Entries |
Document | Title | Date |
20080199455 | Conformation specific antibodies that bind trefoil factors and methods of treating cancers and proliferation disorders using same - The present invention relates to conformation specific antibodies to TFF and compositions thereof. The present invention also relates to methods of regulation of cellular proliferation and/or survival, particularly methods for the treatment of cancers, tumors and proliferative disorders. | 08-21-2008 |
20080199456 | COMPOUNDS AND METHODS FOR TREATMENT AND DIAGNOSIS OF CHLAMYDIAL INFECTION - Compounds and methods for the diagnosis and treatment of Chlamydial infection are disclosed. The compounds provided include polypeptides that contain at least one antigenic portion of a | 08-21-2008 |
20080199457 | Anti-CD63 antibodies and methods of use thereof - CD63 inhibition of IgE-mediated degranulation in mast cells and in vivo inhibition of allergic processes are described. The invention is drawn to methods of treating allergic conditions and anaphylaxis in a mammal comprising administering an effective amount of an agent that inhibits a function of CD63. | 08-21-2008 |
20080199458 | INFLUENZA PREVENTION AND TREATMENT COMPOSITION - A composition for influenza treatment includes an immune enhancer and an anti-viral agent | 08-21-2008 |
20080206229 | Modified Antibodies Recognizing Receptor Trimers or Higher Multimers - The present invention provides tandem diabodies and triabodies against TRAIL receptors, wherein the tandem diabodies and triabodies exhibit greater cytotoxicity as single molecules than whole IgG antibodies. The present invention demonstrates that antibodies that enhance polymerization are useful when aiming to induce cell apoptosis via receptors such as TRAIL receptors, which require polymerization of receptor molecules on the surface of cell membranes to transduce cell death signals. | 08-28-2008 |
20080206230 | Peptides Derived from Human Bplp Protein, Polynucleotides Coding for Said Peptides and Antibodies Directed Against Said Peptides - The invention relates to a peptide that is a maturation product of the Basic Prolin-rich Lacrinal Protein (BPLP) or a peptide derivative of said maturation product, wherein the peptide or peptide derivative exhibits an inhibitory property against a metallo-ectopeptidase, especially NEP and/or APN. | 08-28-2008 |
20080206231 | Compositions and Methods for Treating Disease - The present invention discloses for the first time that the insulin receptor (IR) is a target of Herstatin, which modulates IR and IR-mediated intracellular signaling. In preferred aspects, Herstatin binds at nM concentrations to cell-surface IR, up-regulates basal IR expression by several-fold, induces the accumulation of pro-IR, and stimulates insulin activation of the ERK pathway. Moreover, these changes in insulin signaling are accompanied by alterations in IGF-IR expression, IRS-2 levels, and the serine phosphorylation state of both IRS-1 and IRS-2. Preferred aspects provide novel therapeutic methods and pharmaceutical compositions for treatment of conditions associated with altered IR expression or IR-mediated signaling, including but not limited to insulin resistance syndrome, pre-diabetic conditions, metabolic syndrome, type 1 and type 2 diabetes, cardiac disease, diabetes-associated vascular disease, atherosclerosis, hypertension, diabetes-associated lipid metabolism disorders (dyslipidemia), obesity, critical illness, neurodegenerative disorders, and combinations thereof, and cancer. | 08-28-2008 |
20080206232 | Compositions and Methods For Modulating Pgc-1Beta to Treat Lipid-Related Diseases and Disorders - The present invention provides methods for treating lipid-related diseases and disorders, e.g., hyperlipidemia, hyper-triglyceridemia, hypercholesterolemia, cardiovascular disease, obesity, and type II diabetes, and for modulating lipid biosynthesis, lipid transport, plasma triglyceride levels and/or plasma cholesterol levels, by modulating the expression or activity of PGC-1β. Methods for identifying compounds which are capable of treating or preventing a lipid-related disease or disorder are also described. | 08-28-2008 |
20080206233 | Heavy Chain And Single Domain Antibodies - The present invention relates to heavy chain immunoglobulins or fragments thereof of the VHH or VNAR type, or domain antibodies (dAbs) of the heavy or light chains of immunoglobulins or fragments thereof, suitable for use in the management of infections, in particular of the gastrointestinal tract. The present invention also relates to a delivery system comprising these heavy chain immunoglobulins or functional fragments thereof of the VHH or VNAR type, or domain antibodies (dAbs) of the heavy or light chains of immunoglobulins or fragments thereof, and hosts comprising expression vectors encoding for these heavy chain immunoglobulins or functional fragments thereof of the VHH or VNAR type, or domain antibodies (dAbs) of the heavy or light chains of immunoglobulins or fragments thereof. The invention also relates to food products and pharmaceutical preparations comprising the delivery system, and methods for the preparation of food products according to the invention. | 08-28-2008 |
20080206234 | COMPOSITIONS AND METHODS FOR THE THERAPY AND DIAGNOSIS OF BREAST CANCER - Compositions and methods for the therapy and diagnosis of cancer, particularly breast cancer, are disclosed. Illustrative compositions comprise one or more breast tumor polypeptides, immunogenic portions thereof, polynucleotides that encode such polypeptides, antigen presenting cell that expresses such polypeptides, and T cells that are specific for cells expressing such polypeptides. The disclosed compositions are useful, for example, in the diagnosis, prevention and/or treatment of diseases, particularly breast cancer. | 08-28-2008 |
20080206235 | COMPOSITIONS AND METHODS FOR STIMULATING AN IMMUNE RESPONSE - Compositions and methods for the stimulating, enhancing or promoting an immune response in a host are provided. One embodiment provides methods and compositions for stimulating, enhancing, or promoting an immune response in a host by administering an effective amount of a B7-H4 antagonist, preferably sH4 or variant thereof. Compositions of sH4 can be used to enhance an immune response to treat infection, cancer, or as part of a vaccine. | 08-28-2008 |
