instance, certain short breakdown products of hCG (i.e., short peptides which can easily be synthesized, if needed modified, and used as a pharmaceutical composition) exert a major regulatory activity on pro- or anti-inflammatory cytokine cascades that are governed by a family of crucial transcription factors, the NF-κB family, which generally regulate the expression of genes involved in the body's immune response.09-10-2009
20090253623GH SECRETAGOGUES AND USES THEREOF - The invention relates to use of a GH secretagogue (e.g. GRF or an analog thereof) for (1) altering a lipid parameter in a subject; (2) altering a body composition parameter in a subject, (3) treating a condition characterized by deficient or decreased bone formation in a subject (4) improving daytime vigilance and/or cognitive function in a subject, (5) improving a metabolic condition in a subject, (6) improving anabolism in a catabolic condition in a subject, and/or (7) improving and/or reconstituting immune function in a subject.10-08-2009
20090253627LACTOFERRIN COMPOSITIONS AND METHODS OF WOUND TREATMENT - The present invention relates to lactoferrin compositions and methods of using the compositions to treat wounds. The compositions can be administered alone or in combination with other standard wound healing therapies.10-08-2009
20090247462FGF VARIANTS AND METHODS FOR USE THEREOF - The present invention provides fibroblast growth factor variants demonstrating enhanced receptor subtype specificity and/or affinity. Preferred embodiments include both variants having enhanced activity that act as improved agonists and variants having reduced activity that act as antagonists. Methods of utilizing preferred FGF variants in preparation of medicaments for the treatment of skeletal disorders including skeletal dysplasia, osteoporosis and enhancing bone fracture healing and cartilage healing processes are provided.10-01-2009
20100048479ADRENAL GRK2 ACTIVITY AS A THERAPEUTIC TARGET FOR HEART FAILURE - The present invention relates to compositions and methods for the treatment of failing hearts. More specifically, the present invention provides for the inhibition of G-protein coupled receptor kinase 2 activity in the adrenal gland, which, for example, decreases catecholamine secretion and the sympathetic burden of the failing heart, thereby improving the cardiac adrenergic/inotropic reserve and overall contractile function.02-25-2010
20090042778Methods for Suppressing Neovascularization Using Ephrinb2 - Methods for inhibiting DNA synthesis, MAP kinase activation, and tube formation of endothelial cells are provided. Also provided are methods for inhibiting angiogenesis and neovascularization, as well as compositions useful for the methods described herein.02-12-2009
20090312251Methods of regulating differentiation in mammals - Mechanisms regulating cell proliferation stop and differentiation initiation during the development stage of mammalian embryo, and the proteins involved therein, are presented. Differentiation regulators, methods of regulating differentiation, transgenic organisms with loss of expression of the differentiation regulator, and methods of preparing the transgenic organisms, are provided.12-17-2009
20090312258USES OF HUMAN ZVEN PROTEINS AND POLYNUCLEOTIDES - The present invention provides methods of using Zven1 and Zven2 polypeptides to increase chemokine production. The present invention also provides methods for treating intestinal motility disorders and improving gastrointestinal function with Zven1 and Zven2 polypeptides.12-17-2009
20090312252Antimicrobial Activity in Variants of Lacritin - The present invention provides recombinant proteins with antimicrobial activity and methods for treating animals including humans by administering the novel recombinant proteins. In particular, the invention provides methods for treating and/or preventing microbial diseases and infections using lacritin and homologs, fragments, modifications, and derivatives thereof.12-17-2009
20090312254LONG-ACTING POLYPEPTIDES AND METHODS OF PRODUCING SAME - A polypeptide and polynucleotides encoding same comprising one carboxy-terminal peptide (CTP) of chorionic gonadotrophin attached to an amino terminus of a cytokine and two carboxy-terminal peptides (CTP) of chorionic gonadotrophin attached to a carboxy terminus of a cytokine are disclosed. Pharmaceutical compositions comprising the polypeptide and polynucleotides of the invention and methods of using same are also disclosed.12-17-2009
20090312247NATRIURETIC PEPTIDE RELATED FRAGMENT IN CARDIOVASCULAR DISEASE - This disclosure provides an intracellular fragment of natriuretic peptide receptor A (NPRA), referred to herein as soluble natriuretic peptide receptor-related fragment (sNRF). It is shown herein that sNRF causes NP resistance. Based on these observations, methods of treating a cardiovascular disorder by inhibiting the activity of sNRF are disclosed. Assays are provided that use sNRF to screen agents for their ability to increase the biological activity of an NPR, for example agents that increase the sensitivity of NPR for NPs (such as atrial natriuretic peptide, ANP), or that decrease growth factor deleterious effects, or combinations thereof. Also provided are agents identified using the disclosed assays, and methods of using the agents, for example to treat or diagnose a cardiovascular disorder, such as heart failure.12-17-2009
20090312245SRA binding protein - An isolated polypeptide comprising: (i) SEQ ID No: 2; (ii) amino acids 27 to 109 of SEQ ID No: 2 (iii) amino acids 22 to 109 of SEQ ID No: 2 (iv) amino acids 21-91 of SEQ ID No: 2 (v) amino acids 21-26 and/or 60-67 of SEQ ID No: 2 or (vi) a functional variant of any one of (i) to (v).12-17-2009
20090312244COMPOUNDS AND METHODS FOR IMMUNOTHERAPY AND DIAGNOSIS OF TUBERCULOSIS - Compounds and methods for inducing protective immunity against 12-17-2009
20090312248ANTIMICROBIAL PROTEIN - The present invention provides improved antimicrobial compositions comprising peptide fragments of tammar wallaby milk proteins and analogs and derivatives thereof exemplified by the amino acid sequences of SEQ ID Nos: 1-40 and uses therefor in the treatment of a range of infections by bacteria and fungi. The antimicrobial compositions are particularly useful for broad spectrum applications, especially for the treatment of bacterial infections.12-17-2009
20090312260DRUG THERAPY FOR CELIAC SPRUE - Administering an effective dose of a tTGase inhibitor to a Celiac or dermatitis herpetiformis patient reduces the toxic effects of toxic gluten oligopeptides, thereby attenuating or eliminating the damaging effects of gluten.12-17-2009
20100009909PEPTIDES BINDING THE PHOSPHATASE 2A PROTEIN - The invention relates to novel synthetic or natural E4orf4 or Bcl-2 peptides particularly useful in antitumoral, antiviral and antiparasitic treatments, said peptides being less than 30 amino acids long and binding in vitro to a phosphatase 2A protein holoenzyme or one of its subunits. The invention also relates to polynucleotides encoding the novel peptides, vectors expressing same, as well as antibodies identifying same and probes identifying transcripts thereof.01-14-2010
20100056439LIGANDS THAT HAVE BINDING SPECIFICITY FOR EGFR AND/OR VEGF AND METHODS OF USE THEREFOR - Disclosed are ligands that have binding specificity for vascular endothelial growth factor (VEGF), for epidermal growth factor receptor (EGFR), or for VEGF and EGFR. Also disclosed are methods of using these ligands. In particular, the use of these ligands for cancer therapy is described.03-04-2010
20100016229Oral GLP-1 Formulations - The present invention provides pharmaceutical compositions comprising of at least one delivery agent and GLP-1. These pharmaceutical compositions facilitate the oral delivery of GLP-1, providing improved (e.g. increased) bioavailability of GLP-1 compared to administration of GLP-1 without a delivery agent.01-21-2010
20100056446NA+K+-ATPase-Specific Peptide Inhibitors/Activators of SRC and SRC Family Kinases - A method for regulating Src and its downstream signaling pathway which includes binding between Src and Na+/K+-ATPase is disclosed. The Na+/K+-ATPase/Src complex is a functional receptor for cardiotonic steroids such as ouabain. Also disclosed are Src inhibitors or activators which include either Na+/K+-ATPase or Src that interfere with the interaction between the Na/K-ATPase and Src, act via a different mechanism from ATP analogues, and is pathway (Na+/K+-ATPase) specific.03-04-2010
20090036372COMPOSITION AND USE OF PHYTO-PERCOLATE FOR TREATMENT OF DISEASE - This invention relates generally to a method of preparation of a phyto-percolate that is derived from fresh water mixture including algae. The invention further relates to the use of the phyto-percolate in a variety of disease states. The phyto-percolate is believed to contain an activity that induces the reduction of soluble and insoluble fibrin. Further, the phyto-percolate is believed to reduce oxidative stress in the body.02-05-2009
20090036366INHIBITORS OF HUMAN PLASMIN DERIVED FROM THE KUNITZ DOMAINS - This invention provides: novel proteins, which are homologous to the first Kunitz domain (K1) of lipoprotein-associated coagulation inhibitor (LACI), and which are capable of inhibiting plasmin; uses of such novel proteins in therapeutic, diagnostic, and clinical methods; and polynucleotides that encode such novel proteins.02-05-2009
20090036362Angiogenesis Affecting Polypeptides, Proteins, and Composition, and Methods of Use Thereof - The present invention relates to polynucleotides and proteins associated with vasculogenesis- and angiogenesis-related disorders. The invention further relates to methods for the identification of compounds that modulate the expression of angiogenesis-related genes and gene products and to using such compounds as therapeutic agents in the treatment of angiogenesis-related disorders. The invention also relates to methods for the diagnostic evaluation, genetic testing and prognosis of angiogenesis-related disorders, and to methods and compositions for the treatment these disorders.02-05-2009
20100056450Method For Reducing Postprandial Blood Glucose Levels With A Whey Protein/Fiber Composition - A method is provided that is effective for reducing postprandial blood glucose levels. The method includes administering a blend of native whey protein and viscosifying fiber to a subject in an amount and at a time prior to a meal or concurrent with a meal that is effective for reducing postprandial blood glucose levels and/or reducing food intake.03-04-2010
20090143288Peptide-complement conjugates - The current invention reports a polypeptide conjugate, wherein the conjugate comprises a first polypeptide selected from the group of polypeptides comprising SEQ ID NO: 01 and fragments thereof, and a second polypeptide selected from the group of antifusogenic peptides.06-04-2009
20100062983Use of Factor VIIa or Factor VIIa equivalents for treating late complications of trauma - The invention relates to the use of Factor VIIa or a Factor VIIa equivalent for the manufacture of a medicament for preventing late complications in trauma patients.03-11-2010
20100062978METHOD FOR INHIBITING SIGNAL TRANSDUCTION, SIGNAL TRANSDUCTION INHIBITOR TO BE USED THEREIN AND USE THEREOF - An object of the present invention is to provide a method for inhibiting activation of signaling pathway mediated by erbB1 or erbB2 in human cell and a signaling inhibitor to be used therefor. The above-described activation of signaling pathway can be inhibited by a polypeptide comprising at least one of PTB domain or ERK2 binding domain of human FRS2β. The above-described polypeptide may be introduced directly into cell, or nucleic acid which encodes for the above-described polypeptide may be introduced into cell to allow expression of the polypeptide in the cell. Such polypeptide and nucleic acid can be used, for example, as a signaling inhibitor. In addition, since erbB1 and erbB2 are involved in development of cancer, the above-described signaling inhibitor is also useful, for example, as an anticancer drug.03-11-2010
20100069298Methods for Detecting Overexpression of SPARC and Therapeutic and Diagnostic Methods Relating to Same - Methods for detecting elevated levels of SPARC in biological samples using immunohistochemical staining and therapeutic and diagnostic methods relating to those detection methods.03-18-2010
20100069304PROTECTIVE EFFECTS OF INHIBITING THE INTERACTION OF CALMODULIN AND MUTANT HUNTINGTIN PROTEIN - An artificial polypeptide can be used in a treatment for Huntington's disease. The inventive polypeptide sequence is capable of interacting with mutant huntingtin so as to inhibit interactions between mutant huntingtin or a fragment of mutant huntingtin and calmodulin. The inventive polypeptide sequence can be a portion of calmodulin described herein or an analog or derivative thereof that binds with the polyglutamate portion of a mutant huntingtin protein. For example, polypeptide sequence can include a sequence of KDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEV (SEQ ID NO: 1) or a portion thereof analog thereof or derivative thereof.03-18-2010
20100062979TREATMENT OF ECTOPARASITIC INFESTATION - The present invention relates to Asteraceae protein for use in treating an ectoparasitic infection or infestation in an animal as well as to a method of treating an ectoparasitic infection or infestation in an animal which comprises administering to an animal in need thereof an effective amount of Asteraceae protein; in each case the use or method may also employ glucan or mannan, especially from a yeast source.03-11-2010
20100056449Whey Protein Pre-Load - A method is provided that is effective for reducing postprandial blood glucose levels and/or food intake levels. The method includes administering native whey protein to a subject in an amount and at a time prior to a meal that is effective for reducing postprandial blood glucose levels and/or reducing food intake.03-04-2010
20100056437Compositions for Treating or Preventing Myocardial Damage or Heart Failure - The present inventors compared myocardial damages after ischemia/reperfusion in wild-type mice and Midkine (MK)-deficient mice to confirm the effects and functions of MK. MK administration was found to significantly prevent cardiomyocyte apoptosis in both cultured cardiomyocytes (in vitro) and mouse models (in vivo).03-04-2010
20100056440COMPOSITIONS AND METHODS FOR ADMINISTERING GDNF LIGAND FAMILY PROTEINS - Disclosed are methods of increasing serum exposure of an administered glial cell line-derived neurotrophic factor (GDNF) ligand family protein by administering to a subject via systemic delivery (i) a GDNF ligand family protein, and (ii) an amount of heparin or heparan sulphate that increases serum exposure of the administered GDNF ligand family protein in the subject.03-04-2010
20100056448GLUT-1 AS A RECEPTOR FOR HTLV ENVELOPES AND ITS USES - The invention relates to the use of the ubiquitous vertebrate glucose transporter GLUT1, or of fragments or sequences derived thereof, for the in vitro diagnosis of cancers, when used as a tumor marker, or for the screening of compounds useful for the preparation of drugs for the prevention or the treatment of pathologies linked to an infection of an individual with a PTLV, or pathologies linked to an overexpression of GLUT1 on cell surfaces, or the in vitro detection of GLUT1 on cell surfaces. The invention also relates to pharmaceutical compositions containing GLUT1, or fragments or sequences derived thereof, and to their uses such as in the frame of the prevention or the treatment of pathologies linked to an infection of an individual with a PTLV.03-04-2010
20100056453Liquid, Aqueous Pharmaceutical Compositions of Factor VII Polypeptides - The present invention is directed to liquid, aqueous pharmaceutical compositions stabilised against chemical and/or physical degradation containing Factor VII polypeptides, and methods for preparing and using such compositions, as well as vials containing such compositions, and the use of such compositions in the treatment of a Factor VII-responsive syndrome. The main embodiment is represented by a liquid, aqueous pharmaceutical composition comprising at least 0.01 mg/mL of a Factor VII polypeptide (i); a buffering agent (ii) suitable for keeping pH in the range of from about 4.0 to about 9.0; and at least one stabilising agent (iii) comprising a —C(═N—Z03-04-2010
20100056452ANGIOGENESIS-PROMOTING SUBSTRATE - To provide an angiogenesis-promoting substrate which can be easily and cost-effectively produced, it is proposed that the substrate comprise a non-porous shaped body formed from a gelatin-containing material which is insoluble and resorbable under physiological conditions.03-04-2010
20100056451Stabilized Pharmaceutical Peptide Compositions - Method for increasing the shelf-life of a pharmaceutical composition for parenteral administration comprising a glucagon-like peptide which is prepared from a peptide product that has been subjected to treatment at a pH above neutral pH.03-04-2010
20100056441Method for Inhibiting Angiogenesis - The invention provides methods for inhibiting angiogenesis in an animal in need thereof. The invention also pro-vides methods for preventing tumor growth and metastasis in an animal comprising inhibiting FoxM1B activity.03-04-2010
20100137205Use of FGF-18 Protein, Target Proteins and Their Respective Encoding Nucleotide Sequences to Induce Cartilage Formation - The use of fibroblast growth factor (FGF)-18 protein, certain of its downstream target genes and respective expressed proteins, in particular sonic hedgehog (Shh), Shh protein, β-catenin, β-catenin protein, and the Wnt family of proteins that stimulate β-catenin, and the respective nucleotide sequences encoding this protein, particularly for inducing cartilage formation, particularly for the purpose of generating, repairing, reconstructing, or de novo formation of, cartilaginous tissue. Therapies for which FGF-18 and the target proteins are useful include repair and reconstruction of various tissues in conducting airways such as the trachea, bronchi, lung and larynx caused by, for example, tracheal-bronchial abnormalities, tracheal-laryngo or bronchial malaria. Other therapies for which FGF-18 and the target proteins would be useful include other cartilaginous tissues, such as those of joint and skeletal tissue caused by, for example, arthritis and meniscus abnormalities in joints.06-03-2010
20090215690Compositions and Methods for Inhibiting Cell Migration - The finding that Dickkopf1 (Dkk1) is a dual function protein demonstrates a mechanism for the coordination of cell migration and antagonism of Wnt/β-catenin signaling during developmental and pathological processes. The profile of Dkk proteins expressed by human breast cancers correlates with indicators of outcome: Dkk1 associates with markers of poor prognosis whereas expression of single function Dkk2 or Dkk3 (which inhibit Wnt/β-catenin signaling and promote migration, respectively) correlates with phenotypes reflective of good prognosis. Therefore, the pro-migratory activities of Dkk1 and 3 identified here offer new insights into breast cancer progression and a potential avenue for therapeutic intervention.08-27-2009
20090215694Lyophilized Formulations of Exendins and Exendin Agonist Analogs - Novel formulations containing exendins, exendin agonists and/or exendin analogs are provided.08-27-2009
20090215695REGULATION OF CYTOKINE SYNTHESIS AND RELEASE - Methods of treatment and prevention of diseases associated with release of neutrophil elastase and IL-8 by administration of TFPI and analogs of TFPI are disclosed. Methods of determining efficacy of treatment with TFPI, patient's responsiveness to treatment with TFPI, and the ultimate determination of patient prognosis are also disclosed.08-27-2009
20090215692COMPOSITIONS AND METHODS TO PREVENT CANCER WITH CUPREDOXINS - The present invention relates to compositions and methods comprising chemopreventive agents that may be cupredoxin(s) or variants, derivatives and structural equivalents of cupredoxins, and at least one other chemopreventive agent. Specifically, these compositions may comprise azurin from 08-27-2009
20090215691NOGO Receptor Antagonists - Disclosed are immunogenic Nogo receptor-1 polypeptides, Nogo receptor-1 antibodies, antigen-binding fragments thereof, soluble Nogo receptors and fusion proteins thereof and nucleic acids encoding the same. Also disclosed are compositions comprising, and methods for making and using, such Nogo receptor antibodies, antigen-binding fragments thereof, soluble Nogo receptors and fusion proteins thereof and nucleic acids encoding the same.08-27-2009
20090215682Modified PYY (3-36) Peptides and Their Effects on Feeding Behaviour - The present invention relates to compounds of formula (1); variants or derivatives thereof, or salts or solvates thereof. The present invention also relates to the use of such compounds to control appetite, feeding, food intake, energy expenditure and calorie intake, particularly in the treatment of obesity.08-27-2009
20090215688GLP-I Agonist And Cardiovascular Complications - Methods and uses for the treatment and prevention of cardiac and cardiovascular diseases comprising administration of a GLP-1 agonist.08-27-2009
20090215687Compounds for Enhancing Hypoxia Inducible Factor Activity and Methods of Use - The present invention relates to methods for enhancing Hypoxia inducible factor-1 (HIF) activity in a cell by contacting the cell with any one of the following compounds: 3,6-bis[2-(dimethylamino)ethoxy]-9h-xanthen-9-onedihydrochloride, 2,8-bis[dimethylaminoacetyl]dibenzofurin dihydrochloride hydrate, tilorone analogue R-9536-DA, indoprofen, ciclopiroxolamine, tryptophan, ansindione, nabumetone, oxybendazole, albendazole, tropicamide, pramoxine hydrochloride, atenolol, mebendazole, carbetapentane citrate, monensin sodium, methoxyvone, hydroxyzine, phenazopyridine, clofoctol, ipraflavone, zomepirac, biochanin A, xylometazoline hydrochloride, fenbendazole, pirenzepine, triprolidine hydrochloride, daidzein, tripelennamine citrate, colchicines, aminopyridine, trimethoprim, helenine, hydroxyurea, amiodarone hydrochloride, clindamycin hydrochloride, sulfachlorpyridazine, mephenesin, semustine, clofivric acid, clofibrate, ibuprofen, hyoscyamime, nafcillin sodium, piperin, clidinium bromide, trioxsalen, hydralazine and HIF alpha protein fused to a carrier peptide.08-27-2009
20090215686NK1-BASED POLYPEPTIDES AND RELATED METHODS - The present invention includes various NK1-based polypeptides and polynucleotides, related compositions, methods of modulating Met activity in a cell, and related methods of treatment. Also, the present invention includes a method for designing an antagonist of a receptor tyrosine kinase from a receptor tyrosine kinase agonist.08-27-2009
20090215683SCREENING AND THERAPEUTIC METHOD FOR NSCLC TARGETING CDCA1-KNTC2 COMPLEX - The present invention is based on the observation that the co-activation of CDCA1 and KNTC2, and their cognate interactions, play significant roles in lung-cancer progression and that methods of inhibiting the complex can be used to treat non-small-cell lung cancer.08-27-2009
20090215681Methods of Diagnosis and Treatment of Metabolic Disorders - The invention features diagnostic methods for metabolic disorders (e.g., diabetes and obesity), methods for screening for compounds useful in the treatment of metabolic disorders, and methods for treatment of metabolic disorders that involve sirtuin2 or sirtuin3 nucleic acids or proteins or their agonists or antagonists.08-27-2009
20090215680Inhibitor peptides - The invention concerns peptides useful as MAP kinase/ERK pathway-specific inhibitors relative to a given substrate in a given subcellular compartment.08-27-2009
20090215679Disease-associated proteins - Disclosed are methods and compositions for early diagnosis, monitoring and treatment of an ocular disorder. In particular, the invention relates to a novel protein, that is differentially transcribed and expressed in subjects suffering from retinal dystrophies and the like, such as retinal dystrophy and age-related macular degeneration compared with healthy subjects, antibodies which recognize this protein, and methods for diagnosing such conditions.08-27-2009
20100062977TCR-Independent Activation of T Cells - A method for TCR-independent T cell activation which comprises the co-ligation of CD28 and CD81.03-11-2010
20100137217FIBROSIS INHIBITOR FOR IMPLANTED ORGAN - A pharmaceutical preparation comprising a hepatocyte growth factor or a DNA molecule encoding the same and the like according to the present invention can suppress the fibrosis of a transplanted organ after organ transplantation. The present invention is useful in the fields of organ transplantation and regeneration therapy.06-03-2010
20100069302SPECIFIC THERAPY AND MEDICAMENT USING INTEGRIN LIGANDS FOR TREATING CANCER - The invention relates to a combination therapy for the treatment of tumors and tumor metastases comprising administration of integrin ligands, preferably integrin antagonists, together with co-therapeutic agents or therapy forms that have synergistic efficacy when administered consecutively with said ligands, such as chemotherapeutic agents and or radiation therapy. The therapy results in a synergistic potential increase of the inhibition effect of each individual therapeutic on tumor cell proliferation, yielding more effective treatment than found by administering an individual component alone, concurrently or not in the dosage regime of the present invention.03-18-2010
20090312250EPIDERMAL GROWTH FACTOR INCREASING INSULIN SECRETION AND LOWERING BLOOD GLUCOSE - The present inventors show that a brief exposure to EGF stimulates insulin secretion glucose-independently via a Ca2+ influx- and PLD2-dependent mechanism. Furthermore, the present invention shows that EGF is a novel secretagogue that lowers plasma glucose levels in normal and diabetic mice, suggesting the potential for EGF treatment in diabetes.12-17-2009
20100130415Stem cell secreted product derived compositions for wound treatment - Compositions including formulations comprising secreted products obtained from the culture medium of stem cells, such as umbilical cord blood stem cells, or embryonic germ cell derivatives, or embryonic stem cells, are provided for enhancement of wound healing. Further compositions contain components identified in such culture medium to enhance wound healing. Methods for using the compositions and formulations for enhancing wound healing are also provided. Wounds to both soft and bony tissues are encompassed, and include wounds created by surgical procedures.05-27-2010
20100240589DIASTEREOMERIC PEPTIDES USEFUL AS INHIBITORS OF MEMBRANE PROTEIN ASSEMBLY - The present invention relates to membrane binding diastereomeric peptides comprising amino acid sequences corresponding to a fragment of a transmembrane proteins, wherein at least two amino acid residues of the diastereomeric peptides being in a D-isomer configuration. The diastereomeric peptides are useful in inhibiting fusion membrane protein events, including specifically viral replication and transmission.09-23-2010
20100120686COMPOSITIONS CONTAINING, METHODS INVOLVING, AND USES OF NON-NATURAL AMINO ACIDS AND POLYPEPTIDES - Disclosed herein are non-natural amino acids and polypeptides that include at least one non-natural amino acid, and methods for making such non-natural amino acids and polypeptides. The non-natural amino acids, by themselves or as a part of a polypeptide, can include a wide range of possible functionalities, but typical have at least one oxime, carbonyl, dicarbonyl, and/or hydroxylamine group. Also disclosed herein are non-natural amino acid polypeptides that are further modified post-translationally, methods for effecting such modifications, and methods for purifying such polypeptides. Typically, the modified non-natural amino acid polypeptides include at least one oxime, carbonyl, dicarbonyl, and/or hydroxylamine group. Further disclosed are methods for using such non-natural amino acid polypeptides and modified non-natural amino acid polypeptides, including therapeutic, diagnostic, and other biotechnology uses.05-13-2010
20100120682COMPOSITIONS FOR INCREASING BODY WEIGHT, USE AND METHODS - Use of an isolated polypeptide comprising an amino acid sequence having a sequence identity of at least 80%, with the amino acid sequence represented by Gly Asn Ser Asp Asp Phe Leu Ser Gln Gln Pro Glu Arg Pro Arg AspVal Lys Leu Ala Arg (SEQ ID NO: 2), or a pharmaceutically acceptable salt thereof, for preparing a medicament for the treatment of a mammal to increase the body fat mass of said mammal, or to prevent or reduce the loss of body fat mass of said mammal. The polypeptide may comprise an amino acid sequence having a sequence identity of at least 80% with the amino acid sequence represented by SEQ ID NO: 1, and may be the polypeptide the monomeric proenzyme of tartrate-resistant acid phosphatase type 5 (TRAP). A pharmaceutical composition comprising the polypeptide. The polypeptide is useful for increasing the body fat mass of a mammal.05-13-2010
20100113345PREPARATION OF LOW BLEEDING ANTICOAGULANT FUSION PROTEIN AND ITS USE - Provided is an anticoagulant fusion protein comprising oligopeptide recognizable and cleavable by either factor XIa and factor Xa or thrombin and factor Xa. Also provided are the preparation method of the anticoagulant fusion protein and medicinal use thereof.05-06-2010
20100113338PROPHYLACTIC OR THERAPEUTIC AGENT FOR CORNEAL/CONJUNCTIVAL DISEASE - Disclosed is a novel composition for the treatment of a corneal/conjunctival disease. A prophylactic or therapeutic agent for a corneal/conjunctival disease comprising selenoprotein P as an active ingredient, more specifically a prophylactic or therapeutic agent for a corneal/conjunctival disease such as dry eye, keratoconjunctivitis sicca, superficial punctate keratopathy, corneal erosion or corneal ulcer comprising selenoprotein P as an active ingredient, particularly a prophylactic or therapeutic agent for a corneal/conjuncrtival disease such as dry eye, keratoconjunctivitis sicca, superficial punctate keratopathy, corneal erosion or corneal ulcer accompanied by a corneal/conjunctival epithelial discorder.05-06-2010
20100113346Method of Treating or Preventing Infertility in a Female Mammal and Pharmaceutical Kit for Use in Such Method - The present invention relates to a method of treating infertility in a female mammal that involves controlled ovarian hyperstimulation. The method includes administering to the female a combination of (i) an FSH substance in an amount effective to stimulate follicular development and (ii) a steroid in an effective amount to inhibit or suppress the secretion of luteinising hormone. The steroid can be substances represented by the following formula05-06-2010
20100120678NOVEL INHIBITORS OF THE EGFR KINASE TARGETING THE ASYMMETRIC ACTIVATING DIMER INTERFACE - The invention provides methods and compositions for the modulation of EGFR activity, in particular, inhibition of EGFR activation through an allosteric mechanism is discloses, as is a method for targeted drug discovery and design based on models of the three dimensional structure of the kinase domains of the protein dimers.05-13-2010
20090005299Method For Producing Carboxy-Terminal-Amidified Peptides - The invention relates to the production of carboxy-terminal (C-terminal) amidified peptides with C-terminal amidified lysin, in particular with the biological activity of GLP-1, the chemical and/or biotechnological precursors and intermediate products thereof. The invention also relates to a method for the production and use thereof for producing pharmaceutical products.01-01-2009
20080261879Method of inducing and maintaining neuronal cells - The present invention makes available a method for inducing neuronal differentiation and preventing the death or degeneration of neuronal cells both in vitro and in vivo. The subject method stems from the unexpected finding that, contrary to traditional understanding of neural induction, the default fate of ectodermal tissue is neuronal rather than mesodermal and/or epidermal. In particular, it has been discovered that preventing or antagonizing a signaling pathway in a cell for a growth factor of the TGF-β family can result in neuronal differentiation of that cell.10-23-2008
20100120675INHIBITOR OF THE URACIL-DNA GLYCOSYLASE ENZYME AND USES THEREOF - The present invention relates to a protein which has the capacity to bind to and inhibit the viral uracil DNA glycosylase (UDG) enzyme and its use as a therapeutic agent; in particular, as an antiviral agent.05-13-2010
20100069299Ghrelin analogs - The invention comprises peptidyl analogs that possess agonist or antagonist ghrelin activity, along with therapeutic and non-therapeutic uses thereof.03-18-2010
20100048480PRODUCTION OF ANTI-MICROBIAL PEPTIDES - The present application provides methods of producing antimicrobial peptides (AMPs) in a cell, for example by expression a fusion protein that includes small ubiquitin related modifier (SUMO) and an AMP in the cell. Also provided are nucleic acid and protein sequences of SUMO-AMP fusion proteins, and kits that include such molecules.02-25-2010
20100035804POLYPEPTIDE ANTAGONIST - We describe a circularly permuted growth hormone polypeptide antagonist; compositions comprising said antagonist and methods to treat conditions that would benefit from administration of said antagonist.02-11-2010
20100016225CONJUGATES COMPRISED OF POLYMER AND HIV gp-41-DERIVED PEPTIDES AND THEIR USE IN THERAPY - Provided are conjugates comprising a polymer having operably bound thereto no less than two molecules of synthetic peptide derived from HIV gp41; methods of using these conjugates to inhibit transmission of HIV to a target cell by adding an amount of effective to inhibit infection of the cell by the virus; and methods of producing the conjugates by operably binding each molecule of synthetic peptide, via a reactive functionality, to the polymer.01-21-2010
20100004177TOXIN COMPLEX PROTEINS AND GENES FROM XENORHABDUS BOVIENII - The subject invention relates to novel 01-07-2010
20100004173RECONSTITUTED SURFACTANTS HAVING IMPROVED PROPERTIES - Reconstituted surfactants comprising a lipid carrier, a polypeptide analog of the native surfactant protein SP-C, and a polypeptide analog of the native surfactant protein SP-B are useful for the treatment and/or prophylaxis of RDS and other respiratory disorders.01-07-2010
20100004172Compositions for mucosal and oral administration comprising hcg fragments - The invention relates to the field of immunology, more specifically to the field of immune-mediated disorders such as allergies, auto-immune disease, transplantation-related disease and other inflammatory diseases. The invention in particular relates to the systemic treatment of inflammatory disease by oral or mucosal administration of a pharmaceutical composition with a gene-regulatory peptide. The invention provides a pharmaceutical composition in a form for mucosal application for the treatment of a subject suffering from disease, the pharmaceutical composition comprising a pharmacologically effective amount of a gene-regulatory peptide or a functional analogue thereof together with a pharmaceutically acceptable diluent.01-07-2010
20100004170PROTEIN-CONTAINING SUBSTANCE WITH INCREASED THERMAL STABILITY - The invention relates to an agent with increased thermal stability comprising a core and a coating layer characterized in that the core comprises at least one biologically active protein and that the coating layer comprises a micronized product from leguminous plants, a method for the production of this agent as well as the use of a micronized product from leguminous plants to increase the thermal stability of biologically active proteins in methods for the production of a granulated product as well as in methods for the production of animal feed, food and pharmaceuticals.01-07-2010
20090325874Inhibition of inositol 1,4,5-triphosphate receptor calcium channel/cytochrome c interactions and uses thereof - The present invention demonstrates selective pharmacological targeting and inhibition of apoptotic calcium release in lymphocytes from inositol 1,4,5-trisphosphate receptor calcium channels may enhance the immunologic response to tumor cells which have acquired adaptive changes in death receptor signaling to promote survival. The present invention provides methods of protecting lymphocytes from tumor cell-induced apoptotic cell death by contacting lymphocytes with one or more cell permeant peptide(s). Also provided are methods of inhibiting caspase activation and blocking calcium release by blocking binding of cytochrome c to the inositol 1,4,5-triphosphate receptor calcium channel. In addition, methods are provided to treat a cancer, enhance immunologic response by administering or applying small molecule inhibitor, e.g., cell permeant peptides specific for the cytochrome c binding domain of inositol 1,4,5-triphosphate receptor calcium channel.12-31-2009
20090318342Compounds - A mutant TIMP-3 (Tissue Inhibitor of MetalloProteinase-3) polypeptide wherein an additional residue or residues, for example an alanine residue, precedes the N-terminal residue of the TIMP-3 polypeptide; or wherein the residue corresponding to Threonine2 of TIMP-3 is mutated to Glycine. Such a mutant is considered to retain activity as an inhibitor of ADAMs, such as TACE, ADAMTS-4 and ADAMTS-5, but to have reduced activity as an inhibitor of MMPs.12-24-2009
20090312257USES OF HUMAN ZVEN PROTEINS AND POLYNUCLEOTIDES - The present invention provides methods of using Zven1 and Zven2 polypeptides to increase chemokine production. The present invention also provides methods for treating intestinal motility disorders and improving gastrointestinal function with Zven1 and Zven2 polypeptides.12-17-2009
20090281024Compositions Comprising Receptor-Associated Protein (RAP) Variants Specific for CR-Containing Proteins and Uses Thereof - The present invention relates generally to receptor-selective variants of the low-density lipoprotein receptor-associated protein (RAP) and compositions thereof, methods of generating such variants and methods of using such receptor-selective RAP variant compositions for therapeutic purposes.11-12-2009
20090281026Use of BiP or a Variant, Homologue, Derivative or Fragment Thereof in the Manufacture of a Medicament for the Prevention or Treatment of Bone Loss or Bone Resorption - The present invention relates to the use of BiP or a variant, homologue, derivative or fragment thereof in the manufacture of a medicament for the prevention or treatment of bone loss or bone resorption.11-12-2009
20090029922Use of S1P receptor agonists in heart diseases - The invention relates to the use of a sphingosine-1-phosphate receptor agonist in the treatment of heart diseases.01-29-2009
20090029921Method for Removing Endotoxin from Proteins - Disclosed is a method for removing endotoxin from proteins. Also disclosed are products made by using the method. The method may be used, for example, to produce endotoxin-free lactoferrin. Bovine milk-derived lactoferrin may be produced in commercial quantities by the method, and endotoxin-free bovine lactoferrin may be used for a variety of therapeutic uses, including improving wound healing.01-29-2009
20090029920Methods and Compositions for Treating Ocular Disorders - The present invention provides a method for treating and/or preventing damage to a retina or optic nerve in a subject comprising administering to the subject a therapeutically effective amount of oncomodulin. Preferably, the subject is a mammal, most preferably, a human. In preferred embodiments, the oncomodulin may be used in combination with mannose, a mannose derivative and/or inosine.01-29-2009
20090029915REGULATION OF MINERAL AND SKELETAL METABOLISM - A method is disclosed whereby levels of calcium, phosphate and parathyroid hormone are measured in a patient. The patient is treated with a formulation comprising a compound having phosphotonin activity and thereafter measurements are made again. Dosing of the formulation is adjusted based on measurements with measuring, administering and adjusting dosing continually repeated as needed.01-29-2009
20090029913Novel exendin agonist compounds - Novel exendin agonist compounds are provided. These compounds are useful in treating diabetes and conditions which would be benefited by lowering plasma glucose or delaying and/or slowing gastric emptying.01-29-2009
20090029917METHODS AND COMPOSITIONS FOR THE TREATMENT OF FIBROTIC CONDITIONS & IMPAIRED LUNG FUNCTION & TO ENHANCE LYMPHOCYTE PRODUCTION - The present invention provides methods and compositions to treat fibrotic conditions, to increase lymphocyte production in vivo, and to improve and/or normalize lung function, pulmonary compliance, blood oxygenation, and blood pH to inhibit inflammatory processes to stimulate or inhibit pro-inflammatory and immune cells, and to inhibit migration of vascular endothelial cells. The invention contemplates the administration of human uteroglobin, native or recombinant, as a means of achieving these ends. Specifically, it has been found that uteroglobin inhibits cell adhesion to fibronectin, increases lymphocyte production in vivo, and improves and/or normalizes lung function, pulmonary compliance, blood oxygenation, and blood pH, and inhibits inflammatory process. In addition it has been found that uteroglobin can stimulate or inhibit pro-inflammatory and immune cells and inhibitor migration of vascular endothelial cells.01-29-2009
20090029912Method of enhancing proliferation and/or survival of mesenchymal precursor cells (mpc) - The present invention relates to methods of enhancing proliferation and/or survival of mesenchymal precursor cells (MPC) and/or progeny derived therefrom in vitro or in vivo comprising exposing the MPC or progeny to SDF-1 or analog thereof. The invention also relates to compositions comprising isolated MPCs or progeny derived therefrom and SDF-1 or analogues thereof. The present invention also relates to using such methods and compositions for ex vivo or in vivo bone formation in mammals.01-29-2009
20090209458Cell-penetrating socs polypeptides that inhibit cytokine-induced signaling - Disclosed are compositions and methods related to cell-penetrating suppressor of cytokine signaling (SOCS) proteins that inhibit cytokine-induced signaling.08-20-2009
20090186814Methods and Compositions for Reducing Ischemia-Derived Microvascular Damage - Methods of decreasing the extent of occlusion in the lumen of a mammalian blood vessel due to an ischemic or other hypoxic event are provided. In one form, a method includes administering to a patient in need thereof a pharmaceutically effective amount of an inhibitor of δ protein kinase C, either alone or in combination with a second therapeutic agent, and wherein the blood vessel is a blood vessel of the microvasculature. Additionally, methods of decreasing endothelial cell swelling in a mammalian blood vessel due to an ischemic or other hypoxic event are also provided. In one form, a method includes administering to a patient in need thereof a pharmaceutically effective amount of an inhibitor of δ protein kinase C, either alone or in combination with a second therapeutic agent.07-23-2009
20090118189Novel angiogenic composition-based methods - The invention relates to a composition for promoting angiogenesis, for controlling DNA synthesis of a cell, and for controlling chemotactic motility of a cell. The invention also relates to a method for treating ischemia diseases.05-07-2009
20090118181Compositions and methods for producing bioactive fusion proteins - Disclosed is a composition of matter involving a recombinant fusion protein comprising a a pharmacologically active protein partner, and a small pharmacologically inactive protein domain partner of human origin, such as but not limited to, a 1005-07-2009
20080293625Diagnosis of Inflammatory Bowel Diseases, More Particularly Ulcerative Colitis - The present invention concerns goblet cell antigen, a method for detecting antibodies directed against goblet cell antigen, a method based thereon for diagnosis of inflammatory bowel diseases and a kit for diagnosis of inflammatory bowel diseases, as well as monoclonal antibodies directed against goblet cell antigen.11-27-2008
20090118179Therapeutic Agent for Dentin-Pulp Complex Regeneration - The present invention provides a therapeutic agent for regenerating a dentin-pulp complex, containing a basic fibroblast growth factor and/or a homolog thereof as an active ingredient. The present invention also provides a pulp-capping agent containing a basic fibroblast growth factor and/or a homolog thereof as an active ingredient.05-07-2009