20080206236 | Polyclonal antibody product - The present invention relates to a composition comprising two or more sets of target-specific recombinant polyclonal antibodies, each set being capable of binding to a distinct target, wherein said distinct targets are related to diseases, which may be treated or prevented by the use of antibodies, and wherein said composition is essentially free from immunoglobulin molecules that do not bind to one of said distinct targets. Further the application describes pharmaceutical and diagnostic compositions comprising said composition and use in prevention, treatment and/or amelioration of one or more diseases. | 08-28-2008 |
20080213247 | Mbms as Modifiers of Branching Morphogenesis and Methods of Use - Human MBM genes are identified as modulators of branching morphogenesis, and thus are therapeutic targets for disorders associated with defective branching morphogenesis function. Methods for identifying modulators of branching morphogenesis, comprising screening for agents that modulate the activity of MBM are provided. | 09-04-2008 |
20080213248 | Methods and Systems for Treating Asthma and Other Respiratory Diseases - The subject invention provides methods for using TRPM8 receptors as a therapeutic target for identifying effective methods or compounds useful in the diagnosis or treatment of respiratory diseases or conditions. In certain embodiments, compositions that are identified using the methods of the invention are administered to a patient to diagnose or treat a respiratory disease or condition. In a preferred embodiment, TRPM8 receptor blockers are identified and administered, in accordance with the subject invention, to treat a patient with a respiratory disease, such as asthma. | 09-04-2008 |
20080213249 | Use of Retro-Aldol Reaction to Generate Reactive Vinyl Ketone for Attachment to Antibody Molecules by Michael Addition Reaction for Use in Immunostaining and Immunotargeting - The present invention is directed to methods for formation of a chemically programmed antibody comprising the steps of: (1) reacting a conjugate comprising a signal module covalently linked to a proadapter with a catalytic moiety selected from the group consisting of a catalytic antibody and a Fab fragment of a catalytic antibody, wherein the proadapter includes therein a precursor to a reactive moiety activated to a reactive moiety by a reaction catalyzed by the catalytic moiety; and (2) crosslinking the reactive moiety to a side chain of an amino acid residue in the active site of the catalytic moiety to produce the chemically programmed antibody. The invention also encompasses chemically programmed antibodies formed by these methods, methods for their use, and pharmaceutical compositions, as well as proadaptors and conjugates including them. Chemically programmed antibodies are useful for the treatment of cancer, particularly in metastasis. | 09-04-2008 |
20080213250 | Use of Eph Receptor Inhibitors for the Treatment of Neurodegenerative Diseases - The present invention relates to methods for the screening of gamma secretase modulators, preferably inhibitors as well as to the use of Eph receptor inhibitors for the treatment of neurodegenerative diseases. | 09-04-2008 |
20080213251 | HK1-BINDING PROTEINS - The invention features hK1 binding polypeptides as well as compositions comprising such polypeptides and methods of making and using such polypeptides. | 09-04-2008 |
20080213252 | METHODS OF TREATING ITCH - The invention provides methods for preventing and/or treating itch in a subject in need thereof by administration of a protease-activated G-protein coupled Protease Activated Receptor 4 (PAR4) antagonist. The PAR4 antagonist can be combined with a PAR2 antagonist. | 09-04-2008 |
20080213253 | COMBINATION THERAPY FOR THE TREATMENT OF CANCER - Disclosed are new methods for treatment of angiogenesis-related disorders. Angiogenesis-related disorders are treated by administration of a Tie1 ectodomain-binding agent and a vascular disrupting agent. | 09-04-2008 |
20080213254 | Bispecific molecules cross-linking ITIM and ITAM for therapy - The invention includes bispecific molecules capable of cross-linking ITAM and ITIM receptors on a cell in order to inhibit cell activation, as well as gene therapy approaches using nucleotides encoding such bispecific molecules for expression in vivo. One example of an ITAM/ITIM receptor pair is FcεRI and HM | 09-04-2008 |
20080213255 | DETERMINING AND REDUCING IMMUNORESISTANCE TO A BOTULINUM TOXIN THERAPY USING BOTULINUM TOXIN B PEPTIDES - The present invention provides BoNT/B peptides, BoNT/B peptide compositions, tolerogizing compositions, immune response inducing compositions, as well as methods of determining immunoresistance to botulinum toxin therapy in an individual, methods of treating immunoresistance to botulinum toxin therapy in an individual, methods of reducing anti-botulinum toxin antibodies in an individual and methods of inducing a BoNT/B immune response an individual. | 09-04-2008 |
20080219967 | Soluble lymphotoxin-beta receptors and anti-lymphotoxin receptor and ligand antibodies as therapeutic agents for the treatment of immunological diseases - Compositions and methods comprising “lymphotoxin-β receptor blocking agents” which block lymphotoxin-β receptor signaling and are useful for altering immunological diseases, and particularly antibody mediated immune responses. | 09-11-2008 |
20080219968 | Sos1 inhibitors - Inhibitors of human Sos1, including antisense oligonucleotides, methods, and compositions specific for human Sos1, are provided. Methods of using the compositions for modulating Sos1 expression and for regulating cell growth, particularly tumor cell growth, are also provided. | 09-11-2008 |