20090118190MUTEINS OF FIBROBLAST GROWTH FACTOR 21 - The present invention relates to novel muteins of human fibroblast growth factor 21 with improved pharmaceutical properties. Both protein and the respective encoding nucleic acid species are disclosed. The invention also embodies vectors and host cells for the propagation of said nucleic acid sequences and the production of said muteins. Also disclosed are methods for treating type 2 diabetes, obesity, metabolic syndrome, and in reducing the mortality and morbidity of critically ill patients.05-07-2009
20090118186Use of TRAIL Polypeptides to Treat Cancer - A novel cytokine designated TRAIL induces apoptosis of certain target cells, including cancer cells and virally infected cells. Isolated DNA sequences encoding TRAIL are disclosed, along with expression vectors and transformed host cells useful in producing TRAIL polypeptides. Antibodies that specifically bind TRAIL are provided as well.05-07-2009
20090118176Stem Cell Factor-Like Protein Scfa1 and Uses Thereof - Methods for stimulating epithelial cell proliferation and for treating oral and gastrointestinal disorders are described. The methods use compositions comprising stem cell factor-like protein A1 (SCFA1) polypeptides and polynucleotides.05-07-2009
20090118178Y4 SELECTIVE RECEPTOR AGONISTS FOR THERAPEUTIC INTERVENTIONS - Y4 receptor agonist peptide selected from the group consisting of: [Ala30]PP05-07-2009
20090088379RECONSTITUTED SURFACTANTS HAVING IMPROVED PROPERTIES - The present invention is directed to a reconstituted surfactant containing a lipid carrier, a polypeptide analog of the native surfactant protein SP-C, and a polypeptide comprising a sequence comprised of repeated units where each unit contains between 3 and 8 hydrophobic amino acid residues and one basic amino acid residue. The invention is also directed to the pharmaceutical compositions thereof and to its use for the prophylaxis and/or treatment of RDS and other respiratory disorders.04-02-2009
20080274953Method of Preparing a Protein Aggregate and a Pharmaceutical Preparation - The invention relates to a method of preparing a protein aggregate, wherein an aqueous protein solution is acidified with a pH that lies above the isoelectric point of the protein. In accordance with the invention, a first protein, which through acidification is able to form a protein aggregate, is acidified in the presence of a second protein in the aqueous solution in order to form a coaggregate comprising the first and second protein, wherein the second protein under identical temperature conditions and pH does not form a protein aggregate in the absence of the first protein. Acidification preferably occurs with the aid of CO11-06-2008
20080274954Gene Encoding a Guanine Nucleotide Exchange Factor and Its Gene Product - A gene encoding a novel protein having a guanine nucleotide exchange factor (GEF) activity for a Rho family protein being one group of small GTP binding proteins, namely, a polynucleotide shown by the nucleotide sequence set forth in SEQ ID NO: 1, SEQ ID NO: 3, or SEQ ID NO: 5, or the complementary strand, the equivalents of the polynucleotide, a protein encoded by the polynucleotide, a vector containing the polynucleotide, a transformant containing the vector, an antibody against the protein encoded by the polynucleotide, a method of identifying a compound that inhibits the function of the protein encoded by the polynucleotide and/or the expression of the polynucleotide, a method of determining a disease, a pharmaceutical composition, and a reagent kit are provided.11-06-2008
20080242607GLYCOSYLATION OF PEPTIDES VIA O-LINKED GLYCOSYLATION SEQUENCES - The present invention provides sequon polypeptides with an amino acid sequence including one or more exogenous O-linked glycosylation sequence of the invention. In addition, the present invention provides methods of making polypeptide conjugates as well as methods of using such conjugates and their pharmaceutical compositions. The invention further provides libraries of sequon polypeptides, wherein each member of such library includes at least one exogenous O-linked glycosylation sequence of the invention. Also provided are methods of making and using such libraries.10-02-2008
20080242608Methods and compositions for treating and preventing neurologic disorders - The present invention provides methods for treating or reducing neurologic and ischemic vascular disorders.10-02-2008
20080242609Composition for the therapy of diabetes mellitus and adiposity - A composition containing at least two of the following active substances A, B, C, wherein:10-02-2008
20100197586USE OF SECRETIN AND OPTIONALLY URODILATIN AS THERAPEUTIC AGENTS - The present invention is directed to the use of the peptide compound His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-LeU-Val-NH08-05-2010
20080312145Agent for Regulating Bone Formation - The present invention provides preventive, ameliorating, and/or therapeutic agents for diseases caused by a disturbed balance between bone formation and bone resorption. The decoys of the present invention induce normal bone metabolism by inhibiting the differentiation-inducing factors of cells involved in bone metabolism. For example, bone resorption can be controlled by using a decoy of the present invention to inhibit NF-κB, a transcriptional regulatory factor that regulates osteoclast differentiation. This method uses a mechanism different from those of previous pharmaceutical agents; therefore, one can expect it to be effective for cases in which existing pharmaceutical agents were not effective.12-18-2008
20080306000Three-Dimensional Structures of TALL-1 and its Cognate Receptors and Modified Proteins and Methods Related Thereto - Disclosed are TALL-1 and TALL-1 receptor protein homologues (agonists and antagonists) designed based on the three-dimensional structure of sTALL-1, eBCMA and eBAFF-R; agonist homologues of APRIL; methods of using wild-type APRIL to inhibit the activity of TALL-1; compositions comprising such homologues, nucleic acid molecules encoding such homologues, and therapeutic methods of using such compounds and compositions. Also disclosed are crystalline complexes of sTALL-1 and sTALL-1 in complex with either BCMA or BAFF-R; models of three-dimensional structures of such crystalline complexes and related structures, methods of drug design using any portion of such structures; methods of design and/or identification of regulatory peptides derived from the such structures; compounds identified by drug design using such structures; and the use of such compounds in therapeutic compositions and methods.12-11-2008
20080293627Thyrotropin Receptor Preparations, Binding Regions Thereof, Antibody and Hormone Interactions Therewith, and Uses Thereof - A mutated TSHR preparation which includes at least one point mutation characterised in that at least amino acid Arg at a position corresponding to amino acid 255 of a full length human TSHR has been mutated to a different amino acid residue in said mutated TSHR preparation, whereby said mutated TSHR preparation differentially interacts with patient serum stimulating TSHR autoantibodies, patient serum blocking TSHR autoantibodies and TSH, in that (i) the stimulatory effect of patient serum stimulating TSHR autoantibodies interacting with the mutated TSHR preparation is substantially reduced or essentially abolished, when compared to the stimulatory effect of the patient serum stimulating TSHR autoantibodies interacting with a reference TSHR preparation which has an amino acid sequence corresponding to that of said mutated TSHR preparation with the exception that said mutation of Arg at a position corresponding to amino acid 255 of a full length human TSHR is not present in said reference TSHR preparation, (ii) the stimulatory effect of TSH when interacting with the mutated TSHR preparation is essentially unaffected, when compared to the stimulatory effect of TSH interacting with said reference TSHR preparation, and (iii) the blocking effect of patient serum blocking TSHR autoantibodies interacting with the mutated TSHR preparation is essentially unaffected or increased, when compared to the blocking effect of the patient serum blocking TSHR autoantibodies interacting with said reference TSHR preparation, whereby said mutated TSHR preparation is effective in the differential screening and identification of patient serum stimulating TSHR autoantibodies, patient serum blocking TSHR autoantibodies and TSH in a sample of body fluid being screened.11-27-2008
20080274973 NOVEL HAEMOPOIETIN RECEPTOR AND GENETIC SEQUENCES ENCODING SAME - The present invention relates generally to a novel haemopoietin receptor or components or parts thereof and to genetic sequences encoding same. The receptor molecules and their components and/or parts and the genetic sequences encoding same of the present invention are useful in the development of a wide range of agonists, antagonists, therapeutics and diagnostic reagents based on ligand interaction with its receptor.11-06-2008
20080221030Inhibition of Wet Type Age Related Macular Degeneration (Amd) by Adiponectin or Acrp 30 - The present invention provides new methods of treating wet type of age related macular degeneration by administering adiponectin (APN) or a functional fragment derived therefrom. One of the pathological complications of age related macular degeneration (AMD) is choroidal angiogenesis or choroidal neovascularization (CNV). The inventors discovered that the level of APN expression is significantly lower in the choroids of the laser-induced mouse model of choroidal angiogenesis or choroidal neovascularization (CNV) than that of the control mice and that administration of recombinant adiponectin (rAPN) or a peptide derived from the globular domain of the intact APN protein to the mouse model of CNV reduced the size of CNV significantly. These studies are the first to demonstrate the inhibitory effect of adiponectin on choroidal angiogenesis and thus provide the basis for treating a condition or disease involving angiogenesis, particularly age related macular degeneration, with administration of adiponectin.09-11-2008
20100144613Combined use of DPP-IV Inhibitors and Gastrin Compounds - The invention relates to compositions, conjugates, and methods for the prevention and/or treatment of a condition and/or disease comprising a therapeutically effective amount of a DPP-IV inhibitor and a gastrin compound. The combination of a DPP-IV inhibitor and a gastrin compound provides beneficial effects, in particular sustained beneficial effects, in the prevention and/or treatment of conditions and/or diseases for which either a DPP-IV inhibitor or a gastrin compound have been demonstrated to have a therapeutic effect, including but not limited to diabetes, hypertension, chronic heart failure, fluid retentive states, obesity, metabolic syndrome and related diseases and disorders. Combinations of a DPP-IV inhibitor and a gastrin compound can be selected to provide unexpectedly additive effects or synergistic effects.06-10-2010
20080221024Analogs of Shk Toxin and Their Uses in Selective Inhibittion of Kv1. 3 Potassium Channels - Analogs of ShK toxin and methods for using such ShK analogs. The ShK analogs generally comprise ShK toxin attached to a chemical entity (e.g. an atom, molecule, group, residue, compound, moiety, etc.) that has an anionic charge. In some embodiments the chemical entity attached to the ShK toxin may comprise an amino acid residue. The ShK analogs may be administered to human or non-human animal subjects to cause inhibition of potassium channels or to otherwise treat diseases or disorders. In some embodiments, the chemical entity to which the ShK toxin is attached may be chosen to provide selective inhibition of certain potassium channels (e.g., Kv1.3 channels) over other potassium channels (e.g., Kv1.1 channels). In come embodiments, the chemical entity to which the ShK toxin is attached may include a fluorophore, thereby providing a fluorophore tagged ShK analog. Such fluorophore tagged ShK analogs may be used in flow cytometry alone, or in conjunction with class II tetramers that can detect autoreactive cells.09-11-2008
20090286721TARGETED PLASMINOGEN ACTIVATOR FUSION PROTEINS AS THROMOBOLYTIC AGENTS - This invention relates to novel fusion proteins, comprising a targeting protein and a plasminogen activator, preferably an antibody that binds to P-selectin, operably linked to the plasminogen activator DSPAalpha1, or analogs, fragments, derivatives, or variants thereof, which are useful as thrombolytic agents. Pharmaceutical compositions containing these fusion proteins, methods of using these fusion proteins as thrombolytic agents, and processes for synthesizing these fusion proteins are also described herein.11-19-2009
20090264358VEGF RECEPTOR FUSION PROTEINS, THEIR PHARMACEUTICAL COMPOSITIONS AND THERAPEUTIC APPLICATIONS FOR THE EYE DISEASES - Vascular endothelial growth factor (VEGF) receptor fusion protein comprising Ig domain 2 of Flt-1 and Ig domains 3, or Ig domain 2 of Flt-1 and Ig domain 3 and 4 of KDR, the gene encoding the fusion protein, the pharmaceutical composition containing the fusion protein and the pharmaceutical use of the fusion protein are provided. The fusion protein can be used for treatment of eye disorders involving angiogenesis such as diabetic retinopathy.10-22-2009
20080214461FVIII-Independent FIX-Mutant Proteins for Hemophilia A Treatment - The present invention relates to recombinant blood coagulation factor IX (rFIX) mutants having factor VIII (FVIII) independent factor X (FX) activation potential. Five full length FIX proteins with combinations of mutations of amino acids important for functional activity of FIX and FIX wild type were cloned and expressed in HEK 293 cells. The proteins were tested by an activated partial thromboplastin time (aPTT) assay in FVIII-depleted plasma as well as in FVIII-inhibited patient plasma. In FVIII-depleted plasma functional activity of the FIX mutants was calculated as increased FVIII equivalent activity. The mutant proteins had increased FVIII equivalent activity. In FVIII-inhibited patient plasma the FEIBA equivalent activity was calculated for analysis of FVIII independent FX activation potential. The proteins had also increased FEIBA equivalent activity. Furthermore, the pre-activated FIX proteins had an increased activity in FIX-depleted plasma containing FVIII inhibitors. Therefore these FIX mutants are alternatives as bypassing agents for treatment of FVIII inhibitor patients.09-04-2008
20080214467Exendins and Exendin Agonists Modified with Albumin - Novel modified exendins and exendin agonists having an exendin or exendin agonist linked to one or more molecular weight increasing compounds, for example, albumin, polyethylene glycol polymers, and related formulations and dosages and methods of administration thereof are provided. These modified exendins and exendin agonists, compositions and methods are useful in treating diabetes and conditions that would be benefited by lowering plasma glucose or delaying and/or slowing gastric emptying or inhibiting food intake.09-04-2008
20080214464Method for the Production of Biologically Active Rhngf - The present invention relates to a new rhNGF (recombinant human Nerve Growth Factor) where said rhNGF is characterized by the fact that it presents an in vitro and in vivo activity comparable to that of the native murine NGF. The present invention also relates to the process for the production of said rhNGF, said process adapted for production on middle and large scale, and the modified cells capable of producing said rhNGF.09-04-2008
20080214466Method of administering and using VEGF inhibitors for the treatment of human cancer - A method of treating a human patient suffering from cancer, comprising administering an effective amount of a vascular endothelial growth factor (VEGF) trap antagonist to the human patient, the method comprising: (a) administering to the patient an initial dose of at least approximately 0.3 mg/kg of the VEGF antagonist; and (b) administering to the patient a plurality of subsequent doses of the VEGF antagonist in an amount that is approximately the same or less of the initial dose, wherein the subsequent doses are separated in time from each other by at least one day. The methods of the invention are useful for treating a human cancer selected from the group consisting of renal cell carcinoma, pancreatic carcinoma, breast cancer, prostate cancer, colorectal cancer, malignant mesothelioma, multiple myeloma, ovarian cancer, and melanoma. The invention is further useful for treating a condition which benefits from the reduction of VEGFA and placental growth factor (PLGF).09-04-2008
20080214457TREATMENT OF PATIENTS WITH DYSFUNCTIONAL PROTEIN CHANNELS - Isolated peptides and polynucleotides are provided that can be used to treat a subject that has a genetic predisposition to, or has been diagnosed as having, a cardiac disorder related to dysfunctional sodium channels. Also provided are methods of treatment, as well as methods of predicting the occurrence of a cardiac event or the severity or prognosis of cardiac symptoms, in a subject that has either been diagnosed as having, or is suspected of developing, a sodium channel related cardiac disorder, by testing the subject for the presence of H558R-polymorphism on the subject's SCN5A gene.09-04-2008
20080214463METHOD FOR CELL ADHESION AND WOUND HEALING - The present invention relates to a method for cell adhesion and wound healing with internal domains of βig-h3. Particularly, the present invention relates to the method of using recombinant proteins comprising one or more of 209-04-2008
20080214451G Protein Coupled Receptor Agonists and Antagonists and Methods of Use - The invention relates generally to G protein coupled receptors (GPCRs) and in particular to GPCR agonists and antagonists, use of these compounds and their pharmaceutical compositions, e.g., in the treatment, modulation and/or prevention of physiological conditions associated with GPCRs, such as in treating conditions in which chemokine receptors play a role, e.g., sepsis, arthritis, inflammation and autoimmune diseases.09-04-2008
20080214459Pharmaceutical composition containing sFcyRIIb - The present invention concerns pharmaceutical compositions containing one of the receptors FcγR IIa, FcγR IIb or FcγR III in a recombinantly produced, soluble form and their use to treat diseases or conditions which are caused by overshooting immune reactions and a pathologically increased formation of antibodies, in particular of autoantibodies. Multiple sclerosis, systemic lupus erythematosus and rheumatoid arthritis are particularly important fields of application.09-04-2008
20080214454Use of HMGB fragments as anti-inflammatory agents - Compositions and methods are disclosed for inhibiting the release of a proinflammatory cytokine from a vertebrate cell, and for inhibiting an inflammatory cytokine cascade in a patient. The compositions comprise a vertebrate HMGB A box, and an antibody preparation that specifically binds to a vertebrate HMGB B box. The methods comprise treating a cell or a patient with sufficient amounts of the composition to inhibit the release of the proinflammatory cytokine, or to inhibit the inflammatory cytokine cascade.09-04-2008
20080214449Use of Antagonists of the Cbi Receptor For the Manufacture of a Composition Useful For the Treatment of Hepatic Diseases - The invention relates to the use of antagonists to the CB1 receptor for the preparation of a composition for the treatment of hepatic diseases and preferably to the use of N-piperidino-5-(4-chlorophenyl)-1-(2,4-dichlorophenyl)-4-methylpyrazole-3-carboxamide.09-04-2008
20080214450Polypeptides having antimicrobial activity and polynucleotides encoding same - The present invention relates to isolated polypeptides having antimicrobial activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.09-04-2008
20080214448Compounds, Methods and Formulations for the Oral Delivery of a Glucagon-Like Peptide (Glp)-1 Compound or a Melanocortin-4 Receptor (Mc4) Agonist Peptide - The present invention relates to novel compounds, methods, and formulations useful for the oral delivery of a GLP-1 compound or an MC4 agonist peptide.09-04-2008
20090312253Methods of effecting Wnt signaling through Dkk structural analysis - Compositions and methods related to Wnt signaling regulation by Dickkopf (Dkk) polypeptides and Wnt-related diseases are disclosed. For example, compounds that bind a Dkk or LRP polypeptide are disclosed. Compounds that disrupt binding of a Dkk polypeptide to an LRP polypeptide are also disclosed. Methods for using the described compounds and compositions are also disclosed.12-17-2009
20080255050METHOD OF TREATING ATHEROSCLEROSIS - A method of treating atherosclerosis in a subject is carried out by administering the subject 2-aminopurine or a pharmaceutically salt thereof in a treatment effective amount. Optionally, the subject may also be administered an additional hypolipidemic agent. Compositions useful for carrying out the present invention are also described.10-16-2008
20080255046Y2 Selective Receptor Agonists for Therapeutic Interventions - The modified human PP peptides (i) [Lys4,Leu17,Ser30,Gln34]hPP, (ii) Lys4,Leu17,Thr30,Gln34]hPP; and (iii) [Lys4,Leu17,oxidised Met30,Gln34]hPP wherein “oxidised Met” may be the sulfoxide or sulfone, and certain analogues and derivativatised forms thereof as referred to in the specification, are selective agonists of the Y2 receptor relative to the Y1 and Y4 receptors, and are useful for, for example, appetite control and therapeutic angiogenesis.10-16-2008
20080255049COMBINED USE OF ULTRASOUND AND GROWTH FACTORS TO STIMULATE BONE FORMATION - The combination of low intensity pulsed ultrasound with administration of an osteogenic protein or proteins or their genes enhances bone repair in mammals. This combination avoids thermal activation of tissue repair mechanisms and allows the osteogenic protein or proteins or their genes to act at the site of bone fracture or lowered bone density to enhance or accelerate bone formation, thereby improving the prognosis of a patient. The combination may be used to treat fractures, to prevent or treat osteoporosis, to improve outcomes for bone replacement and to prevent or treat bone loss due to other physiologic disorders.10-16-2008