20080219969 | Concentrate of Chikungunya-Specific Immunoglobulins as a Medicinal Product - The invention concerns a new medicinal product for the treatment of chikungunya, i.e a concentrate of chikungunya-specific immunoglobulins, as well as its process of preparation. | 09-11-2008 |
20080219970 | IDENTIFICATION AND MOLECULAR CHARACTERISATION OF PROTEINS, EXPRESSED IN THE IXODES RICINUS SALIVARY GLANDS - The invention relates to a new polynucleotide which encodes a polypeptide expressed in the salivary glands of ticks, more particularly the | 09-11-2008 |
20080219971 | HUMAN ANTI-CD100 ANTIBODIES - Compositions and methods are provided for treating diseases associated with CD100, including certain types of cancers, autoimmune diseases, inflammatory diseases including central nervous system (CNS) and peripheral nervous system (PNS) inflammatory diseases, transplant rejections, and invasive angiogenesis. Compositions include anti-CD100 antibodies capable of binding to a soluble human CD100 antigen or a CD100 antigen located on the surface of a human CD100-expressing cell, wherein the antibody has CD100 blocking activity that is achieved by having at least one optimized CDR or FWR engineered within the variable region of the antibody. Compositions also include antigen-binding fragments, variants, and derivatives of the monoclonal antibodies, cell lines producing these antibody compositions, and isolated nucleic acid molecules encoding the amino acid sequences of the antibodies. The invention further includes pharmaceutical compositions comprising the anti-CD100 antibodies of the invention, or antigen-binding fragments, variants, or derivatives thereof, in a pharmaceutically acceptable carrier, and methods of use of these anti-CD100 antibodies. | 09-11-2008 |
20080219972 | Prostatic Acid Phosphatase (Pap) Materials and Methods of Use Thereof in the Prophylactic and Therapeutic Treatment of Prostate Cancer - A nucleic acid molecule comprising at least one nucleotide sequence encoding SEQ ID NO: 14, 15, 19, 41, or a sequence that is at least about 95% identical thereto; a composition comprising same and a method of administering same to induce an immune response; a polypeptide consisting of SEQ ID NO: 14, 15, 19, 41, or a sequence that is at least about 95% identical thereto; a composition comprising same and a method of administering same to induce an immune response; a composition comprising APC, which have been exposed to the polypeptide, and a method of administering same to treat prostate cancer; a composition comprising T-cells, which are specific for an epitope in a polypeptide consisting of SEQ ID NO: 14, 15, 19, or 41 and a method of administering same to treat prostate cancer; a composition comprising an anti-idiotypic antibody having an internal image of an epitope of a polypeptide consisting of SEQ ID NO: 14, 15, 19, or 41 and a method of administering same to treat prostate cancer; and an immortal B-cell line that produces an anti-idiotypic monoclonal antibody having an internal image of an epitope of a polypeptide consisting of SEQ ID NO: 14, 15, 19, or 41. | 09-11-2008 |
20080219973 | Pharmaceutical Composition Having Inhibitory Effect on Overproduction and Accumulation of Extracellular Matrix - A pharmaceutical composition having an inhibitory effect on the overproduction and the accumulation of extracellular matrix, said composition comprising as an active ingredient a compound that inhibits the biological activity of galectin-3, which pharmaceutical composition can serve as a therapeutic or preventive agent for glomerular nephritis, diabetic nephropathy or tissue fibrosis, as well as the use of said compound for the production of pharmaceuticals for the above-mentioned use, and a method for inhibition of the overproduction and accumulation of the extracellular matrix. | 09-11-2008 |
20080226618 | HYDANTOIN DERIVATIVES USEFUL AS ANTIBACTERIAL AGENTS - This invention relates to compounds of the Formula (I), | 09-18-2008 |
20080226619 | Anti-Muc1 Alpha/Beta Antibodies - The present invention provides antibodies that simultaneously bind the α- and β-subunits of an intact MUC1 protein, and methods for making and using such antibodies. | 09-18-2008 |
20080226620 | COMPOSITIONS AND METHODS FOR THE THERAPY AND DIAGNOSIS OF PROSTATE CANCER - Compositions and methods for the therapy and diagnosis of cancer, particularly prostate cancer, are disclosed. Illustrative compositions comprise one or more prostate-specific polypeptides, immunogenic portions thereof, polynucleotides that encode such polypeptides, antigen presenting cell that expresses such polypeptides, and T cells that are specific for cells expressing such polypeptides. The disclosed compositions are useful, for example, in the diagnosis, prevention and/or treatment of diseases, particularly prostate cancer. | 09-18-2008 |
20080226621 | ANTAGONIST ANTI-NOTCH3 ANTIBODIES AND THEIR USE IN THE PREVENTION AND TREATMENT OF NOTCH3-RELATED DISEASES - The present invention relates to antagonist antibodies that specifically bind to Notch 3 and inhibit its activation. The present invention includes antibodies binding to a conformational epitope comprising the first Lin12 domain and the second dimerization domain. The present invention also includes uses of these antibodies to treat or prevent Notch 3 related diseases or disorders. | 09-18-2008 |
20080226622 | Hif Inhibitors - HIF-1 inhibitors and methods of use thereof are provided. | 09-18-2008 |
20080226623 | Stabilized protein crystals, formulations comprising them and methods of making them - This invention relates to methods for the stabilization, storage and delivery of biologically active macromolecules, such as proteins, peptides and nucleic acids. In particular, this invention relates to protein or nucleic acid crystals, formulations and compositions comprising them. Methods are provided for the crystallization of proteins and nucleic acids and for the preparation of stabilized protein or nucleic acid crystals for use in dry or slurry formulations. The present invention is further directed to encapsulating proteins, glycoproteins, enzymes, antibodies, hormones and peptide crystals or crystal formulations into compositions for biological delivery to humans and animals. According to this invention, protein crystals or crystal formulations are encapsulated within a matrix comprising a polymeric carrier to form a composition. The formulations and compositions enhance preservation of the native biologically active tertiary structure of the proteins and create a reservoir which can slowly release active protein where and when it is needed. Methods are provided preparing stabilized formulations using pharmaceutical ingredients or excipients and optionally encapsulating them in a polymeric carrier to produce compositions and using such protein crystal formulations and compositions for biomedical applications, including delivery of therapeutic proteins and vaccines. Additional uses for the protein crystal formulations and compositions of this invention involve protein delivery in human food, agricultural feeds, veterinary compositions, diagnostics, cosmetics and personal care compositions. | 09-18-2008 |
20080226624 | Combined treatment of cancer by urokinase inhibition and a cytostatic anti-cancer agent for enhancing the anti-metastatic effect - The present invention relates to a combined treatment of cancer using a urokinase inhibitor and a cytotoxic or a cytostatic agent. | 09-18-2008 |
20080226625 | Stable non- aqueous single phase viscous vehicles and formulations utlizing such vehicles - This invention relates to stable non-aqueous single phase viscous vehicles and to formulations utilizing such vehicles. The formulations comprise at least one beneficial agent uniformly suspended in the vehicle. The formulation is capable of being stored at temperatures ranging from cold to body temperature for long periods of time. The formulations are capable of being uniformly delivered from drug delivery systems at an exit shear rate of between about 1 to 1×10 | 09-18-2008 |
20080233105 | Compositions and methods for preventing or treating a viral infection - The present invention is a composition for enhancing the immunogenicity of viral vaccine. The composition encompasses a viral vaccine in combination with at least one toll-like receptor and, in particular embodiments, an anti-CD40 antibody. The compositions of the instant invention find application in the prevention or treatment of a viral infection. | 09-25-2008 |
20080233106 | Markers for labour - The invention relates to markers which find use in the diagnosis of labour or pre-term labour, to assays comprising such markers, to methods of identifying therapeutic agents which can prolong pregnancy, using these markers and to methods of treatment of pre-term labour, methods of prolonging gestation, or methods of suppressing labour contractility based on the markers. | 09-25-2008 |
20080233107 | SELECTIVE DELIVERY OF MOLECULES INTO CELLS OR MARKING OF CELLS IN DISEASED TISSUE REGIONS USING ENVIRONMENTALLY SENSITIVE TRANSMEMBRANE PEPTIDE - A polypeptide with a predominantly hydrophobic sequence long enough to span a membrane lipid bilayer as a transmembrane helix (TM) and comprising one or more dissociable groups inserts across a membrane spontaneously in a pH-dependant fashion placing one terminus inside cell. The polypeptide conjugated with various functional moieties delivers and accumulates them at cell membrane with low extracellular pH. The functional moiety conjugated with polypeptide terminus placed inside cell are translocated through the cell membrane in cytosol. The peptide and its variants or non-peptide analogs can be used to deliver therapeutic, prophylactic, diagnostic, imaging, gene regulation, cell regulation, or immunologic agents to or inside of cells in vitro or in vivo in tissue at low extracellular pH. The claimed method provides a new approach for diagnostic and treatment diseases with naturally occurred (or artificially created) low pH extracellular environment such as tumors, infarction, stroke, atherosclerosis, inflammation, infection, or trauma. The method allows to translocate cell impermeable molecules (peptides, toxins, drugs, inhibitors, nucleic acids, peptide nucleic acids, imaging probes) into cells at low pH. The method allows to attach to the cell surface a variety of functional moieties and particles including peptides, polysaccharides, virus, antigens, liposomes and nanoparticles made of any materials. | 09-25-2008 |
20080233108 | METHODS FOR DETECTING AND INHIBITING ANGIOGENESIS USING ANTAGONISTS - The present invention provides methods for reducing or inhibiting angiogenesis in a tissue, by contacting α5β1 integrin in the tissue with an agent that interferes with specific binding of the α5β1 integrin to a ligand expressed in the tissue; and methods of identifying angiogenesis in a tissue, by contacting the tissue with an agent that specifically binds α5β1 integrin, and detecting specific binding of the agent to α5β1 integrin associated with a blood vessel in the tissue. Also provided are methods of diagnosing a pathological condition characterized by angiogenesis in a tissue in an individual. The invention further provides methods of reducing or inhibiting angiogenesis in a tissue in an individual, by administering to the individual an agent that interferes with the specific binding of α5β1 integrin to a ligand expressed in the tissue; and methods of reducing the severity of a pathological condition associated with angiogenesis in an individual, by administering to the individual an agent that interferes with specific binding of α5β1 integrin to a ligand in a tissue associated with the pathological condition. The invention also provides methods of identifying an agent that reduces or inhibits angiogenesis associated with α5β1 integrin expression in a tissue by contacting a tissue exhibiting angiogenesis associated with α5β1 integrin expression with an agent, and detecting a reduction or inhibition of angiogenesis in the tissue. | 09-25-2008 |
20080233109 | Transgenic mammal carrying GANP gene transferred thereinto and utilization thereof - It is an object of the present invention to provide a high affinity antibody effective as a diagnostic or therapeutic for various diseases; a transgenic mammal for producing the high affinity antibody; and a medicine comprising the high affinity antibody or a cell producing the high affinity antibody. According to the present invention, a transgenic mammal carrying a GANP gene transferred thereinto, its progeny, or a part thereof, and a method of producing a high affinity antibody using the same are provided. | 09-25-2008 |