20080255047Method of Treating Acute Renal Failure with Thrombomobulin Variant - The present invention provides a method for preventing and/or treating subjects with acute renal failure caused by a variety of conditions. The method comprises administering to the subject soluble thrombomodulin. In conjunction with standard of care, soluble thrombomodulin will reduce tissue injury and subsequent morbidity and mortality.10-16-2008
20090069232GLYCOSYLATION OF MOLECULES - Described herein are methods and genetically engineered cells useful for producing an altered N-glycosylation form of a target molecule. Also described are methods and molecules with altered N-glycosylation useful for treating a variety of disorders such as metabolic disorders.03-12-2009
20100210547METHOD FOR THE PRODUCTION OF CONJUGATES OF INSULIN-LIKE GROWTH FACTOR-1 AND POLY(ETHYLENE GLYCOL) - The present invention relates to a fusion protein comprising IGF-I or an IGF-I variant N-terminally linked to the C-terminus of a propeptide. The invention relates also to a method involving the use of the aforementioned fusion protein in the production of a lysine-PEGylated IGF-I or IGF-I variant. The method comprises the steps of cultivating a prokaryotic host cell comprising an expression vector containing a nucleic acid encoding the fusion protein and causing the cell to express the fusion protein, recovering and PEGylating said fusion protein, cleaving said PEGylated fusion protein with IgA protease, and recovering lysine-PEGylated IGF-I or IGF-I variant. The invention relates also to a lysine-PEGylated IGF-I or IGF-I variant produced using the above method. In addition, the invention relates to a method for treating a neurodegenerative disorders like Alzheimer's Disease using the lysine-PEGylated IGF-I or IGF-I variant and a composition comprising the lysine-PEGylated IGF-I or IGF-I variant.08-19-2010
20100029559Method for achieving desired glial growth factor 2 plasma levels - The present invention relates to administering glial growth factor 2 (GGF2) to a patient in need thereof, to achieve serum levels of GGF2 within a desired therapeutic window determined based on the disease or disorder afflicting the patient. In a particular embodiment, the patient is suffering from a disease or disorder associated with reduced levels of myelination and the GGF2 is administered to promote myelination in the patient.02-04-2010
20100179096METHODS OF TREATING FIBROSING DISEASES BY INDUCTION OF IMMUNE TOLERANCE - The present invention has demonstrated for the first time that orally administered type I collagen (CI) induced tolerance to CI in patients suffering from systemic sclerosis (SSc) and ameliorated clinical manifestations of the disease. Accordingly, the present invention provides methods of treating a fibrosing disease by oral administration of a tissue protein, for example, collagen, derived from the tissue undergoing fibrosis.07-15-2010
20100168026INSULIN SECRETION INDUCER, AND ACCELERATOR FOR INCREASING THE NUMBER OF PANCREATIC BETA-CELLS - Disclosed are: an insulin secretion inducer; an insulin secretion-inducing composition; a process for the production of the composition; an accelerator for increasing the number of pancreatic β-cells; a composition for increasing the number of pancreatic β-cells; a process for the production of the composition; and a viral vector for gene therapy. The insulin secretion inducer or the accelerator for increasing the number of pancreatic β-cells comprises a polypeptide having an amino acid sequence encoded by DNA that is known to encode a membrane protein Tm4sf20 (transmembrane 4 L six family member 20) or the like or a fragment of the polypeptide as an active ingredient.07-01-2010
20100168009PHa1B TOXIN, cDNA of Pha1B TOXIN GENE, PHARMACEUTICAL COMPOSITION CONTAINING PHa1B TOXIN, PROCESS AND PRODUCT - Methods and compositions for blocking calcium channels with a spider toxin from 07-01-2010
20100168015PEPTIDES WITH CAPACITY FOR BINDING WITH INTERLEUKINE 10 (IL-10) - The invention relates to peptides having the capacity to bind to interleukin-10 (IL-10) and their use in the treatment of clinical conditions or pathological disorders associated to IL-10 expression, particularly to a high IL-10 expression, for example, infectious diseases, tumors, cancers and acute damage conditions.07-01-2010
20100168011Pharmaceutical Formulations and Methods for Making the Same - In certain embodiments, the invention relates to pre-lyophilization formulations, lyophilized compositions, reconstituted formulations, kits comprising the same, and methods for preparing, storing and using the same.07-01-2010
20100168004METHODS AND COMPOSITIONS FOR THE SYNERGISTIC ACTIVATION OF LATENT HIV - The present invention provides methods and compositions useful for the elimination of latent HIV reservoirs that persist despite HAART. The methods and compositions overcome this latent barrier by inducing the replication of HIV in latently infected T cells while preventing the spread of the newly produced virions to uninfected cells by providing HAART simultaneously. Compositions of the invention comprise an activator of latent HIV expression, such as prostratin, and an inhibitor of histone deacetylase, such as TSA. A surprising finding of this invention is that the inhibitor of the histone deacetylase synergizes the effect of prostratin thus, allowing administering to a patient a lower, non-toxic dose of prostratin.07-01-2010
20100204121DIETARY SUPPLEMENTS CONTAINING TERPENOID ACIDS OF MASLINIC ACID OR OLEANOLIC ACID AND PROCESS FOR ENHANCING MUSCLE MASS IN MAMMALS - A process for increasing lean body mass in a mammalian subject is provided that includes administering to the subject a purified quantity of maslinic acid, oleanolic acid, or a combination thereof. The administration can be orally and benefits from ingestion of an amino acid source such as dietary protein, oligopeptides, or amino acids. Administration within 2 hours of muscle-degrading exercise or on a daily basis for a period of time increases lean body mass.08-12-2010
20100210551Novel Bacillus Thuringiensis Crystal Polypeptides, Polynucleotides, and Compositions Thereof - The present invention provides insecticidal polypeptides related to 08-19-2010
20100120688ErbB Interface Peptidomimetics And Methods Of Use Thereof - Peptides, mimetics and antibodies of erbB, TNF, and IgSF receptors and pharmaceutical compositions comprising the same are described. Methods of using such antibodies, peptides, and mimetics in therapeutic, prophylactic, imaging and diagnostic applications are disclosed.05-13-2010
20090298758THYMOSIN BETA 4 DERIVATIVES AND USE THEREOF - The present invention relates to thymosin β4 (Tβ4) derivatives, Gly-Tβ4 and Ala-Tβ4. The present invention further relates to a pharmaceutical composition comprising the said Tβ4 derivatives. The present invention also relates to the use of said Tβ4 derivatives in manufacture of a medicament for treatment of skin lesion, heart injury, corneal lesion and/or coronary heart disease. The present invention further relates to a method of treatment for skin lesion, heart injury, corneal lesion and/or coronary heart disease by using the said Tβ4 derivatives.12-03-2009
20090176704Exendin Agonist Analogs to Treat Diabetes - Methods for treating conditions or disorders which can be alleviated by reducing food intake are disclosed which comprise administration of an effective amount of an exendin or an exendin agonist, alone or in conjunction with other compounds or compositions that affect satiety. The methods are useful for treating conditions or disorders, including obesity, Type II diabetes, eating disorders, and insulin-resistance syndrome. The methods are also useful for lowering the plasma glucose level, lowering the plasma lipid level, reducing the cardiac risk, reducing the appetite, and reducing the weight of subjects. Pharmaceutical compositions for use in the methods of the invention are also disclosed.07-09-2009
20090176709PROCESS FOR OBTAINING A CONCENTRATE OF VON WILLEBRAND FACTOR OR A COMPLEX OF FACTOR VIII/VON WILLEBRAND FACTOR AND USE OF THE SAME - The process is characterised by the preparation of a solution of Von Willebrand Factor or a complex of Factor VIII/Von Willebrand Factor which contains VWF and a concentration of up to 12 IU VWF:RCo/ml and a Von Willebrand Factor/Factor VIII ratio of 0.4 or more; and then proceeding with nanofiltration of the solution prepared in a) through a filter having a pore size of less than 35 nanometres.07-09-2009
20090176705MODULAR PLATFORM FOR TARGETED THERAPEUTIC DELIVERY - Pharmaceutical compounds, pharmaceutical compositions and methods of treatment are disclosed, wherein a compound comprises a targeting moiety which, in free form, binds a cell receptor with a dissociation constant K07-09-2009
20090176703NEUROPEPTIDES FOR AQUATIC ORGANISMS CULTURE - The present invention is related to the use of variants of the Pituitary Adenylate Cyclase-Activating Polypeptide (PACAP) to stimulate the growth and to improve the immunological system of aquatic organisms. The variants of the peptide were provided by immersion, injection or as a food additive.07-09-2009
20090176701Anti-microbial agents that interact with the complement system - Anti-microbial therapeutic agents that act via a novel method to treat infection are compounds which may comprise a peptide with natural or non-natural amino acids, or a small molecule. The agent can bind to the surface of a microorganism and productively fix complement in order to cause lysis of the microorganism via the assembly of a membrane attack complex, thereby triggering removal of the microbe by phagocytosis. The agents may be fragments of TFPI e.g. from the C-terminus region.07-09-2009
20090176700Derivatives Of GLP-1 Analogs - The present invention relates to a pharmaceutical composition comprising a GLP-1 derivative having a lipophilic substituent; and a surfactant.07-09-2009
20090176699Inhibitors Based on Fusion, Hr1 and Hr2 Sequences in Bacterial Adhesin - A known surface adhesin (NadA) in 07-09-2009
20090286730REMEDIES FOR ISCHEMIA - The present invention relates to uses and methods of parathyroid hormone (PTH), preferably PTH (1-34), and/or parathyroid hormone-related peptide (PTHrP), preferably PTHrP (1-34), for recruiting stem cells into tissue suffering from ischemia, wherein said stem cells are preferably capable of repairing and/or regenerating said tissue suffering from ischemia. Accordingly, the uses and methods of the present invention are preferably suitable for the prevention and/or treatment of ischemia. Moreover, the present invention relates to a composition comprising parathyroid hormone (PTH), preferably PTH (1-34), and/or parathyroid hormone-related peptide (PTHrP), preferably PTHrP (1-34), and/or G-CSF or a G-CSF fragment for use as a pharmaceutical composition. In a particular aspect, a DPP IV antagonist is applied in the uses, methods and/or compositions of the present invention.11-19-2009
20090281027MODIFIED VITAMIN K-DEPENDENT POLYPEPTIDES - The invention provides vitamin K-dependent polypeptides with enhanced membrane binding affinity. These polypeptides can be used to modulate clot formation in mammals. Methods of modulating clot formation in mammals are also described.11-12-2009
20090258826Pituitary adenylate cyclase activating peptide (PACAP) receptor (VPAC2) agonists and their pharmacological methods of use - This invention provides novel peptides that function in vivo as agonists of the VPAC2 receptor. These insulin secretagogue polypeptides are shown to lower blood glucose in vivo more than controls upon glucose challenge. The polypeptides of this invention are also stable in formulation and have long half-lives. The peptides of the present invention provide a new therapy for patients with decreased endogenous insulin secretion, in particular type 2 diabetics. In particular, the invention is a polypeptide selected from a specific group of VPAC2-related polypeptides, or functional equivalents thereof. The invention is also directed to a method of treating a metabolic disease in a mammal comprising administering a therapeutically effective amount of the insulin secretagogue peptides to said mammal. Also disclosed are methods of making the peptides, both recombinant and synthetic.10-15-2009
20100190714RNAi Inhibition of Alpha-ENaC Expression - The invention relates to compositions and methods for modulating the expression of alpha-ENaC, and more particularly to the downregulation of alpha-ENaC expression by chemically modified oligonucleotides.07-29-2010
20100190707Novel Bacillus Thuringiensis Gene with Lepidopteran Activity - The invention provides nucleic acids, and variants and fragments thereof, obtained from strains of 07-29-2010
20100190704STRUCTURE COMPRISING CHITOSAN AND COLLAGEN - It is an object of the present invention to provide a structure comprised of a mixture of chitosan and collagen, which achieves both degradability and tissue adhesiveness. The present invention provides a structure comprised of a mixture of chitosan and collagen, wherein (i) the deacetylation degree of chitosan is 50% to 70%, (ii) the weight ratio of chitosan and collagen is 30/70 or more and less than 70/30.07-29-2010
20100190703PEPTIDES SPECIFIC FOR HUMAN BLOOD OUTGROWTH ENDOTHELIAL CELLS - Provided herein are compositions and methods for binding outgrowth endothelial cells (OEC). The compositions consist of peptide ligands capable of binding OEC with high affinity and specificity. The compositions of the invention include peptides set forth in SEQ ID NO: 1-38 and variants and derivatives thereof. Compositions also include the nucleotide sequences encoding the peptides of the invention. The compositions find use in methods for the isolation of OEC and for the recruitment and retention of OEC to sites of therapeutic interest. Methods for the identification and isolation of other peptides capable of binding OEC are also provided.07-29-2010
20100190700METHODS AND COMPOSITIONS FOR TREATING HYPOGLYCEMIC DISORDERS - This invention relates to methods of treating and ameliorating congenital and neonatal hyperinsulinism and post-prandial hypoglycemia, comprising the step of administering an antagonist of the Glucagon-Like Peptide-1 (GLP-I) receptor, e.g. a GLP-I fragment or analogue thereof.07-29-2010
20100081620PRODOMAIN MODULATORS OF ADAM 10 - The presently disclosed subject matter discloses isolated ADAM 10 modulating peptides and related compounds useful for studying the biological functions of ADAM 10 and for the treatment of diseases such as cancer, neurological disorders, asthma, and allergic responses, and disorders characterized at least in part by the presence of one or more of inflammation, excess cell proliferation, angiogenesis, and excess soluble CD23. In one aspect, the presently disclosed subject matter provides isolated mouse and human ADAM 10 prodomain comprising the sequence set forth in SEQ ID NOs 1-8, or a sequence having at least 95% homology to any of SEQ ID NOs 1-8 and having the functionality of modulating ADAM 10 activity.04-01-2010
20100029560COMPOSITIONS AND METHODS FOR DIAGNOSING, TREATING, AND PREVENTING PROSTATE CONDITIONS - Disclosed are compositions and methods for diagnosing, preventing, and treating prostate cancer and prostate intraepithelial neoplasia (PIN).02-04-2010
20100029555G-CSF SITE-SPECIFIC MONO-CONJUGATES - Novel site-specific mono-conjugates of Granulocyte Colony Stimulating Factor (G-CSF) are hereby described, with analogues and derivatives thereof, which stimulate proliferation and differentiation of progenitor cells to mature neutrophiles. These conjugates have been obtained using transglutaminase to covalently and site-specifically bind a hydrophilic, non-immunogenic polymer to a single glutamine residue of the human G-CSF native sequence and analogues thereof. These novel site-specific mono-conjugated derivatives are recommended for therapeutic use since they are stable in solution and exhibit significant biological activity in vitro and a longer bloodstream half-life, as compared to the non-conjugated protein, with a consequent prolonged pharmacological activity.02-04-2010
20100029552Peptide inhibitors of c-jun dimerization and uses thereof - The present invention provides a method for the screening of nucleic acid fragment expression libraries and selecting encoded peptides based upon their ability to modulate the activity of a target protein or nucleic acid and assume conserved conformations compatible with albeit not reiterative of the target protein or nucleic acid. The present invention also provides methods for the diagnosis and treatment of ischemia. The present invention also provides c-Jun dimerization inhibitory peptides and analogues thereof that are useful for treatment of ischemia.02-04-2010
20100029568TIGHTER-BINDING C-PEPTIDE INHIBITORS OF HIV-1 ENTRY - The invention provides compositions and methods for the treatment of HIV infection, inhibition against drug-resistant strains of HIV-1 and methods of enhancing the anti-HIV potency of peptide inhibitors against drug-resistant strains of HIV-1. In particular, oligomeric C-peptide inhibitors for inhibiting HIV entry into host cells are disclosed.02-04-2010
20100029569Pharmaceutical Formulation - The invention relates to aqueous pharmaceutical formulations comprising human growth hormone, histidine, poloxamer, phenol, and mannitol.02-04-2010
20100029567METHOD OF CORRECTING IMBALANCE BETWEEN BONE RESORPTION AND BONE FORMATION AND KITS AND COMPOSITIONS THEREFOR - Compounds, methods, uses, compositions, kits and packages for the treatment of imbalance between bone resorption and bone formation, based on uses of 4-phenyl-2 propionamidotetralin (4-P-PDOT) and analogs, derivatives, prodrugs, precursors thereof, and salts thereof, are described.02-04-2010
20100029566USE OF AT LEAST ONE BOTULINUM NEUROTOXIN FOR TREATING THE PAIN INDUCED BY THERAPEUTIC TREATMENTS FOR THE AIDS VIRUS - The present invention relates to the use of at least one botulinum neurotoxin for the production of a medicament for treating or preventing pain induced by a medicament used for treating the AIDS virus.02-04-2010
20100029565RECOMBINANT B. pseudomallei ADHESIN PROTEIN AND METHODS AND USES THEREOF - Isolated and/or recombinant adhesin polypeptides from 02-04-2010
20100029562hG31P Expression System - Expression plasmids and expression systems for the expression of human G31P02-04-2010
20100029561AMELIORATING AGENT FOR INSULIN RESISTANCE - The present invention provides an insulin sensitizer and a prophylactic/therapeutic agent for diseases involved by sugar metabolic abnormality, comprising a substance that inhibits the expression or activity of CPSF5 protein and/or a substance that inhibits the expression or activity of CPSF6 protein. Provided as the substances are (a) an antisense nucleic acid against a nucleic acid that encodes CPSF5 (or CPSF6), (b) an siRNA against an RNA that encodes CPSF5 (or CPSF6), (c) a nucleic acid capable of producing an siRNA against an RNA that encodes CPSF5 (or CPSF6), and the like. Also provided is a screening method for an insulin resistance ameliorating substance using a cell that produces CPSF5 and/or CPSF6.02-04-2010
20100029558Alpha1 proteinase inhibitor peptides methods and use - The invention is directed to the use of peptides that can bind and block the interaction of α1 proteinase inhibitor (α02-04-2010
20100029556Stable composition comprising a bone anabolic protein, namely a pthrp analogue, and uses thereof - The present invention provides a storage-stable composition containing a parathyroid hormone-related protein (PTHrP) analogue and methods of using a PTHrP analogue and the PTHrP compositions described herein to treat osteoporosis, to increase bone mass or to increase bone quality. The composition is storage stable, in sterile form, and in general may be stored at room temperature for at least several weeks to allow convenient parenteral administration to human patients.02-04-2010
20100029554Composition and Methods for Treatment of Congestive Heart Failure - Provided herein is the use of GLP-1 molecules or agonists and analogs thereof, and the use of exendin molecules or agonists and analogs thereof, including their derivatives and active fragments, for the prevention or treatment of congestive heart failure. Pharmaceutical compositions for use in the methods described herein are also disclosed. Further provided are compositions and methods for the treatment and/or prevention of diabetes mellitus, hyperglycemia, insulin resistance and obesity, and for the reduction of food intake and suppression of appetite of subjects.02-04-2010
20100029553Microfluidic Device for Controlled Aggregation of Spider Silk - The present invention is directed to a device and method of controlling the phase separation of one or a mixture of two or more spider silk proteins, leading to the defined and controllable assembly of the said silk protein(s) to defined morphologies, such as spheres, nano fibrils, threads, etc.02-04-2010
20100022454Peptides with High Affinity for the Prolactin Receptor - The present invention is concerned with peptides binding to the prolactin receptor, wherein said peptides have an improved binding via binding site 1 (BS1) to the prolactin receptor. In one embodiment, said improved binding is achieved by mutation of positions 61, 71 and 73.01-28-2010
20100022455THERAPEUTIC AGENTS COMPRISING ELASTIN-LIKE PEPTIDES - The present invention provides therapeutic agents and compositions comprising elastin-like peptides (ELPs) and therapeutic proteins. In some embodiments, the therapeutic protein is a GLP-1 receptor agonist, insulin, or Factor VII/VIIa, including functional analogs. The present invention further provides encoding polynucleotides, as well as methods of making and using the therapeutic agents. The therapeutic agents have improvements in relation to their use as therapeutics, including, inter alia, one or more of half-life, clearance and/or persistance in the body, solubility, and bioavailability.01-28-2010
20100022453NoGo Receptor 1 and Fibroblast Growth Factor Interactions - Compositions and methods useful in promoting neuronal growth, synaptic transmission, or neuronal regeneration are described, including, for example, a polypeptide comprising a fragment of NgR1, wherein the NgR1 fragment has reduced FGF2 binding as compared to wild-type NgR1. Also described are chimeric polypeptides comprising the NgR1 fragment and compositions comprising the fragment or chimeric polypeptide. Nucleic acids, vectors and expression systems are also described which encode the fragments and polypeptides. These compositions can be used in combination with FGF2 to promote neurite outgrowth or neuronal regeneration and can be used to treat central nervous systems diseases and disorders.01-28-2010