20080233110 | Intrabodies with defined framework that is stable in a reducing environment and applications thereof - A method for the isolation of CDRs in a defined framework that is stable and soluble in reducing environment is described as well as thus obtainable scFv. Starting from such scFv with defined framework a scFv library can be generated wherein the framework is conserved while at least one complementary determining region (CDR) is randomized. Such library, e.g. in yeast cells, is suitable for screening for antibody/CDR-interactions or for screening for antibodies. | 09-25-2008 |
20080233111 | HUMAN RECEPTOR PROTEINS; RELATED REAGENTS AND METHODS - Nucleic acids encoding mammalian, e.g., primate or rodent receptors, purified receptor proteins and fragments thereof. Antibodies, both polyclonal and monoclonal, are also provided. Methods of using the compositions for both diagnostic and therapeutic utilities are provided. | 09-25-2008 |
20080241124 | Human G-Protein Chemokine Receptor (CCR5) HDGNR10 - Human G-protein chemokine receptor polypeptides and DNA (RNA) encoding such polypeptides and a procedure for producing such polypeptides by recombinant techniques is disclosed. Also disclosed are methods for utilizing such polypeptides for identifying antagonists and agonists to such polypeptides and methods of using the agonists and antagonists therapeutically to treat conditions related to the underexpression and overexpression of the G-protein chemokine receptor polypeptides, respectively. Also disclosed are diagnostic methods for detecting a mutation in the G-protein chemokine receptor nucleic acid sequences and detecting a level of the soluble form of the receptors in a sample derived from a host. | 10-02-2008 |
20080241125 | MUC1-IKB KINASE COMPLEXES AND THEIR ACTIVITIES - The disclosure provides methods of identifying and making compounds and pharmaceutical compositions containing the compounds that inhibit the interaction between MUC1 and an IKK. The disclosure also provides in vivo and in vitro methods of inhibiting such an interaction. Also embraced by the disclosure are in vitro and in vivo methods of inhibiting the IKK/NF-κB pathway in cells expressing MUC1. The compounds, compositions, and methods of the disclosure are generally useful in the treatment of various cancers, inflammatory (e.g., autoimmune disorders), and transplant rejection. | 10-02-2008 |
20080241126 | Nucleic acids encoding Human Engineered heavy and light chain variable region sequences to Ep-CAM - Human engineered anti-Ep-CAM antibodies and various uses therefore are disclosed. These human engineered anti-Ep-CAM antibodies have high affinity binding to Ep-CAM with low immunogenicity. | 10-02-2008 |
20080241127 | Methods of Making Passive Immunotherapies - Methods for isolating antibodies useful as passive immunotherapies are described. | 10-02-2008 |
20080241128 | Beta-Glucuronide-Linker Drug Conjugates - Ligand Drug conjugate compounds comprising a β-glucuronide-based linker and methods of using such compounds are provided. | 10-02-2008 |
20080241129 | ADIPOCYTE SECRETED PROTEIN CCDC80 IS A POTENT STIMULATOR OF BONE FORMATION - Disclosed herein are methods of using Ccdc80, Ccdc80 mimics, or Ccdc80 agonists or antagonists in the treatment of bone disorders. | 10-02-2008 |
20080241130 | METHODS AND COMPOSITIONS FOR MODULATING IL-17F/IL-17A BIOLOGICAL ACTIVITY - The invention provides a novel mouse IL-17F/IL-17A, and further provides uses of such mouse IL-17F/IL-17A in the characterization of the IL-17F/IL-17A heterodimer. The present invention is also related to polynucleotides and polypeptides of the IL-17F/IL-17A signaling pathway, and targeting of the IL-17F/IL-17A signaling pathway in methods of treating IL-17F/IL-17A-associated disorders. The invention thus provides methods of using isolated IL-17F/IL-17A heterodimer, e.g., in a mouse model of airway inflammation, and specific or selective IL-17F/IL-17A modulators (e.g., signaling agonists or signaling antagonists (e.g., specific or selective antagonistic antibodies, specific or selective antagonistic small molecules, etc.)). The invention also provides methods of screening for compounds capable of modulating IL-17F/IL-17A biological activity, e.g., IL-17F/IL-17A signaling antagonists (e.g., using the mouse model of airway inflammation), as well as methods of identifying whether the IL-17F/IL-17A modulator is a specific IL-17F/IL-17A modulator. The invention is also directed to novel methods for diagnosing, prognosing, monitoring, preventing, and/or treating IL-17F/IL-17A-associated disorders, including, but not limited to, inflammatory disorders (e.g., arthritis (including rheumatoid arthritis), psoriasis, systemic lupus erythematosus, and multiple sclerosis), respiratory diseases (e.g., airway inflammation, chronic obstructive pulmonary disease, cystic fibrosis, asthma, allergy), transplant rejection (including solid organ transplant rejection), and inflammatory bowel diseases or disorders (e.g., ulcerative colitis, Crohn's disease). The present invention is further directed to novel therapeutics and therapeutic targets identified by methods of screening of the invention, and uses of such identified therapeutics in methods of treatment and prevention of IL-17F/IL-17A-associated disorders. | 10-02-2008 |
20080241131 | SPHKS as modifiers of the p53 pathway and methods of use - Human SPHK genes are identified as modulators of the p53 pathway, and thus are therapeutic targets for disorders associated with defective p53 function. Methods for identifying modulators of p53, comprising screening for agents that modulate the activity of SPHK are provided. | 10-02-2008 |