20100022456Dimeric Prolactin Receptor Ligands - The patent application relates to antagonistic dimers of prolactin molecules and their use in treating cancer.01-28-2010
20100022452Nanobodies for the treatment of aggregation-mediated disorders - The present invention relates to improved Nanobodies™ against von Willebrand Factor (vWF), as well as to polypeptides comprising or essentially consisting of one or more of such Nanobodies. The invention also relates to nucleic acids encoding such Nanobodies and polypeptides; to methods for preparing such Nanobodies and polypeptides; to host cells expressing or capable of expressing such Nanobodies or polypeptides; to compositions comprising such Nanobodies, polypeptides, nucleic acids or host cells; and to uses of such Nanobodies, such polypeptides, such nucleic acids, such host cells or such compositions, in particular for prophylactic, therapeutic or diagnostic purposes, such as the prophylactic, therapeutic or diagnostic purposes.01-28-2010
20090203607Method And Compositions For Simultaneously Regulating Memory And Mood - The present invention is concerned with methods and compositions for simultaneously treating or modulating memory and mood within the same individual.08-13-2009
20100168028COMPOSITIONS AND METHODS OF USING CRMP-1 AND ITS FRAGMENTS FOR TREATING CANCER - Active fragments of hcrmp1 that are capable of inhibiting cell proliferation, invasive activity, and metastasis of cancer and methods of using the same for treating cancer are disclosed. The method can also be used prior to, or in combination with, the administration a chemotherapy agent. Vectors capable of expressing an hcrmp1, variants of hcrmp1, fragments of hcrmp1 and/or variants of fragments of hcrmp1 are also disclosed.07-01-2010
20100190713USE OF THE PEPTIDE THYMOSIN BETA 4 ALONE OR IN COMBINATION WITH CECROPIN A AS A THERAPEUTIC AGENT - The present invention is directed to the use of the peptide compound Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH or its combination with the peptide Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys as a therapeutic agent for the prophylaxis and/or treatment of cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurodegenerative diseases, infectious diseases, lung diseases, heart and vascular diseases and metabolic diseases. Moreover the present invention relates to pharmaceutical compositions preferably in form of a lyophilisate or liquide buffer solution or artificial mother milk formulation or mother milk substitute containing the peptide Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH or its combination optionally together with at least one pharmaceutically acceptable carrier, cryoprotectant, lyoprotectant, excipient and/or diluent.07-29-2010
20100197584USE OF CURCUMIN TO BLOCK BRAIN TUMOR FORMATION IN MICE - The present invention provides compositions and methods of using curcumin or curcumin derivatives or analogs to activate the pro-apoptotic enzymes caspase-3/7 in cancer cells. The present invention also provides formulations of curcumin or derivatives or analogs with increased solubility or improved bioavailability. The formulations may be administered to a subject such that high concentrations of therapeutically effective curcumin compounds resuit in the subject's bloodstream. The invention thus involves the use of curcumin or curcumin derivatives or analogs to diminish cancer cell growth, decrease tumor size, prevent tumor formation, and Curcumin Carrier to reduce or prevent cancer or tumor cell invasion or metastasis into a tissue, e.g., into the nervous System and especially the brain, of a subject. The instant invention may be used prophylactically to prevent tumor formation or metastasis, as a monotherapy to treat existing tumors, after surgery to prevent recurrence of tumors or in conjunction with conventional cancer therapies to improve patient prognosis and reduce side-effects.08-05-2010
20090203602Compositions and methods for diagnosis and treatment of type 2 diabetes - The present invention relates generally to the identification of biological markers associated with an increased risk of developing Diabetes, as well as methods of using such biological markers in diagnosis and prognosis of Diabetes. The biological markers of the invention may indicate new targets for therapy or constitute new therapeutics for the treatment or prevention of Diabetes.08-13-2009
20100179094BISPECIFIC EGFR/IGFIR BINDING MOLECULES - The present invention relates to bispecific molecules comprising an EGFR binding domain and a distinct IGFIR binding domain for use in diagnostic, research and therapeutic applications. The invention further relates to cells comprising such proteins, polynucleotide encoding such proteins or fragments thereof, and vectors comprising the polynucleotides encoding the innovative proteins. Exemplary bispecific molecules include antibody-like protein dimers based on the tenth fibronectin type III domain.07-15-2010
20090111742Use of fgf-21 and thiazolidinedione for treating type 2 diabetes - A method for treating type 2 diabetes and metabolic syndrome comprising administering an effective amount of fibroblast growth factor 21 in combination with a thiazolidinedione.04-30-2009
20090286732COMPOUNDS FOR DELIVERY OF THERAPEUTIC AND IMAGING MOIETIES TO NERVE CELLS - The invention features compounds of the general formula:11-19-2009
20090018065Plant PR-5 proteins as mammalian therapeutic agents - The Proteins of the PR-5 family having a lectin-like P barrel domain control apoptosis in yeast through receptor binding. Receptors that specifically bind to PR-5 proteins having a lectin-like P barrel domain have been found to be homologous to mammalian adiponectin receptors, and such PR-5 proteins can act as functional homologues of adiponectin and control adiponectin response in mammals. PR-5 proteins having a lectin-like β barrel domain, for example osmotin, can be used in the treatment of conditions in mammals which are the result of activation or inhibition of adiponectin receptor-mediated metaboloic pathways. PR-5 proteins having a lectin-like β barrel domain, nucleic acids encoding such proteins, and receptors that specifically bind such proteins, can also be used in screening and rational design of new therapeutic agents for use in mammals.01-15-2009
20090124542METHODS AND REAGENTS FOR TREATMENT AND DIAGNOSIS OF AGE-RELATED MACULAR DEGENERATION - The invention relates to Factor H gene polymorphisms and haplotypes associated with an elevated or a reduced risk of AMD. The invention provides methods and reagents for diagnosis and treatment of AMD.05-14-2009
20100173841Highly Purified Type A Botulinum Toxin Preparation From Infant Botulism Pathogen - A novel type A 07-08-2010
20080293635Angiogenic composition - The present invention relates to a amphiphilic polymer in the preparation of a therapeutic composition for promoting angiogenesis at its site of administration, comprising a complex between a polymer and a PDGF, wherein the polymer is amphiphilic.11-27-2008
20080269123Methods for treating polycystic kidney disease (PKD) or other cyst forming diseases - The present invention is directed to methods of treating or ameliorating an effect of a polycystic disease. More particularly, the methods include administering to a patient in need thereof an amount of a modulator of a tumor necrosis factor (TNF) pathway, which is sufficient to treat or ameliorate an effect of a polycystic disease. Methods of treating or ameliorating an effect of a polycystic kidney disease (PKD) are also provided. Methods are also provided for identifying a candidate compound that may be effective to treat or ameliorate an effect of a polycystic disease or to increase polycystin-2 (PC2) function or decrease Rab11-Family of Interacting Protein2 (FIP2) function. Further provided are methods for identifying a patient having, or who is at risk for developing, a polycystic disease or who would benefit from treatment with a TNF-alpha inhibitor.10-30-2008
20090221496 NOVEL ANTITHROMBOTIC AGENT - The present invention provides: a pharmaceutical composition comprising an albumin conjugated with polyethylene glycol; and a method of treating a human thrombosis or a human ischemic disease, comprising intravenously administering an albumin conjugated with polyethylene glycol to a patient.09-03-2009
20100261651Purification and Use of a Factor for Supporting Wound Healing - A process for manufacturing of a composition containing a purified factor for supporting wound healing selected from the group consisting of Hepatocyte Growth Factor (HGF) platelet derived growth factor (PDGF), Epidermal growth factor (EGF), transforming growth factor alfa (TGF-α), Transforming growth factor beta (TGF-β), insulin like growth factor (IGF-1) and Fibroblast growth factor (FGF) from sources, such as blood, containing the factor for supporting wound healing, wherein the manufacturing process comprises purification steps which are performed in the presence of antithrombin III (AT-III).10-14-2010
20090054315Counteracting Drug-Induced Obesity Using GLP-1 Agonists - The present invention describes administering a GLP-1 agonist to treat obesity caused by the administration of an obesity-inducing drug.02-26-2009
20090170777HSP THERAPY IN CONJUNCTION WITH A LOW ANTIGENICITY DIET - The present invention relates to a method for suppression, prevention, delaying the onset or treatment of diabetes, by administering to an individual in need thereof a fragment of Hsp60 or analog thereof in conjunction with a low antigenicity diet. The invention is exemplified using DiaPep277™, an analog of residues 437-460 of human Hsp60 in combination with a hydrolyzed casein diet.07-02-2009
20090042779Purified Extract of an Alpha-Amylase Inhibitor From Phytoemagglutinin-Essentially Free Beans, Process for Its Extraction and Compositions Containing It - The invention relates to the use of beans essentially free from phytohemagglutinin for extracting the alpha-amylase inhibitor (hereinafter also “phaseolamin”), the extract enriched in phaseolamin, the highly purified extract, and also the dietetic and pharmaceutical compositions that contain it; the invention also relates to a process for preparing the above extract and for the immobilisation of phaseolamin on an inert solid support.02-12-2009
20090137477Treatment of oropharyngeal candidiasis in cancer patients - A method for local treatment of severe oral lesions caused by oropharyngeal candidiasis in immunocompromised patients, in particularly having head and neck cancer and undergoing or have undergone radiation therapy, by administering a prolonged release mucoadhesive tablet containing at least one active principle of miconazole. Methods of treating xerostomia in cancer patients having severe oral lesions is also provided.05-28-2009
20090093399Glycopegylation methods and proteins/peptides produced by the methods - The invention includes methods and compositions for remodeling a peptide molecule, including the addition or deletion of one or more glycosyl groups to a peptide, and/or the addition of a modifying group to a peptide.04-09-2009
20100210539USE OF PEPTIDE LL-37 AS A THERAPEUTIC AGENT - The present invention is directed to the use of the peptide compound Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH08-19-2010
20100056438Methods of producing nano-and microcapsules of spider silk proteins - The present invention is directed to a method of producing nano- and microcapsules from spider silk proteins The invention is further directed to nano- or microcapsules obtainable by this method as well as pharmaceutical, cosmetical and food compositions containing same.03-04-2010
20090170771Anti-angiogenic agents and methods of their use - The present invention relates to the use of sFRP-4 and functional variants thereof as anti-angiogenic agents. It relates to methods of treatment and screening methods using sFRP-4 and functional variants thereof. Further, it relates to compositions, and in particular pharmaceutical composition, including sFRP-4 and functional variants thereof which may be used in the various methods provided herein.07-02-2009
20100184664OPHTHALMIC COMPOSITIONS USEFUL FOR IMPROVING VISUAL ACUITY - The present invention provides a method of improving the visual acuity of a person in need thereof which comprises topically administering to said person, in an effective amount, an ophthalmic composition comprising an aqueous carrier component; and an effective amount of a tonicity component comprising a material selected from a combination of compatible solute agents, wherein said combination of compatible solute agents comprises two polyol components and one amino acid component and wherein said polyol components are erythritol and glycerol and said amino acid component is carnitine.07-22-2010
20100240587STABLE FORMULATIONS OF AMYLIN AND ITS ANALOGUES - The invention relates to a soluble pharmaceutical composition for parenteral administration, which comprises an amylin peptide and an anionic surfactant, and methods for treatment of hyperglycemia.09-23-2010
20090156482EXTERNAL PREPARATION, METHOD OF PRODUCING THE SAME AND USAGE FOR THE SAME - The present invention provides an external preparation and the method for produce the same, in which said external preparation comprises recombinant human growth hormone or recombinant human granulocyte macrophage-stimulating factor and pharmaceutical acceptable carriers. The present invention also relates to application and usage method in preparing medicaments for treatment of various lesions and ulcer, especially corneal lesion and corneal ulcer.06-18-2009
20090181887USE OF A GLP-1 MOLECULE FOR TREATMENT OF BILIARY DYSKINESIA AND/OR BILIARY PAIN/DISCOMFORT - The present invention relates to molecules, compositions and methods suitable for the treatment or prevention of biliary dyskinesia and/or pain and/or discomfort originating from the biliary tree. The peptide hormone glucagon-like peptide-1 (GLP-1) has both anti-secretory effects and smooth muscle relaxatory properties in the gastrointestinal tract. GLP-1 exists in several forms, where the natural occurring GLP-1 molecules are GLP-1 (1-37), GLP-1 (7-37), and the amidated versions GLP-1 (1-36)amide, GLP-1 (7-36)amide. Other molecules capable of binding to and activating the GLP-1 receptor is herein included in the tern GLP-1 molecules. GLP-1 molecules may be naturally occurring or homologues of GLP-1 having one or more amino acid substitutions or modifications. The GLP-1 molecules are used for the manufacture of a medicament for the treatment or prevention of biliary dyskinesia and/or pain and/or discomfort originating from the biliary tree.07-16-2009
20100130418P2X7 Inhibition Of Epithelial Cancers And Papillomas - The present invention demonstrates that P2X05-27-2010
20100125052ANTIDOTES FOR FACTOR XA INHIBITORS AND METHODS OF USING THE SAME IN COMBINATION WITH BLOOD COAGULATING AGENTS - The present invention relates to antidotes of anticoagulants targeting factor Xa which antidotes are used in combination with blood coagulating agents or other heparin antidotes to prevent or reduce bleeding in a subject. The antidotes described herein have reduced or no intrinsic coagulant activity. Disclosed herein are methods of stopping or preventing bleeding in a patient that is or will be undergoing anticoagulant therapy with a factor Xa inhibitor.05-20-2010
20100184654ANTI-MICROBIAL TARGETING CHIMERIC PHARMACEUTICAL - The present invention is based on the discovery of a composition that provides targeted anti-microbial effect. Specifically the composition contains a targeting moiety which recognizes a target microbial organism and an anti-microbial peptide moiety which has anti-microbial activity. In addition, the present invention provides methods of treating a microbial infection, e.g., on mucosal surfaces by using the compositions provided by the present invention.07-22-2010
20100130425USE OF TOLL-LIKE RECEPTOR LIGANDS IN TREATING EXCITOTOXIC INJURY, ISCHEMIA AND/OR HYPOXIA - Methods of protecting cells against cytotoxic insults are provided. The methods involve administering a composition including a Toll-like receptor (TLR) ligand, for instance a TLR7, TLR8, or TLR9 ligand to a subject. The methods are applicable to the protection of neural and non-neural cells. For example, methods of protecting a neural cell against excitotoxic brain injury are provided. Methods for preparing medicaments for the prophylactic treatment of excitotoxic injury, ischemia and/or hypoxia are also provided. Also provided are compositions for use in the described methods.05-27-2010
20090264366Transglutaminase Mediated Conjugation of Peptides - Methods for conjugating peptides are provided comprising i) reacting a peptide with a first compound comprising a functional group in the presence of a transglutaminase capable of incorporating said compound into the peptide to form a transaminated peptide, and ii) reacting said transaminated peptide with e.g. a functionalized polymer capable of reacting with the functional group incorporated in the peptide in the enzymatic reaction.10-22-2009
20090312246Uses of Glucoregulatory Proteins - The present invention relates generally to the novel use of incretin compounds (ICs) and amylinomimetic compounds to treat, prevent, or ameliorate a variety of metabolic conditions or diseases.12-17-2009
20090036375DBC1, a novel native inhibitor of anti-aging protein SIRT1 - A novel complex is identified between the NAD-dependent deacetylase, SIRT1 and its novel inhibitor, DBC1. Provided herein are methods to identify a compound that inhibits the complexation between SIRT1 and DBC1. Exemplary methods comprise contacting either the complexation between DBC1 and SIRT1 with an agent being tested for its ability to inhibit the complexation between SIRT1 and DBC1. Also, provided are methods to identify a compound that increases the complexation between SIRT1 and DBC1. Exemplary methods comprise contacting either the complexation between DBC1 and SIRT1 with an agent being tested for its ability to increase the complexation between SIRT1 and DBC1. Further, methods are provided to increase or decrease SIRT1 activity by contacting the complexation between SIRT1 and DBC1 with a peptide that either decreases or increases the complexation between SIRT1 and DBC1. Further, methods are provided for the treatment of patients suffering from diseases including metabolic diseases including obesity and diabetes, and neurodegenerative disorders including Alzheimer's disease and Huntington's disease using compounds that inhibit the complexation between SIRT1 and DBC1.02-05-2009
20090192083METHODS AND COMPOSITIONS FOR THE TREATMENT OF GASTROINTESTINAL DISORDERS - Compositions and related methods for treating IBS and other gastrointestinal disorders and conditions (e.g., gastrointestinal motility disorders, functional gastrointestinal disorders, gastroesophageal reflux disease (GERD), duodenogastric reflux, Crohn's disease, ulcerative colitis, inflammatory bowel disease, functional heartburn, dyspepsia (including functional dyspepsia or nonulcer dyspepsia), gastroparesis, chronic intestinal pseudo-obstruction (or colonic pseudoobstruction), and disorders and conditions associated with constipation, e.g., constipation associated with use of opiate pain killers, post-surgical constipation, and constipation associated with neuropathic disorders as well as other conditions and disorders are described. The compositions feature peptides that activate the guanylate cyclase C (GC-C) receptor and predicted metabolites of such peptides.07-30-2009
20090247455Isolation of Inhibitors of IRES-Mediated Translation - The present invention relates to a method for identifying or determining a compound that inhibits or reduces internal ribosome entry site (IRES) mediated translation. For example, the present invention provides a method for determining a compound that inhibits IRES-mediated translation, said method comprising expressing in a cell a counter selectable marker operably under the control of an IRES. A candidate compound is then introduced into the cell or contacted with the cell and the cell maintained under conditions that select against a cell expressing the counter-selectable marker gene. Accordingly, a cell in which IRES-mediated translation of the counter-selectable reporter gene is selected, thereby identifying a compound that inhibits IRES-mediated translation. The present invention also provides compounds identified by the method.10-01-2009
20090036364GIP ANALOG AND HYBRID POLYPEPTIDES WITH SELECTABLE PROPERTIES - The present invention relates generally to novel GIP analogs and GIP hybrid polypeptides with selectable properties, useful as agents for the treatment and prevention of metabolic diseases and disorders, for example those which can be alleviated by control plasma glucose levels, insulin levels, and/or insulin secretion, positive inotropic effects, reduction of catabolic effects, slowing of gastric emptying. Such conditions and disorders include, but are not limited to, hypertension, dyslipidemia, cardiovascular disease, eating disorders, critical care, insulin-resistance, obesity, and diabetes mellitus of any kind, including type 1, type 2, and gestational diabetes.02-05-2009
20090170770METHODS AND COMPOSITIONS FOR TREATING CONDITIONS ASSOCIATED WITH ANGIOGENESIS USING A VASCULAR ADHESION PROTEIN-1 (VAP 1) INHIBITOR - The invention relates generally to methods and compositions for treating conditions associated with angiogenesis, and, more specifically, the invention relates to methods and compositions for treating conditions associated with angiogenesis using vascular adhesion protein-1 (VAP-1) inhibitors. The invention also relates to methods and compositions for treating conditions associated with lymphangiogenesis using VAP-1 inhibitors.07-02-2009
20090099078Nogo Receptor Antagonists - Disclosed are immunogenic Nogo receptor-1 polypeptides, Nogo receptor-1 antibodies, antigen-binding fragments thereof, soluble Nogo receptors and fusion proteins thereof and nucleic acids encoding the same. Also disclosed are Nogo receptor antagonist polynucleotides. Also disclosed are compositions comprising, and methods for making and using, such Nogo receptor antibodies, antigen-binding fragments thereof, soluble Nogo receptors and fusion proteins thereof, nucleic acids encoding the same and antagonist polynucleotides.04-16-2009