20080241132 | BRAF Mutation T1796A in Thyroid Cancers - The BRAF gene has been found to be activated by mutation in human cancers, predominantly in malignant melanoma. We tested 476 primary tumors, including 214 lung, 126 head and neck, 54 thyroid, 27 bladder, 38 cervical, and 17 prostate cancers, for the BRAF T1796A mutation by polymerase chain reaction (PCR)-restriction enzyme analysis of BRAF exon 15. In 24 (69%) of the 35 papillary thyroid carcinomas examined, we found a missense thymine (T)→adenine (A) transversion at nucleotide 1796 in the BRAF gene (T1796A). The T1796A mutation was detected in four lung cancers and in six head and neck cancers but not in bladder, cervical, or prostate cancers. Our data suggested that activating BGRAF mutations may be an important even in the development of papillary thyroid cancer. Moreover, BRAF mutation reliably predicts a poor prognosis for papillary thyroid carcinomas. | 10-02-2008 |
20080241133 | Novel 25869, 25934, 26335, 50365, 21117, 38692, 46508, 16816, 16839, 49937, 49931 and 49933 molecules and uses therefor - The invention provides isolated nucleic acids molecules, designated 25869, 25934, 26335, 50365, 21117, 38692, 46508, 16816, 16839, 49937, 49931 and 49933 nucleic acid molecules. The invention also provides antisense nucleic acid molecules, recombinant expression vectors containing 25869, 25934, 26335, 50365, 21117, 38692, 46508, 16816, 16839, 49937, 49931 or 49933 nucleic acid molecules, host cells into which the expression vectors have been introduced, and nonhuman transgenic animals in which a 25869, 25934, 26335, 50365, 21117, 38692, 46508, 16816, 16839, 49937, 49931 or 49933 gene has been introduced or disrupted. The invention still further provides isolated 25869, 25934, 26335, 50365, 21117, 38692, 46508, 16816, 16839, 49937, 49931 or 49933 proteins, fusion proteins, antigenic peptides and anti-25869, 25934, 26335, 50365, 21117, 38692, 46508, 16816, 16839, 49937, 49931 or 49933 antibodies. Diagnostic and therapeutic methods utilizing compositions of the invention are also provided. | 10-02-2008 |
20080248022 | Therapeutic Strategy for Treating Autoimmune and Degenerative Diseases - Numerous diseases have been linked to the production of effector cells. The present invention relates to the realization that effector cells are cycling in these diseases. In addition, the present invention relates to the determination that regulator cells are cycling in degenerative diseases. Based on these realizations, the present invention provides methods for treating conditions such as autoimmune diseases, degenerative diseases, and graft-versus-host disease. The present invention also relates to methods of determining when therapy should be administered to a patient. | 10-09-2008 |
20080248023 | PREVENTION AND TREATMENT OF AMYLOIDOGENIC DISEASES - Disclosed are pharmaceutical compositions and methods for preventing or treating a number of amyloid diseases, including Alzheimer's disease, prion diseases, familial amyloid neuropathies and the like. The pharmaceutical compositions include immunologically reactive amounts of amyloid fibril components, particularly fibril-forming peptides or proteins. Also disclosed are therapeutic compositions and methods which use immune reagents that react with such fibril components. | 10-09-2008 |
20080248024 | THERAPEUTIC AGENT FOR CANCER, INFLAMMATION, AND AUTO-IMMUNE DISEASE CONTAINING INHIBITOR OF ZINC FINGER PROTEIN 91 - The present invention relates to a use of ZFP91 based on the functions of ZFP91 (Zinc Finger Protein 91) and the interaction of ZFP91 with NF-κB (Nuclear factor kappa B) signal transduction pathway proteins, more precisely a method to inhibit the activation of NF-κB alternative pathway by regulating ZFP91 activation, to inhibit tumor growth by inhibiting the transcription factor HIF-1 (hypoxia inducible factor-1) activation, to inhibit cancer malignancy by inhibiting angiogenesis, or reversely a method to increase the activation of NF-κB alternative pathway or to increase angiogenesis by increasing activation of HIF-1. The method of regulating ZFP91 activation of the present invention can increase or reduce HIF-1α stability by increasing or reducing the activation of NF-κB alternative pathway, so that it can be effectively used for the development of an anticancer agent, a therapeutic agent for arthritis, a therapeutic agent for ulcerative colitis, an anti-inflammatory agent and an angiogenesis inducer. | 10-09-2008 |
20080248025 | Gamma Delta T Cells and Methods of Treatment of Interleukin-17 Related Conditions - This invention generally relates to methods to treat conditions and diseases associated with interleukin-17 (IL-17) production. The invention also relates to methods of inhibiting γδ T cells, and particularly, a subset of γδ T cells that produce IL-17. | 10-09-2008 |
20080248026 | PTEN/Akt methods and compositions relating to BMP - The present invention relates to a purified molecules, including antibodies, that bind specifically to murine β-catenin phosphorylated at amino acid position Serine | 10-09-2008 |
20080248027 | Method of enhancing intestinal pinocytosis of immunoglobulins in postnatal domestic mammals - Disclosed is a method of enhancing absorption (pinocytosis efficiecy) of immunoglobulins administered to postnatal domestic mammals (e.g., bovine) by using selenium. As an example of a selenium compound added, sodium selenite is particularly effective. | 10-09-2008 |
20080254020 | Therapeutic Peptides - The invention relates to compounds that exhibit improved bioefficacy in multidose administration. More specifically, the invention relates to polypeptides or peptides modified to include an antibody Fc region and one or more water soluble polymers. | 10-16-2008 |
20080254021 | TIE1-BINDING LIGANDS - Tie1 is a receptor tyrosine kinase protein that includes a transmembrane domain. Tie1 is present on endothelial cells. This disclosure described antibodies that bind to Tie1, including ones that inhibit endothelial cell activity. | 10-16-2008 |