20100184688COMPOSITIONS AND METHODS FOR ENHANCED MUCOSAL DELIVERY OF PARATHYROID HORMONE - Pharmaceutical compositions and methods are described comprising at least a parathyroid hormone peptide (PTH) preferably PTH07-22-2010
20090137474USE OF POLYPEPTIDES HAVING ANTIMICROBIAL ACTIVITY - The present invention relates to the use of polypeptides related to a 05-28-2009
20090253628Use of PEGylated IGF-I variants for the treatment of neuromuscular disorders - The present invention relates to a pharmaceutical composition containing a PEGylated IGF-I variant derived from the wild-type human IGF-I amino acid sequence where one or two of the lysine amino acids at positions 27, 65, and 68 are altered to be a polar amino acid other than lysine and where the PEG is attached to at least one lysine residue. The invention also relates to methods for the treatment, prevention and/or delay of progression of neuromuscular disorders, in particular amyotrophic lateral sclerosis (ALS) by administering a therapeutically effective amount of the pharmaceutical composition of the invention.10-08-2009
20080293628Methods and Compositions for the Inhibition of Thrombus Formation - The present invention is directed to anti-platelet peptides that may be used in various methods for the treatment or prophylaxis of thrombosis. More specifically, the specification describes methods and compositions for making and using compositions GPIbα fragments as anti-platelet agents. The present invention is also directed to peptides that inhibit intracellular function of 14-3-3.11-27-2008
20090062196Compositions and methods of treating cancer - This present invention compositions and methods of treating cancer and methods of accessing/monitoring the responsiveness of a cancer cell to a therapeutic compound.03-05-2009
20100190705Suppression of glial fibrillary acidic protein - Provided herein are methods of decreasing glial fibrillary acidic protein (GFAP) levels in a cell. Such methods include administering an effective amount of a GFAP lowering compound to the cell. Also provided are compounds useful for the treatment of Alexander disease in subjects at risk of or diagnosed with Alexander disease and methods for the identification of such compounds.07-29-2010
20080318852Epitopes Related to Coeliac Disease - The invention herein disclosed is related to epitopes useful in methods of diagnosing, treating, and preventing coeliac disease. Therapeutic compositions which comprise at least one epitope are provided.12-25-2008
20100190710IL-23 RECEPTOR ANTAGONISTS AND USES THEREOF - The present invention relates to IL-23 receptor antagonists and agonists. The use of IL-23 receptor antagonists in treating autoimmune and inflammatory disorders, as well as methods of identifying IL-23 receptor antagonists and agonists.07-29-2010
20100035816MEDICAMENT COMPRISING A PEPTIDE EXTRACT OF AVOCADO, WHICH IS INTENDED FOR THE TREATMENT AND PREVENTION OF ILLNESSES THAT ARE LINKED TO AN IMMUNE SYSTEM DEFICIENCY OR OXIDATIVE STRESS OR SKIN AGEING OR DRY SKIN - The invention relates to a medicament which comprises a peptide extract of avocado and which can also comprise a composition containing D-mannoheptulose an/or perseitol, such as a water-soluble extract of avocado sugars, and/or a peptide extract of lupine. The inventive medicament is intended for the treatment and/or prevention of illnesses that are linked to an alteration in innate and/or acquired immunity, through an increase in the production of anti-microbial peptides, preferably hBD-2, without inducing inflammatory reactions, irritations or intolerances.02-11-2010
20080242612ADMINISTRATION OF LEPTIN - A method and composition for administering leptin to a subject. The invention includes suspending isolated native leptin-containing milk fat globules in a suitable medium for administering to a subject. The suspended milk fat globules may be administered orally as well as by intravenous, intramuscular, intraperitone41, other enteral routes of administration, and other parenteral routes of administration. The invention includes a method for treating growth or maturational-related disorders in newborns as, well as subjects having conditions that can be treated by the administration of leptin.10-02-2008
20090075895Stabilised Solid Composition of Modified Factor VII - The invention concerns a composition comprising; i) Modified Factor VII; ii) an agent suitable for keeping the pH of said composition in the range of 4 to 7 when said composition is dissolved in water; and iii) a moisture content of at the most 3%.03-19-2009
20090197805Insulin receptor antagonists and related compositions, uses and methods - Provided are new peptidic insulin receptor antagonists (PIRAs) and related compounds and compositions. Also provided are new uses of PIRAs and methods of obtaining PIRAs.08-06-2009
20090298756FUNCTIONS AND USES OF GPR39 GENE IN MAMMALIAN CENTRAL NERVOUS SYSTEM - The present invention provides mammalian GPR39 gene, its coded products, and the uses in regulating appetite and pain sensitivity. A pharmaceutical composition and a health product comprising GPR39 protein are also provided. The health product and the pharmaceutical composition for suppressing appetite or decreasing pain sensitivity comprise a safe and efficient amount of antagonists of mammalian GPR39 protein (for example, 0.01-99%) and a bromatologically or pharmaceutically acceptable carrier in a suitable amount (for example 1-99.99 wt %).12-03-2009
20090118171Use of enzymatic inhibitors of h-prune for the prevention and treatment of the metastases of tumours overexpressing h-prune - The invention relates to the use of enzymatic inhibitors of h-PRUNE and to screening method for the prevention and treatment of the metastases of tumours overexpressing h-PRUNE thereof and to the diagnostic kit for the prognosis of said metastases thereof.05-07-2009
20090062190Transcriptional Regulation of Cytokines by LITAF and STAT (6)(B) - The present invention relates to novel proteins (LITAF and STAT6(B)) and the nucleotide sequences encoding the same. The present invention also relates to the use of the novel peptides and nucleotide sequences of the present invention, or functional fragments thereof, for the regulation of cytokine expression. The present invention also relates to the use of the novel proteins and nucleotides sequences of the present invention for the regulation of inflammatory responses in mammals including the regulation of angiogenesis and tubulogenesis. Also in this regard, the present invention relates to the generation of null mutant animals deficient in the expression of one or both of the proteins of the present invention.03-05-2009
20100056444Treatment of Alzheimer's Disease Using Compounds that Reduce the Activity of Non Selective Ca Activated ATP- Sensitive Cation Channels Regulated by SUR1 Receptors - NSC antagonists are disclosed as useful in the treatment of dementia, in delaying the onset of dementia, and in the prevention of dementia. Dementia so treated may be, for example, Alzheimer's Disease (AD). NSC antagonists for treating dementia such as AD may be administered alone, a) in combination with other drugs used for treating dementia, b) in combination with drugs that stabilize or increase blood plasma glucose levels, or with both a) and b). Pharmaceutical compositions, dosage forms, and methods for using the same are disclosed, which include NSC antagonists, NSC antagonists combined with dementia drugs, NSC antagonists combined with glucose-level stabilizing or enhancing drugs, or combinations of these. Dosage forms may be designed to provide stable plasma levels for extended periods of time. Exemplary pharmaceutical compositions include compositions including glibenclamide and memantine; glibenclamide and donepezil; tolbutamide and memantine; tolbutamide and donepezil; and these compositions further including glucagon and/or glucose.03-04-2010
20080318861Mucosal Delivery of Stabilized Formulations of Exendin - What is described is a pharmaceutical formulation for intranasal administration of exendin to a mammal, wherein the formulation comprises a therapeutically effective amount of an exendin, a viscosity enhancer, methyl-β-cyclodextrin, a surfactant, tartrate buffer to control pH and a chelating agent for cations, and wherein such exendin dosage form exhibits at least 95% exenatide recovery after storage for at least 365 days at 5° C.12-25-2008
20100184655MODIFIED ERYTHROPOIETIN - This invention relates to novel protein conjugates, in particular, to novel pegylated proteins, and their methods of making and use. One aspect of the present invention relates to pegylated-erythropoietin having greater clinical efficacy and stability during shipment and storage than current erythropoietin formulations.07-22-2010
20090298759C-Reactive Protein and Its Use to Treat Systemic Lupus Erythematosus and Related Conditions - The present invention relates to the use of C-reactive protein, its mutants, metabolites and polypeptides and related compounds thereof for the treatment of various disease states and conditions associated with systemic lupus erythematosus (SLE), including lupus of the skin (discoid), systemic lupus of the joints, lungs and kidneys, hematological conditions including hemolytic anemia and low lymphocyte counts, lymphadenopathy and CNS effects including memory loss, seizures and psychosis, among numerous others as otherwise disclosed herein, in another aspect of the invention, the reduction in the likelihood that a patient who is at risk for an outbreak of a disease state or condition with systemic lupus erythematosus will have an outbreak is an additional aspect of the present invention.12-03-2009
20090221498Use of Mas-G-Protein-Coupled Receptor Agonists in the Treatment of the Metabolic Syndrome, Its Components and its Complications - The present invention is characterized by the use of Mas-G-protein-coupled receptor agonists for the control, prevention and treatment of the body levels of triglycerides, cholesterol and glucose, as well as of hyper-tension and possible increase in body weight, which are characteristic of the clinical manifestation of the metabolic syndrome and its complications. Another characteristic of the invention is the use of Mas-G-protein-coupled receptor agonists, including the Angiotensin-(1-7) peptide and its analogs, agonists, either peptidic or non-peptidic, as modulators of the manifestations of insulin resistance and glucose intolerance and in the prevention and treatment of the related alterations. The invention claims the use of MAS-G-protein-coupled receptor agonists, formulated with pharmaceutically and pharmacologically acceptable excipients or carriers, and Mas-G-protein-coupled receptor agonists, including the Angiotensin-(1-7) peptide and its analogs, agonists, either peptidic or non-peptidic, as modulators of the metabolic syndrome, the diseases that compose it and its complications.09-03-2009
20090042782Diagnostic and therapeutic strategies for conditions associated with the FLJ13639 gene - Provided are methods for determining a prognosis for an individual suspected of having or diagnosed with cancer, where a high CD24/low FLJ13639 ratio indicates an unfavorable prognosis. Also provided are methods for enhancing the activity of chemotherapeutic agents, and isolated, purified FLJ13639 proteins for use in improving the prognosis of an individual and for enhancing the activity of chemotherapeutic agents.02-12-2009
20100210538THERAPEUTIC USES OF INTERMEDIN 47 AND 53 PEPTIDES - The present invention is directed to the use of the peptide compound His-Ser-Gly-Pro-Arg-Arg-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH08-19-2010
20080293629Albumin Fusion Proteins - The present invention encompasses albumin fusion proteins. Nucleic acid molecules encoding the albumin fusion proteins of the invention are also encompassed by the invention, as are vectors containing these nucleic acids, host cells transformed with these nucleic acids vectors, and methods of making the albumin fusion proteins of the invention and using these nucleic acids, vectors, and/or host cells. Additionally the present invention encompasses pharmaceutical compositions comprising albumin fusion proteins and methods of treating or preventing diseases, disorders or conditions related to diabetes mellitus using albumin fusion proteins of the invention.11-27-2008
20090318337Compositions and methods for activating innate and allergic immunity - Methods for making and using therapeutic formulations of Proteosome-based immunoactive compositions are provided. The immunogenic compositions, which include Proteosomes and liposaccharides, may be used to elicit or enhance a nonspecific innate immune response to, for example, treat or prevent infectious disease. In addition, after activating the innate immune system, immunogenic compositions further containing an antigen may be used to elicit a specific adaptive immune response. Furthermore, provided are compositions capable of altering hyperreactive responses or inflammatory immune responses, such as allergic reactions. Such compositions may be used as a prophylactic, or in various clinical settings to treat or prevent infectious disease (such as parasite, fungal, bacterial or viral infections), or to alter inappropriate inflammatory immune responses (such as allergic reactions or asthma).12-24-2009
20090275504PCSK9 PROTEINS, FRAGMENTS THEREOF AND METHODS OF MODULATING PCSK9 PHOSPHORYLATION AND LOW DENSITY LIPOPROTEIN (LDLR) DEGRADATION - The present invention provide PCSK9 polypeptides, fragments thereof and methods of modulating PCSK9 phosphorylation and low density lipoprotein degradation.11-05-2009
20090197809ANTIFUNGAL METHODS - A system for reducing the incidence or severity of fungal infection of a plant, comprising a chemical fungicide component, which may be provided by foliar or root (soil or liquid nutrient) application, together with an antifungal plant defensin not in nature expressed in the plant being protected or expressed in lower amounts or in different tissues, provides synergistic improvement in protection against infection by a plant pathogenic fungus which is susceptible to the defensin and the fungicide. The fungicide can be a strobilurin or a triazole, and the defensin can be selected from a wide range of known defensins, for example, NaD1 and others, or it can be a chimeric defensin engineered for low toxicity to the plant. The defensin can be provided as a protein formulation, optionally together with the fungicide, or it can be provided by recombinant expression in the plant to be protected from fungal infection.08-06-2009
20090088385Antibodies that bind to BGS-4 - The present invention provides novel polynucleotides encoding BGS-4 polypeptides, fragments and homologues thereof. Also provided are vectors, host cells, antibodies, and recombinant and synthetic methods for producing the polypeptides of the present invention. The invention further relates to diagnostic and therapeutic methods for applying these novel BGS-4 polypeptides to the diagnosis, treatment, and/or prevention of various diseases and/or disorders related to these polypeptides. The invention further relates to screening methods for identifying agonists and antagonists of the polynucleotides and polypeptides of the present invention.04-02-2009
20090215685METHODS FOR INHIBITING HAIR DEPIGMENTATION AND HAIR LOSS - The present invention aims to provide a method for inhibiting hair depigmentation and a method for inhibiting hair loss, in which hair depigmentation and hair loss are inhibited by collagen XVII.08-27-2009
20090312255STIMULATION OF TRPV1+ SENSORY NEURONS TO CONTROL BETA-CELL STRESS AND ISLET INFLAMMATION IN DIABETES - The present invention provides a method of altering the function of TRPV1+ sensory afferent neurons in the pancreas as a way of treating, managing, alleviating, etc., the symptoms and/or underlying causes of diabetes or abnormal glucose metabolism by increasing the release of neuropeptides, such as substance P (sP) or other tachykinin peptide, in the pancreas. This may be achieved by injecting a TRPV1 agonist, such as a capsaicinoid compound or capsaicin analog, or a neuropeptide, such as sP or other tachykinin peptide, directly into the pancreas, or alternatively, by stimulating one or more intercostal and/or subcostal nerves of spinal nerves derived from one or more thoracic segments T8 through T12 by chemical, electrical, surgical, mechanical, etc., methods.12-17-2009
20080249007Protracted Exendin-4 Compounds - Novel protracted exendin-4 compounds and therapeutic uses thereof.10-09-2008
20090018067REGULATORY T CELL EPITOPES, COMPOSITIONS AND USES THEREOF - The invention is directed to T cell epitopes wherein said epitopes comprises a peptide or polypeptide chain comprising at least a portion of an immunoglobulin constant or variable region. The invention also relates to methods of using and methods of making the epitopes of the invention.01-15-2009
20100234292METHODS OF ASSESSING A PROPENSITY OF CLINICAL OUTCOME FOR A FEMALE MAMMAL SUFFERING FROM BREAST CANCER - The present invention relates to a method of assessing a propensity of clinical outcome for a female mammal suffering from breast cancer in view of the expression of specific nucleic acid sequences in a biological sample.09-16-2010
20100179095USE OF FOLATES FOR PRODUCING A PREPARATION SUITABLE FOR PREVENTING AND TREATING INFLAMMATION AND DISEASES ASSOCIATED WITH INFLAMMATION, ESPECIALLY FOR INFLUENCING THE INFLAMMATION MARKERS CRP AND SAA - This invention relates to the use of folates for producing a pharmaceutical preparation suitable for the prevention and treatment of inflammation and of diseases associated with inflammation, particularly for influencing the inflammation markers C-reactive protein (CRP) and serum amyloid A protein (SAA). The clinical areas of application are all anomalies of the CRP and SAA levels.07-15-2010
20090082264123 Human Secreted Proteins - The present invention relates to novel human secreted proteins and isolated nucleic acids containing the coding regions of the genes encoding such proteins. Also provided are vectors, host cells, antibodies, and recombinant methods for producing human secreted proteins. The invention further relates to diagnostic and therapeutic methods useful for diagnosing and treating diseases, disorders, and/or conditions related to these novel human secreted proteins.03-26-2009
20080234193Von Willebrand factor-and factor VIII-polymer conjugates having a releasable linkage - The present invention provides von Willebrand Factor-polymer conjugates and Factor VIII-polymer conjugates, each having a releasable linkage. Methods of making conjugates, methods for administering conjugates, are also provided.09-25-2008
20100056454Method for Screening Modulators of Apoptosis - The use and screening of modulators of apoptosis is disclosed. The modulators may be, for example, modulator of NF-κB activity. The modulators may be used, for example, in the treatment of NF-κB-mediated diseases, conditions, and injuries.03-04-2010
20100137218Expression System of NELL Peptide - Recombinant NELL peptides and methods of preparing the same are disclosed.06-03-2010
20090281031Methods and Compositions Related to Improving Properties of Pharmacological Agents Targeting Nervous System - Disclosed are compositions and methods related to improving pharmacological properties of bioactive compounds targeting nervous system.11-12-2009
20100016231Treatment Of Rheumatoid Arthritis With Mammal Beta Defensins - The present invention relates to treatment of rheumatoid arthritis with mammal beta defensins.01-21-2010
20100197596Compositions and methods for diagnosis and treatment of type 2 diabetes - The present invention relates generally to the identification of biological markers associated with an increased risk of developing Diabetes, as well as methods of using such biological markers in diagnosis and prognosis of Diabetes. The biological markers of the invention may indicate new targets for therapy or constitute new therapeutics for the treatment or prevention of Diabetes.08-05-2010
20090099077TREATMENT OF RETT SYNDROME AND OTHER DISORDERS - The invention relates to methods for treatment of Rett Syndrome and other disorders of synaptic function and maturation using IGF1, (1-3)IGF-1, (1-3)IGF-1 analog(s) and/or related therapeutic molecules.04-16-2009
20090305963Lipocalin 2 for the Treatment, Prevention, and Management of Cancer Metastasis, Angiogenesis, and Fibrosis - The invention features methods and compositions for treating and preventing cancer metastasis, angiogenic disorders, and fibrotic disorders using lipocalin 2 compounds.12-10-2009
20100168008METHOD OF USE OF EPIREGULIN PROTEIN AND NUCLEIC ACID ENCODING THE SAME IN INFLAMMATORY CONDITIONS - The present invention relates to nucleotide and protein sequences of epiregulin and epiregulin like proteins and nucleotides and methods employing them as a drug response marker in inflammatory conditions. The invention also provides epiregulin protein for treatment of inflammatory conditions like psoriasis and rheumatoid arthritis alone or in combination with one or more anti-inflammatory compounds.07-01-2010
20100125054Amylin and Amylin Agonists for Treating Psychiatric Diseases and Disorders - Methods and compositions for treating psychiatric diseases and disorders are disclosed. The methods provided generally involve the administration of an amylin or an amylin agonist to a subject in order to treat psychiatric diseases and disorders, and conditions associated with psychiatric diseases and disorders.05-20-2010
20100184687Purification of Glucagon-Like Peptides - Method for purifying a glucagon-like peptide by reversed phase high performance liquid chromatography.07-22-2010
20090258824Amyloid beta receptor and uses thereof - The present invention relates to the identification that soluble assemblies of amyloid β function as a NMDA receptor antagonist. The present invention also provides methods and compositions for the detection and treatment of neurodegenerative and cognitive disorders and screening methods to identify agents that modulate the antagonistic effect of soluble assemblies of amyloid β on NMDA receptor function.10-15-2009