20080260717 | Methods for Reducing Seizure-Induced Neuronal Damage - This invention provides a method for treating a subject either during or soon after a seizure, in order to reduce the extent of neuronal damage in the subject resulting from the seizure comprising administering to the subject, either during or soon after the seizure, a therapeutically effective amount of an inhibitor of receptor for advanced glycation endproducts (RAGE), so as to thereby reduce the extent of neuronal damage in the subject. This invention further provides a method for inhibiting neuronal damage which would otherwise result from a seizure in a subject predisposed to having a seizure, comprising administering to the subject a prophylactically effective amount of an inhibitor of receptor for advanced glycation endproducts (RAGE), so as to inhibit neuronal damage which would otherwise result from a seizure in the event the subject were to suffer a seizure. | 10-23-2008 |
20080260718 | Phospholipase C Gamma Modulation and Uses Thereof for Management of Pain and Nociception - The present invention provides methods of preventing and treating pain, by modulating, e.g. inhibiting, the activity, function and/or expression of a PLC | 10-23-2008 |
20080260719 | EDG: Modulators of lymphocyte activation and migration - The present invention relates to regulation of lymphocyte activation and migration. More particularly, the present invention is directed to nucleic acids encoding EDG family GPCR proteins, e.g., EDG-1, 2, 3, 4, 5, 6, 7, or 8, which are involved in modulation of lymphocyte activation and migration. The invention further relates to methods for identifying and using agents, including small organic molecules, antibodies, peptides, cyclic peptides, nucleic acids, antisense nucleic acids, sphingolipid analogs, and ribozymes, that modulate lymphocyte activation or migration via modulation of EDG GPCRs and EDG related signal transduction; as well as to the use of expression profiles and compositions in diagnosis and therapy related to lymphocyte activation and suppression, and lymphocyte migration. | 10-23-2008 |
20080260720 | Systems and Methods for Inhibiting Metastasis - The present invention relates to compositions and methods for cancer therapeutics. In particular, the present invention provides compositions and methods for inhibiting cancer metastasis by inhibiting G12 and G13 activity. | 10-23-2008 |
20080260721 | Nucleic acids encoding a mammalian raptor polypeptide and uses therefor - The present invention relates to isolated raptor nucleic acid molecules of mammalian origin (e.g., human) and complements, portions and variants thereof. Another aspect of the invention are isolated raptor polypeptides of mammalian origin and portions thereof, and antibodies or antigen binding fragments thereof that specifically bind a raptor polypeptide. The present invention also relates to constructs and host cells comprising the nucleic acid molecules described herein. In addition, the present invention relates to uses of the nucleic acid and polypeptide molecules provided herein. | 10-23-2008 |
20080260722 | Method for High Efficiency Survival/Proliferation of Human Embyonic Stem Cells and Human Embryo Survival in Culture - The present invention provides a role for neurotrophins in hES cell survival and important new insights into the molecular mechanisms controlling the growth of these cells. Although previous studies identified growth factors that affect self-renewal of hES cells, the novelty of the present invention is the identification of factors that act through specific receptors present on hES cells and activate the receptors at physiological concentrations to promote survival and proliferation. | 10-23-2008 |
20080260723 | Method of Treatment and Bioassay Involving Macrophage Migration Inhibitory Factor (MIF) as Cardiac-Derived Myocardial Depressant Factor - One embodiment of the present invention relates to a pharmaceutical composition, which includes a therapeutically effective amount of at least one anti-MIF antibody; and at least one pharmaceutically acceptable carrier. Another embodiment of the present invention relates to a pharmaceutical composition, which includes a therapeutically effective amount at least one anti-CD74 antibody; and at least one pharmaceutically acceptable carrier. Another embodiment of the present invention relates to a pharmaceutical composition, which includes a therapeutically effective amount of at least one anti-TNFR antibody; a therapeutically effective amount of at least one anti-MIF antibody; and at least one pharmaceutically acceptable carrier. Other embodiments of the present invention relate to methods of treating or preventing cardiac dysfunction, cardiodepression, burn injury-associated cardiac dysfunction, improving cardiac function in a subject following acute myocardial infarction, and identifying an MIF inhibitor. | 10-23-2008 |
20080260724 | Drug Induced Exposure Of The Fungal Pro-Inflammatory Molecule Beta-Glucan - Methods and reagents for screening for anti-microbial agents are provided. Diagnostic tools for assessing treatment of fungal infections are provided. Antimicrobial substances including substances useful for the treatment of fungal infections are provided. In some embodiments, the substances have antigen unmasking activity. In some embodiments the substances have fungicidal activity and surface antigen unmasking activity. | 10-23-2008 |
20080260725 | Tag and target delivery system - A system for targeting dividing cells and delivering therapeutic agents to the targeted cells using a Tag nanoparticle. Each Tag nanoparticle comprises a nucleotide encoding a Tag, which is expressed only in dividing cells. The system optionally utilizes a microparticle to deliver Tag nanoparticles to cells. Therapeutic nanoparticles comprising therapeutic compounds are subsequently targeted to the tagged cells via surface molecules that specifically bind to the Tag. The system may be adapted for specific patient needs, for example, targeting and eliminating cancer cells, preventing metastasis and secondary tumors, stimulating or inhibiting proliferation of endothelial cells, and stimulating cell regeneration in diseased organs such as liver. | 10-23-2008 |