20090325866NON-ACTIVATED WNT INHIBITION POLYPEPTIDES AND METHOD FOR PREPARING THE SAME - The present invention relates to non-activated Wnt inhibition polypeptides (WIPs) containing: (a) a protein transduction domain (PTD) which enables said WIPs to permeate a cell membrane without the aid of a cell membrane receptor; and (b) a Wnt antagonist domain which is inactive by itself, but is activated in mammalian cells and then secreted out of the cells to function to inhibit Wnt signal transduction. Also, the invention relates to a method for preparing said non-activated WIPs, and a pharmaceutical composition containing said WIPs as active ingredients. Said non-activated WIPs can be produced in large quantities through the culture of bacteria such as 12-31-2009
20100130413TREATMENT FOR AGE-RELATED MACULAR DEGENERATION AND OTHER DISEASES OF THE EYE - A method is disclosed for treating diseases or disorders of the eye involving undesired neovascularization by administration of a complement inhibitory protein such as soluble complement receptor type I (sCR1). The present invention relates to the direct treatment of macular degeneration, particularly age-related macular degeneration (AMD), by administering a complement inhibitory protein intraocularly or systemically.05-27-2010
20090011996DIAGNOSING AND PROTECTING HORSES AGAINST PAPILLOMAVIRUS - Compositions for conferring protection against Equus caballus papillomavirus (EcPV) and Bovine papillomavirus (BPV) infection in a subject are provided and include a virus-like particle assembled from an EcPV L1 protein and virus like particle assembled from a BPV L1 protein. Methods for protecting a subject against EcPV and BPV infection are further provided and include administering to the subject a composition comprised of a virus-like particle assembled from an EcPV L1 protein and virus like particle assembled from a BPV L1 protein. Methods of diagnosing EcPV and/or BPV infection in a subject are also provided and include providing a virus-like particle assembled from a papillomavirus L1 protein selected from an EcPV L1 protein and a BPV L1 protein; contacting the virus-like particle with serum from the subject; and identifying the subject as having an infection if an antibody capable of binding the virus-like particle is detected in the serum.01-08-2009
20100190712USE OF PEPTIDE YY, ALONE OR IN COMBINATION WITH GLUCAGON-LIKE PEPTIDE, FOR USE IN MEDICINE - The present invention is directed to the use of the peptide compound Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH07-29-2010
20100160230UBIQUITIN AND UBIQUITIN RELATED MOLECULES FOR TREATMENT AND PREVENTION OF HARMFUL ACTIVATION OF THE IMMUNE SYSTEM - Compositions and methods for suppressing the immune system of a mammal using ubiquitin and derivatives and analogs thereof.06-24-2010
20090036369ANTI-TUMOR AGENTS COMPRISING R-SPONDINS - The present invention provides an anti-tumor agent comprising a human R-spondin including R-spondin1 (GIPF), R-spondin2, R-spondin3 or R-spondin4, or a fragment thereof which has human R-spondin activity as an active ingredient.02-05-2009
20100234288SUSTAINED RELEASE PHARMACEUTICAL COMPOSITION ON THE BASIS OF RELEASE SYSTEM COMPRISING AN ACID-SOLUBLE POLYMER AND A pH-DEPENDENT POLYMER - Sustained release pharmaceutical composition comprising at least one poorly soluble active agent(s), at least one solubilizer, a release rate controlling polymer system consisting of an acid-soluble polymer and a pH-dependent polymer, and optionally other pharmaceutically acceptable excipients. The present invention also describes a process for preparation of such compositions and method of using such compositions. The sustained release compositions are useful in providing therapeutically effective levels of active agent(s) for extended periods of time.09-16-2010
20090286728Tooth root formation promoting factors and method for promotion of tooth root formation - The present invention provides a tooth root formation promoting factor and a method for promotion of tooth root formation, which can promote tooth root formation and which are useful in various aspects of dental therapy. Specifically, the tooth root formation promoting factor contains, as an active ingredient, proteins belonging to the FGF8 subfamily (i.e., fibroblast growth factors); and the method includes administering proteins belonging to the FGF8 subfamily to a mammalian.11-19-2009
20090253625GLP-1, exendin-4, peptide analogs and uses thereof - The invention relates to novel polypeptide analogues of GLP-1 and exendin-4. The polypeptide, in a preferred embodiment, is insulinotropic and long-acting. Preferably, the polypeptide's insulinotropic effect is comparable to or exceeds the effect of an equimolar amount of GLP-1 or exendin-4. The invention also relates to a method of treating a subject with diabetes, comprising administering to the subject the polypeptide of the invention in an amount that has an insulinotropic effect. The invention also relates to methods of using GLP-1, exendin-4, and polypeptide analogues thereof for neuroprotective and neurotrophic effects.10-08-2009
20090075889IREN PROTEIN, ITS PREPARATION AND USE - There are provided DNA sequences encoding TRAF binding proteins, proteins encoded thereby, and their use in the treatment or prevention of pathological conditions associated with NF-κB induction, or an activity mediated by a TRAF.03-19-2009
20100160224SHELF-STABLE CONSUMABLE COMPOSITIONS CONTAINING PROBIOTIC-MIMICKING ELEMENTS AND METHODS OF PREPARING AND USING THE SAME - A shelf-stable consumable composition may comprise one or more Probiotic-Mimicking Elements (PMEs) wherein the median particle size of the one or more PMEs is less than the median particle size of a probiotic from which the one or more PMEs were derived. In some embodiments, the median particle size of the one or more PMEs may be less than about 0.2 microns. In some embodiments, the PMEs may comprise at least one of peptides, fatty acids, bacteriocins, cell surface proteins, phospholipids, teichoic acids, and nucleic acids, and may be combined with one or more prebiotics, such as oligosaccharides, inulin, short-chain fructo-oligosaccharides, xylooligosaccharides, galactooligosaccharides, soyoligosaccharides, and lactulose/lactitol. Methods for preparing and using a shelf-stable consumable composition for promoting digestive health in a subject are also described.06-24-2010
20090270321Over-expression of MPS-1 gene or its gene product(s) results in reduction in size of a variety of malignancies - Metallopanstimulin-1 (MPS-1) is a multifunctional ribosomal protein. MPS-1 is a 10 kD zinc finger protein (ZFP) that is present in all tissues and expressed in increased quantities in a wide variety of proliferating tissues and malignancies. The ribosome is a ribonucleoprotein complex of ribosomal RNAs (rRNA) and proteins (r-protein). Conventionally, r-proteins are thought to be responsible for new protein synthesis, but emerging evidence has shown activity exists beyond this. Some extra-ribosomal functions of r-proteins have been observed in close relation to cancer pathology. MPS-1 is over-expressed in the serum and tissue of dozens of malignancies. However, it is unknown whether the enhanced expression of MPS-1 is the cause or result of tumor development and progression. Our preliminary observations show increased MPS-1 decreases paxillin. Recently, paxillin was found to have an important role in regulating both normal and tumor cell proliferation.10-29-2009
20100184677USE OF THE HUMAN PANCREATIC POLYPEPTIDE AS A THERAPEUTIC AGENT - The present invention is directed to the use of the peptide compound Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp- Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH07-22-2010
20090156485METHOD FOR COUPLING KERATIN-BINDING POLYPEPTIDES WITH EFFECTOR MOLECULES WHICH SUPPORT CARBOXYLIC GROUPS OR SULFONIC ACID GROUPS - The invention relates to a method of producing keratin-binding effector molecules and to intermediates and end-products of the method according to the invention and to the use of the keratin-binding effector molecules produced according to the invention in dermocosmetics.06-18-2009
20090105134C-Terminally Pegylated Growth Hormones - Conjugated growth hormones of the structure (I) are provided together with methods for manufacturing said conjugates. The conjugates are useful in therapy.04-23-2009
20080293637Cross-linked collagen and uses thereof - The present invention discloses collagen cross-linked in a micro to non-fibrillar form and at a high concentration. The cross-linked collagen gel has improved volume stability or persistence than collagen cross-linked at a neutral pH. Also disclosed are methods for preparing the inventive cross-linked collagen and using such for augmenting soft tissues in mammals.11-27-2008
20090124544COMPOSITIONS AND METHODS FOR THE PREPARATION OF PROTEASE RESISTANT HUMAN GROWTH HORMONE GLYCOSYLATION MUTANTS - The present invention relates to protease resistant mutants of human growth hormone, which contain newly introduced proteolysis resistant mutations and N-linked or O-linked glycosylation site(s), such that these recombinantly produced polypeptides have glycosylation patterns distinctly different from that of the naturally occurring human growth hormone. The polynucleotide coding sequences for the mutants, expression cassettes comprising the coding sequences, cells expressing the mutants, and methods for producing the mutants are also disclosed. Further disclosed are pharmaceutical compositions comprising the mutants and method for using the mutants.05-14-2009
20090298774Bifunctional Molecules for Inhibiting HIV Entry - Disclosed herein are bifunctional molecules which inhibit HIV entry into the target cell. Also disclosed are novel anti-HIV therapeutics for treatment of patients infected by HIV, including non-B and multi-drug resistant strains.12-03-2009
20100069301COMPOSITIONS AND METHODS FOR TREATING PATHOLOGIC ANGIOGENESIS AND VASCULAR PERMEABILITY - Compounds, compositions and methods for inhibiting vascular permeability and pathologic angiogenesis are described herein. Methods for producing and screening compounds and compositions capable of inhibiting vascular permeability and pathologic angiogenesis are also described herein. Pharmaceutical compositions are included in the compositions described herein. The compositions described herein are useful in, for example, methods of inhibiting vascular permeability and pathologic angiogenesis, including methods of inhibiting vascular permeability and pathologic angiogenesis induced by specific angiogenic, permeability and inflammatory factors, such as, for example VEGF, bFGF and thrombin. Methods for treating specific diseases and conditions are also provided herein.03-18-2010
20090029914Albumin Fusion Proteins - The present invention encompasses albumin fusion proteins. Nucleic acid molecules encoding the albumin fusion proteins of the invention are also encompassed by the invention, as are vectors containing these nucleic acids, host cells transformed with these nucleic acids vectors, and methods of making the albumin fusion proteins of the invention and using these nucleic acids, vectors, and/or host cells. Additionally the present invention encompasses pharmaceutical compositions comprising albumin fusion proteins and methods of treating, preventing, or ameliorating diseases, disorders or conditions using albumin fusion proteins of the invention.01-29-2009
20090118177USE OF NERVE GROWTH FACTOR IN EYE-DROPS FOR THERAPY OF PATHOLOGIES OF THE CENTRAL NERVOUS SYSTEM, SUCH AS ALZHEIMER'S AND PARKINSON'S DISEASE - Nerve growth factor (NGF), in the form of a preparation for administration on the ocular surface, is proposed for use in the therapy and/or prophylaxis of pathologies affecting brain tissues and encephalic structures, with particular reference to pathologies affecting the hippocampus, cerebral cortex, basal forebrain, medial septum, Broca's diagonal band, Meynert's basal nucleus, substantia nigra pars compacta, striatum and cerebellum. Applied in the form of an external ophthalmic preparation, for example, as eye-drops or ointment, the NGF is able to pass from the ocular surface to the brain tissues, and has been found to exert a therapeutic action on pathologies of the central nervous system, and particularly on Alzheimer's Disease and Parkinson's Disease.05-07-2009
20100160220Compositions and Methods for Improving Bone Mass Through Modulation of Novel Receptors of PTH and Fragments Thereof - The present invention relates to the discovery of novel receptors for the signaling of PTH and/or fragments of PTH, and the role of cPTH in bone development. The novel PTH receptors identified are selected from the group consisting of LRP5/6, TGFβRII, BMPRII (long form and short form), ActRIIA, and ActRIIB. Specifically, the present invention provides a novel screening tool for identifying compounds that improve bone mass by affecting certain pathways that promote or downregulate bone-forming activity. This promotion of bone-forming activity could provide for treatments for bone-loss or bone density disorders and/or kidney disease. The invention further encompasses the compounds, PTH ligands, and fragments of PTH ligands described herein; pharmaceutical compositions comprising the compounds, PTH ligands, or fragments of PTH ligand; and methods of increasing bone density using the compounds, PTH ligands, or fragments of PTH ligands.06-24-2010
20090048160Antimicrobial activity of bovine bactericidal/permeability-increasing protein (BPI)-derived peptides against Gram-negative bacterial mastitis isolates - The antimicrobial activity of bovine bactericidal/permeability-increasing protein (bBPI)-derived synthetic peptides against mastitis-causing Gram-negative bacteria was evaluated. Three peptides were synthesized with sequences corresponding to amino acids 65-99 (bBPI02-19-2009
20090075880Albumin Fusion Proteins - The present invention encompasses albumin fusion proteins. Nucleic acid molecules encoding the albumin fusion proteins of the invention are also encompassed by the invention, as are vectors containing these nucleic acids, host cells transformed with these nucleic acids vectors, and methods of making the albumin fusion proteins of the invention and using these nucleic acids, vectors, and/or host cells. Additionally the present invention encompasses pharmaceutical compositions comprising albumin fusion proteins and methods of treating, preventing, or ameliorating diseases, disorders or conditions using albumin fusion proteins of the invention.03-19-2009
20090163409Trappin-2 (elafin) inhibits HIV - In sub-Saharan Africa, the vast majority of HIV transmission occurs through heterosexual contact, therefore, the initial site of HIV infection occurs within the genital tract. In a cohort of HIV-highly exposed sex workers we have identified a select group of individuals who epidemiologically and clinically appear to be HIV-resistant. Studies of these women indicate a strong correlation of HIV-specific immune responses within the genital tract to protection from infection. We hypothesized that a characteristic immune phenotype is present within the genital tract of the HIV-resistant women when compared to susceptible controls. To test this we used SELDI-TOF mass spectrometry to profile the proteome of genital tract secretions from the HIV-resistant women and found a number of potential biomarkers (differentially expressed proteins) which correlated to HIV-resistance. Purification and tandem mass spectrometry resulted in the identification of a particular biomarker, namely trappin-2 (elafin). This protein was tested for HIV inhibitory activity in vitro and found to be a potent inhibitor of T tropic viral infection.06-25-2009
20100069297Selective Inhibition of TLR4 Signaling - Blocking peptides comprised of the 14 amino acids that correspond to the sequences of the BB-loops of the four known TIR domain-containing adapter proteins (i.e. MyD88, TRAM, TIRAP, and TRIF) and homologous sequences of four TLRs (TLR2, TLR4, TLR1, and TLR6) are described. Adapter BB loop peptides disrupted TLR4, but not TLR2 signaling. TLR2 and TLR4 blocking peptides inhibited TLR4- and TLR2-mediated activation of ERK and cytokine induction, however, these peptides did not inhibit activation of p38. These peptides can be used to treat or prevent an immune or inflammatory response associated with a condition related to TLR4 signaling.03-18-2010
20090062192Dimeric Peptide Agonists of the Glp-1 Receptor - Dimerization of GLP-1 agonists and therapeutic uses thereof.03-05-2009
20100184674PROADRENOMEDULLIN ALONE OR IN COMBINATION WITH BIG GASTRIN I AS A THERAPEUTIC AGENT - The present invention is directed to the use of the peptide compound Ala-Arg-Leu-Asp-Val-Ala-Ser-Glu-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH07-22-2010
20080261885PROCESS FOR THE EXTRACTION, PURIFICATION AND ENZYMATIC MODIFICATION OF SOY 7S GLOBULIN ALPHA' SUBUNIT FOR USE AS HYPOCHOLESTEROLEMIZING AGENT - A process for the extraction, purification and enzymatic modification of β-conglycinin α′ subunit, wherein β-conglycinin is selectively extracted from ground, defatted soy, then precipitated by treatment with aqueous ethanol; the enriched fraction is then subjected to Metal Affinity Chromatography (MAC) in denaturant conditions to obtain the α′ subunit, which is treated with chymotrypsin, then subjected to a further MAC to recover the amino-terminal region of this polypeptide (MW 28,000 Da).10-23-2008
20090036371Use of Serum Amyloid A Gene in Diagnosis and Treatment of Glaucoma and Identification of Anti-Glaucoma Agents - The present invention provides compositions and methods for treating glaucoma, methods for diagnosing glaucoma, and methods for identifying agents which may be useful in the treatment of glaucoma. More specifically, the present invention describes the use of agents that modulate the expression of serum amyloid A.02-05-2009
20100113361ANTI-IGE VACCINES - The present invention provides compositions and methods for the use of antigenic peptides derived from the Fc portion of the epsilon heavy chain of an IgE molecule as vaccines for the treatment and prevention of IgE-mediated allergic disorders. In particular, the invention provides compositions, methods for the treatment and prevention of IgE-mediated allergic disorders comprising an immunogenic amount of one or more antigenic peptides derived from the CH3 domain or junction of Ch-3/CH4 domain of an IgE molecule and methods for the evaluation of IgE mediated allergies in dogs.05-06-2010
20090029916Fibroblast Growth Factor-14 - Disclosed is a human Fibroblast growth factor-14 polypeptide and DNA(RNA) encoding such polypeptide. Also provided is a procedure for producing such polypeptide by recombinant techniques. Also disclosed are methods for utilizing such polypeptide for promoting wound healing for example as a result of burns and ulcers, to prevent neuronal damage due to associated with stroke and promote neuronal growth, and to prevent skin aging and hair loss, to stimulate angiogenesis, mesodermal induction in early embryos and limb regeneration. Antagonists against such polypeptides and their use as a therapeutic to prevent abnormal cellular proliferation, hyper-vascular diseases and epithelial lens cell proliferation are also disclosed. Diagnostic methods for detecting mutations in the coding sequence and alterations in the concentration of the polypeptides in a sample derived from a host are also disclosed.01-29-2009
20100184678USE OF A PEPTIDE AS A THERAPEUTIC AGENT - The present invention is directed to the use of the combination of the His-Pro-Leu-Gln-Lys-Thr-Tyr-OH and His-Ser-Asp-Gly-lle-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH07-22-2010
20090170766Chimeric Kunitz Domains and their Use - The present invention relates to chimeras of human tissue factor inhibitor domain 1 with natural and non-natural Kunitz domains, and their preparation and use.07-02-2009
20080242602Methods and Compositions For the Inhibition of Hiv-1 Replication - This invention relates to methods and compositions for the attenuation of HIV-1 replication in human cells, and especially in human macrophages. The invention particularly concerns the use of inhibitors of P21 (CDKN1A) expression to attenuate such replication. The invention particularly concerns the use of antisense P21 oligonucleotides, siRNA and/or 2-cyano-3,12-dioxooleana-1,9-dien28-oic (CDDO) to attenuate such replication.10-02-2008
20090325879CONTROLLED RELEASE COPOLYMER FORMULATION WITH IMPROVED RELEASE KINETICS - The present invention provides a constant release copolymer composition adapted for use in a controlled release formulation for a bioactive agent, such as a formulation adapted for implantation within a patient's body tissues as a depot to release the agent over a period of time, wherein the copolymer provides a substantially constant rate of release of the bioactive agent over the time period for which the depot persists in the body tissues. The copolymer includes a PLG copolymer and a PLG oligomer of about 5-10 kDa average molecular weight, which can lack free carboxylic acid groups. When the PLG copolymer is a low burst copolymer, the constant release copolymer composition is a low burst, constant release copolymer composition adapted for implantation in the body tissues of a mammal, wherein a substantially constant rate of release of the bioactive agent is achieved.12-31-2009
20090258833FORTIFIED LIQUID PROTEIN COMPOSITIONS AND METHODS OF MAKING SAME - A fortified liquid protein composition and method includes hydrolyzed collagen and a desired abundance of sulfur containing amino acids and optionally taurine.10-15-2009
20090291887Proteins of the SDF-1-Family for the Manufacturing of a Medicament - Use of a protein of the SDF-1-family for the manufacturing of a medicament for the improvement of the plasticity and/or regeneration of axons upon their lesion.11-26-2009
20100056442USE OF GPR101 RECEPTOR IN METHODS TO IDENTIFY MODULATORS OF HYPOTHALAMIC PROOPIOMELANOCORTIN (POMC)-DERIVED BIOLOGICALLY ACTIVE PEPTIDE SECRETION USEFUL IN THE TREATMENT OF POMC-DERIVED BIOLOGICALLY - The present invention relates to methods of using GPR101 G protein-coupled receptor (GPCR) to screen candidate compounds as modulators of hypothalamic proopiomelanocortin (POMC)-derived biologically active peptide secretion. Modulators of GPR101 receptor modulate hypothalamic POMC-derived biologically active peptide secretion and are useful in the treatment of POMC-derived biologically active peptide-related disorders. POMC-derived biologically active peptides include, but are not limited to, α-melanocyte stimulating hormone (α-MSH), β-melanocyte stimulating hormone (β-MSH) and γ-melanocyte stimulating hormone (γ-MSH). Agonists and partial agonists of GPR101 receptor stimulate hypothalamic α-MSH, β-MSH and γ-MSH secretion and are useful, for example, in the treatment and prevention of obesity and conditions related thereto (including but not limited to Type 2 diabetes, insulin resistance, and metabolic syndrome), inflammation-associated disorders, and pyrexia. Inverse agonists and antagonists of GPR101 receptor inhibit α-MSH, β-MSH and γ-MSH secretion and are useful, for example, in the treatment and prevention of disorders such as cachexia.03-04-2010
20080274961Use of compounds having the biological activity of vasoactive intestinal peptide for the treatment of sarcoidosis - The present invention relates to peptides which are highly biologically and pharmacologically active as therapeutic drug for the treatment of diseases related to sarcoidosis. The peptides which can be used according to the invention for the treatment of said disease comprise at least one specific highly conservative amino acid residue sequence which seem to play an important role in connection with pulmonary and arteriolar hypertension events. It could be shown that the known naturally occurring peptides “vasoactive intestinal peptide (VIP)” and “pituitary adenylate cyclase-activating polypeptide (PACAP)”, having these specific sequences are potent drugs which can be successfully used for treatment of sarcoidosis. Furthermore, the present invention discloses a method for the treatment patients suffering from sarcoidosis.11-06-2008
20100197594METHODS FOR USING SOY PEPTIDES TO INHIBIT H3 ACETYLATION, REDUCE EXPRESSION OF HMG-COA REDUCTASE AND INCREASE LDL RECEPTOR AND SP1 EXPRESSION IN A MAMMAL - Controlled studies demonstrate that methods using soy related peptides inhibit H3 acetylation, reduce expression of HMG-CoA reductase and increase LDL receptor and Sp1 expression in mammals. The present disclosure is generally directed to using lunasin peptides and/or lunasin peptide derivatives to 1) inhibit H3 acetylation, 2) reduce expression of HMG-CoA reductase, 3) increase LDL receptor expression or 4) increase Sp1 expression in a mammal. In at least one exemplary embodiment of the present disclosure, an effective amount of lunasin peptides or lunasin peptide derivatives and one or more enzyme inhibitors is provided to a mammal to 1) inhibit H3 acetylation, 2) reduce expression of HMG-CoA reductase, 3) increase LDL receptor expression or 4) increase Sp1 expression in a mammal. Additionally, lunasin will protect against, prevent, or reduce: 1) the expression of Matrix metalloproteinase (MMP-1), 2) collagen breakdown, 3) photoaging and 4) the formation of skin wrinkles.08-05-2010
20090298771USE OF SECRETED PROTEIN PRODUCTS FOR PREVENTING AND TREATING PANCREATIC DISEASES AND/OR OBESITY AND/OR METABOLIC SYNDROME - This invention relates to the use of secreted SF01-SF13 proteins, to the use of polynucleotides encoding these, and to the use of effectors/modulators thereof in the diagnosis, study, prevention, and treatment of pancreatic diseases (e.g. diabetes mellitus), obesity and/or metabolic syndrome and to the use in regeneration of tissues such as pancreatic tissues and others.12-03-2009
20090048158Insulin-Like Growth Factor Binding Protein-4 Compounds and Methods for Inhibiting Angiogenesis and Tumor Growth in Mammalian Cells - The use of fragments of IGFBP-4 for inhibiting angiogenesis and tumor growth is described.02-19-2009
20100056445ADIPONECTIN FOR THE TREATMENT AND DIAGNOSIS OF ALBUMINURIA - Disclosed are methods relating to the treatment and/or prevention of kidney disorders, especially kidney disorders characterized by or involving albuminuria. Methods described include the administration of an adiponectin polypeptide or a nucleic acid encoding such a polypeptide to treat or prevent the development of albuminuria. Also described are methods in which adiponectin is measured as a predictor of a subject's likelihood of having or developing a kidney disorder characterized by or involving albuminuria. Also described are methods of treating or preventing a kidney disorder involving administering an AMPK agonist and/or an inhibitor of Nox4 activity.03-04-2010
20090062187Use of Hmgb1 for Wound Healing - The present invention describes the role of HMGB1 in improving wound healing, in particular in a model of diabetes. Other evidences based on the effect of glycyrrhizin, the underexpression of HMGB1 in the skin and fibroblast of diabetic subjects, the accumulation of RAGE in the skin of diabetic mice and the chemoattractant properties of HMGB1 on normal and diabetic human cells demonstrate that HMGB1 can be advantageously utilized for preparing medicament specifically devoted to wound healing, in particular for diabetic subjects.03-05-2009
20090036382TGF-Beta Modulators and Use Thereof - The present invention relates to molecules preferably of polypeptide nature with negative regulatory activity on the amount or activity of TGF-β through direct interaction with pro-TGF-β, and containing as active region a cysteine-rich polypeptide sequence defined as “EMI domain”, or its subfragments, wherein said “EMI domain” has at least 25% sequence homology to the ID NO2 sequence for pharmaceutical use. Even more preferably said polypeptide sequence consists of the EMI domain of the following proteins: emilin-1, emilin-2 and/or multimerin-2 or their subfragments having a length of at least 6 amino acids, capable of inhibiting the conversion of pro-TGFβ to mature TGFβ as anti-hypertensive drugs and polypeptides active on the cardiovascular system. The invention extends to the use of molecules which are known to negatively regulate TGF-β and to molecules which interfere with TGF-β binding to its receptors, or to inhibitors of TGF-β mRNA synthesis or TGF-β expression for the same therapeutic uses as anti-hypertensive drugs and polypeptides active on the cardiovascular system.02-05-2009
20100184676USE OF A PEPTIDE AS A THERAPEUTIC AGENT - The present invention is directed to the use of the peptide compound Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH07-22-2010
20100062982AVIAN DERIVED FUSION PROTEINS - The invention encompasses among other things fusion proteins including Fc fusion proteins such as CTLA4-Fc having avian N-linked glycosylation patterns obtained from egg white of eggs laid by transgenic avians.03-11-2010
20090042783APO E ANALOGS AND METHODS FOR THEIR USE - Novel ApoE-protein transduction domain conjugates are disclosed which are useful for treating disorders including CNS inflammation, traumatic brain injury, cerebral ischema, Alzheimer's Disease and other brain disorders.02-12-2009
20090170768WATER-SOLUBLE CARBON NANOTUBE COMPOSITIONS FOR DRUG DELIVERY AND MEDICINAL APPLICATIONS - Compositions comprising a plurality of functionalized carbon nanotubes and at least one type of payload molecule are provided herein. The compositions are soluble in water and PBS in some embodiments. In certain embodiments, the payload molecules are insoluble in water. Methods are described for making the compositions and administering the compositions. An extended release formulation for paclitaxel utilizing functionalized carbon nanotubes is also described.07-02-2009
20100197578DEMANNOSYLATED RECOMBINANT FACTOR VIII [[VII]] FOR THE TREATMENT OF PATIENTS WITH HAEMOPHILIA A - There is provided in accordance with the practice of this invention a demannosylated Factor VIII, the immunogenicity of which is substantially decreased or abolished in Human. The modified factor VIII is disclosed together with the modified amino acid sequence, changed by at least one substitution. The modified factor VIII is useful for hemophiliacs, either to avoid or prevent the action of inhibitory anti-FVIII antibodies.08-05-2010
20090042781Methods for Treating Diabetes - Methods for treating diabetes by increasing the insulin secretion by administration of a GLP-1 receptor agonist and/or a DPP-IV inhibitor in combination with a proton pump inhibitor and optionally a PPAR agonist are provided.02-12-2009
20090143296METHODS AND COMPOSITIONS FOR THE REPAIR AND/OR REGENERATION OF DAMAGED MYOCARDIUM - Methods, compositions, and kits for repairing damaged myocardium and/or myocardial cells including the administration of cytokines are disclosed and claimed.06-04-2009
20090062202METHODS OF TREATING AND PREVENTING PRESSURE ULCERS WITH INTRADERMAL AND TRANSDERMAL DELIVERY OF CALCITONIN GENE-RELATED PEPTIDE (CGRP) - A method of treating ischemic skin pressure ulcers and helping such ulcers heal has the steps of a. debriding the ulcer as necessary to produce a clean, largely uncontaminated surface; and b. applying calcitonin gene-related peptide (CGRP) intradermally or transdermally to the periphery of the ulcer, the CGRP being administered at a dose below a vascular-affecting threshold, thereby enhancing ulcer healing with the anti-ischemic and tissue-healing properties of the CGRP. Also provided is a method of preventing, pressure ulcers of the skin in individuals prone thereto with the steps of a. providing a container with contents comprising CGRP and a vehicle, the CGRP container further comprising connectors for connection to an iontophoresis controller; b. connecting the CGRP container to the iontophoresis controller; c. applying the CGRP container to a body location known to be prone to pressure ulcers; and d. performing an electronic program for forcing CGRP through the skin.03-05-2009
20080207506Nucleotide and Protein Sequence of Mammastatin and Methods of Use - A nucleic acid sequence encoding Mammastatin, a specific mammary cell growth inhibitor. Mammastatin is encoded by a single nucleic acid sequence and has an approximate molecular weight of 44 kDa in its inactive, non-phosphorylated form. Normal mammary cells express functional phosphorylated forms having approximate molecular weights of 53 kDa and 49 kDa. Metastatic mammary cells either do not express Mammastatin at all, or do not express the 53 kDa or 49 kDa, phosphorylated forms. Mammary cancer cells are inhibited in their growth by the administration of phosphorylated mammastatin.08-28-2008
20090099069MODULATORS OF ALPHA-SYNUCLEIN TOXICITY - Disclosed are compositions and methods for modulating expression of genes that function at the step of ER of Golgi trafficking. Compounds that modulate expression of these genes of activity of the encoded proteins can be used to inhibit alpha-synuclein mediated toxicity and used to threat of prevent synucleinopathies such as Parkinson's disease. Also disclosed are methods of identifying inhibitors of alpha-synuclein mediated toxicity.04-16-2009
20100093632ENAMEL MATRIX PROTEIN COMPOSITION FOR TREATMENT OF SYSTEMIC INFLAMMATORY RESPONSE - The present invention relates to the use of a preparation of an active enamel matrix substance, such as an amelogenin, for the manufacture of a pharmaceutical composition for modulating an immune response. The composition can be used in preventing and/or treating a condition or disease in a mammal that is characterised by said mammal presenting an imbalance in its native immune response to an internal and/or external stimuli, i.e. wherein at least a part of said mammal's immune system is stimulated non-discriminatingly, reacts hypersensitively to said immunogen, or fails to react to said stimuli. Said condition can typically either be systemic or local, such as a systemic and/or post-traumatic whole-body inflammation or an autoimmune disease.04-15-2010
20100093633POLYPEPTIDES HAVING ANTIMICROBIAL ACTIVITY - The present invention relates to isolated polypeptides having antimicrobial activity. The invention also relates to polynucleotides encoding the polypeptides; and nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.04-15-2010
20100093634METHODS FOR REGULATING URINARY POTASSIUM - The internalization sequence at the C-terminal end of the ROMK protein has been identified and sequenced. It has been discovered determined that endocytosis is triggered by binding of the ROMK internalization sequence to ARH protein, which is co-localized and expressed with ROMK. New methods of treating or preventing hyperkalemia have been discovered that include administering to a patient who is at risk of developing hyperkalemia or who has hyperkalemia, a therapeutically effective amount of an agent that blocks the interaction of the ROMK internalization sequence with ARH protein, thereby preventing or reducing ARH-induced endocytosis of ROMK.04-15-2010
20100093630MAMMALIAN CHEMOKINES; RELATED REAGENTS - Novel CC chemokines from human, reagents related thereto including purified proteins, specific antibodies and nucleic acids encoding these chemokines are provided. Also provided are methods of making and using said reagents and diagnostic kits.04-15-2010
20100093631METHOD OF TREATING CRAVINGS BY ADMINISTRATION OF NERVE GROWTH FACTOR - A method for administering nerve growth factor to treat cravings is provided. Pharmaceutical compositions for the treatment of cravings comprising nerve growth factor are also provided.04-15-2010
20100093629GENES AND POLYPEPTIDES RELATING TO HUMAN PANCREATIC CANCERS - The present application provides novel human genes C1958V1 or C1958V2 whose expression is markedly elevated in pancreatic cancers compared to corresponding non-cancerous tissues. The genes and polypeptides encoded by the genes can be used, for example, in the diagnosis of pancreatic cancer, and as target molecules for developing drugs against the disease.04-15-2010
20100093626PEPTIDE AND SMALL MOLECULE AGONISTS OF EPHA AND THEIR USES IN DISEASE - A method of treating a neoplastic disorder in a subject includes administering to a Eph kinase expressing neoplastic cell of the subject being treated an EphA agonist and at least one immunosuppressant.04-15-2010
20100093624PEPTIDE THERAPEUTICS THAT BIND VEGF AND METHODS OF USE THEREOF - The present invention provides peptides and mimetics thereof that bind to VEGF. In preferred embodiments, the peptides of the invention are D type optical isomers which can bind VEGF and which can inhibit or reduce VEGF biological activity.04-15-2010
20100093623COMPOSITIONS AND METHODS FOR MODULATING NOD-LIKE RECEPTOR ACTIVITY AND USES THEREOF - Disclosed herein are compositions and methods relating to a peptide that inhibits Nod-like Receptors. Further provided are compositions and methods for treating or preventing inflammation, including diseases associated with inflammation such as inflammatory bowel disease, Crohn's disease, ulcerative colitis, arthritis, psoriasis, Alzheimer's disease, cardiovascular disease, diabetes, and sepsis.04-15-2010
20100093621SCGB3A2 AS A GROWTH FACTOR AND ANTI-APOPTOTIC AGENT - The present disclosure is generally related to methods of using the secretory protein SCGB3A2 for promoting lung development and treating lung disease. Some embodiments are, for example, methods for treating and inhibiting the development of neonatal respiratory distress. Other embodiments are methods of promoting lung development in damaged or diseased lungs. Also disclosed are methods for inhibiting lung damage due to anti-cancer agents.04-15-2010
20100093617Use - The present invention relates to the use of one or more cas genes for modulating resistance in a cell against a target nucleic acid or a transcription product thereof.04-15-2010
20100093625SMOOTHENED POLYPEPTIDES AND METHODS OF USE - Disclosed is an isolated or purified polypeptide or peptidomimetic comprising an amino acid sequence of a portion of a Smoothened (SMO) protein, wherein the portion comprises an amino acid sequence of any of the intracellular loops of the SMO protein, a functional fragment thereof, or a functional variant of either the portion or the functional fragment, wherein the functional fragment comprises at least 7 contiguous amino acids of the intracellular loops, and wherein the functional fragment or functional variant inhibits proliferation of a diseased cell, or a fatty acid derivative thereof. Related conjugates, nucleic acids, recombinant expression vectors, host cells, and pharmaceutical compositions are further provided. Methods of inhibiting proliferation of a diseased cell, treating or preventing cancer, treating a neoplasm or psoriasis, and inhibiting the expression of genes involved in the Hedgehog signaling pathway, thereby inhibiting the Hedgehog signaling pathway, are furthermore provided by the invention.04-15-2010
20100093619Insect Inhibition by Plant Serpin - The present invention relates to a method to limit damage by insects and mites in plants, by the use of endogenous plant proteinase inhibitors. More specifically, it relates to the use of serpins comprising an arginine residue in their reactive center loop, like 04-15-2010
20100093616Combination of EGF/GHRP-6 for Neurogeneration of Central Nervous System Following Autoimmune Damage - The present invention is directed to stimulate the neuroregeneration of the central nervous system due to autoimmune damage. In particular the pharmaceutical combination that comprise therapeutically effective concentrations of the Epidermal Growth Factor and the Growth Hormone Releasing Peptide-6, is administrated to a subject that suffers from symptoms of Multiple Sclerosis and Optic Neuromyelitis and corrects the demyelination caused by autoreactive cells in central nervous system.04-15-2010
20090131308Splice Variants of ErbB Ligands, Compositions and Uses Thereof - The present invention relates to nucleic acid and amino acid sequences of previously unknown ErbB ligands that are splice variants of previously known ErbB ligands, to compositions comprising these sequences and uses thereof in the diagnosis, treatment, and prevention of diseases and disorders mediated by ErbB receptors. Specifically, the present invention relates to splice variants lacking the C-loop of an intact EGF domain.05-21-2009
20090131319Human Tumor Necrosis Factor Receptor-Like 2 - The present invention relates to novel members of the Tumor Necrosis Factor family of receptors. The invention provides isolated nucleic acid molecules encoding a human TR2 receptor and two splice variants thereof. TR2 polypeptides are also provided as are vectors, host cells and recombinant methods for producing the same. The invention further relates to screening methods for identifying agonists and antagonists of TR2 receptor activity. Also provided are diagnostic methods for detecting disease states related to the aberrant expression of TR2 receptors. Further provided are therapeutic methods for treating disease states related to aberrant proliferation and differentiation of cells which express the TR2 receptors.05-21-2009
20090131312Non-natural chemokine receptor ligands and methods of use thereof - The present invention provides non-natural CXCR3 ligands comprising the N-loop region of the iTAC and polynucleotide encoding such non-natural CXCR3 ligands. The invention additionally provides methods of treating fÊbrotic disorders, angiogenic disorders, and cancer. The methods generally involve administering to an individual in need thereof an effective amount of a non-natural CXCR3 ligand of the invention.05-21-2009
20090131318Rational evolution of cytokines for higher stability, the cytokines and encoding nucleic acid molecules - Compositions of modified cytokines and uses thereof generated using processes and systems for the high throughput directed evolution of peptides and proteins, particularly cytokines that act in complex biological settings, are provided. Also provided are modified cytokines formulated for oral delivery and uses thereof to treat diseases and conditions mediated by cytokines.05-21-2009
20090131317COMPOUNDS AND PEPTIDES THAT BIND THE TRAIL RECEPTOR - The present invention relates to peptides and compounds that bind to a TRAIL receptor or otherwise act as a TRAIL receptor agonist, as well as methods of treating human diseases using the same. In addition, methods of synthesizing the peptides and compounds described herein are provided by the present invention.05-21-2009
20090131315Treatment of Subarachnoid Hemorrhage With APO E Analogs - Novel ApoE peptide derivatives and ApoE-protein transduction domain conjugates are disclosed which are useful for treating disorders including subarachnoid hemorrhage, intracerebral hemorrhage, and intraventricular hemorrhage and other brain disorders. The invention encompasses methods for treating cerebral vasospasm by administration of at least one ApoE or ApoE mimetic peptide.05-21-2009
20090131314Thrombospondin-1 Derived Peptides and Treatment Methods - Treatments employing the matricellular protein thrombospondin-1 (TSP-I) and related compositions are disclosed for stabilizing atherosclerotic plaque and decreasing occurrence of plaque rupture events leading to, for example, myocardial infarction, stroke, and acute limb ischemia. Various peptides, including certain synthetic peptides, related to TSP-I are also disclosed. Such peptides have utility in stabilizing plaque in various contexts, including the disease states mentioned above. Some of these peptides include one or more sequences related to active sites of TSP-I for regulating, e.g., TGF-ss1 and MMP-9 activity. Experimental data show that a representative peptide provides a beneficial effect with systemic injection of the peptide.05-21-2009
20090131311Method for Preventing Formation of Trisulfide Derivatives of Polypeptides - A method for reducing or substantially preventing formation of a trisulfide derivative of a polypeptide in a liquid medium containing the polypeptide ijn question comprises stripping the liquid medium with a gas, suitably a chemically unreactive gas such as nitrogen or argon.05-21-2009
20090131310Mucin3 egf-like domains - The invention provides for a mucin3 polypeptide, a polypeptide including a mucin3 EGF-like domain, and nucleic acids encoding such polypeptides. The invention also provides for methods of treating an individual that has or is at risk of developing a disease or condition of the alimentary canal using such polypeptides or nucleic acids.05-21-2009
20090253622USE OF TLR3 AGONISTS FOR THE TREATMENT OF NEURODEGENERATIVE DISORDERS - The present invention relates to a method for the treatment and/or prophylaxis of a degenerative inflammatory process in a tissue of a subject, said method comprising increasing the activity of Toll-like receptor 3 (TLR3) in cells of said tissue. In a preferred embodiment, the TLR3 agonist is stathmin or stathmin-like proteins such as SCGIO, SCLIP or RB3.10-08-2009
20100130422USE OF COCOA EXTRACT - A cocoa extract obtainable by the extraction of no