20080260726 | Organic Compounds - A method of identifying a substance suitable for use in inhibiting mucus hypersecretion that modulates the activity of a human cathepsin C gene or its gene product. The method involves combining a candidate substance with the human cathepsin C gene or its gene product and measuring the effect of the candidate substance on the activity of the gene or its gene product. | 10-23-2008 |
20080267945 | Salts of Isophosphoramide Mustard and Analogs Thereof as Anti-Tumor Agents - The present disclosure relates to salts and compositions of isophosphoramide mustard and isophosphoramide mustard analogs. In one embodiment the salts can be represented by the formula | 10-30-2008 |
20080267946 | Pharmaceutical Composition for Treating Avellino Cornea Dystrophy Comprising an Antibody Against Tgf-Beta - The present invention relates to a medicine for treating Avellino corneal dystrophy (ACD), and more particularly, to a pharmaceutical composition for treating Avellino corneal dystrophy containing an antibody against TGF-β as an effective ingredient. The pharmaceutical composition of the present invention has an effect of improving symptoms of a patient with severe Avellino corneal dystrophy due to TGF-β induced by exposure to intense light, such as UV etc. | 10-30-2008 |
20080267947 | Cancer therapy with cantharidin and cantharidin analogs - Provided are methods for treating cancer in a patient, comprising administration of a therapeutically effective regimen of cantharidin or cantharidin analog of formula of formula I, II or III | 10-30-2008 |
20080267948 | Croos-B Structure Binding Compounds - The invention relates to the field of biochemistry, biophysical chemistry, molecular biology, structural biology and medicine. More in particular, the invention relates to cross-β structure conformation. Even more particular, the invention relates to compounds capable of binding to a compound with cross-β structure conformation, i.e. cross-β structure binding compounds and uses thereof. | 10-30-2008 |
20080267949 | Peptides capable of binding to serum proteins - The present invention relates to amino acid sequences that are capable of binding to serum proteins; to compounds, proteins, polypeptides, fusion proteins or constructs comprising or essentially consisting of such amino acid sequences; to nucleic acids that encode such amino acid sequences, compounds, proteins, polypeptides, fusion proteins or constructs; to compositions, and in particular pharmaceutical compositions, that comprise such amino acid sequences, compounds, proteins, polypeptides, fusion proteins or constructs; and to uses of such amino acid sequences, compounds, proteins, polypeptides, fusion proteins or constructs. | 10-30-2008 |
20080267950 | Molecular determinants of myeloma bone disease and uses thereof - The present invention is drawn to understanding lytic bone diseases. In this regard, the present invention discloses mechanism by which Wnt signaling antagonist inhibits bone differentiation. Also disclosed herein are methods to control bone loss, treat bone disease and prevent tumor growth in bones of individual. | 10-30-2008 |
20080274098 | Method of Treating or Preventing Tissue Deterioration, Injury or Damage Due to a Neuro-, Muscular- or Neuro-Muscular-Degenerative Disease, or Restore Tissue Adversely Affected by Said Disease - A method of treatment for treating, preventing, inhibiting or reducing tissue deterioration, injury or damage due to a neuro-, muscular- or neuro-muscular-degenerative disease, or for restoring tissue adversely affected by said disease, in a subject, includes administering to a subject in need of such treatment an effective amount of a composition including a peptide agent including amino acid sequence LKKTET or LKKTNT, a conservative variant thereof, or a peptide agent that stimulates production of an LKKTET or LKKTNT peptide, or a conservative variant thereof, in the tissue. | 11-06-2008 |
20080274099 | ANTIBODIES OF THE ED-B DOMAIN OF FIBRONECTIN, THEIR CONSTRUCTION AND USES - According to the present invention there is provided a specific binding member which is specific for and binds directly to the ED-B oncofoetal domain of fibronectin (FN). The invention also provides materials and methods for the production of such binding members. | 11-06-2008 |
20080274100 | ANTIBODIES AND USES THEREOF - The present invention provides antibodies or fragments thereof that bind to co-receptor CCR5 or CXCR4. | 11-06-2008 |
20080274101 | STABILIZING POLYPEPTIDES WHICH HAVE BEEN EXPOSED TO UREA - Methods for stabilizing polypeptides, such as anti-HER2 antibodies, which have been exposed to urea. | 11-06-2008 |
20080279844 | Methods for Treating Cancer Targeting Transglutaminase - A method for treating cancer comprising inhibiting transglutaminase activity is provided. Suitable cancer types for which the methods of the present disclosure can be used to treat include, but are not limited to, pancreatic, breast, and ovarian cancers and melanoma. The inhibition of transglutaminase activity may be performed by one or more techniques, including, but not limited to, downregulating transglutaminase expression, inhibiting TG2 translation, or blocking TG2 enzymatic activity, such as with a small molecule inhibitor or intracellular antibody (intrabody). | 11-13-2008 |
20080279845 | COMBINATION THERAPY WITH A COMPOUND ACTING AS A PLATELET ADP RECEPTOR INHIBITOR - The present invention is directed to pharmaceutical compositions and methods of using combination therapies containing [4-(6-fluoro-7-methylamino-2,4-dioxo-1,4-dihydro-2H-quinazolin-3-yl)-phenyl]-5-chloro-thiophen-2-yl-sulfonylurea, or a pharmaceutically acceptable salt thereof, for the treatment of thrombosis diseases. | 11-13-2008 |
20080279846 | METHODS OF TREATMENT AND PREVENTION OF NEURODEGENERATIVE DISEASES AND DISORDERS - The present invention provides compostions and methods useful for treating and preventing neurodegenerative disease and neurologically related disorders by inhibition of Lp-PLA2. The compositions and methods are useful for treating and preventing diseases and disorders with abnormal blood brain barrier (BBB) function, for example neurodegenerative diseases with a permeable BBB, such as but not limited to, Alzheimer's Disease, Huntington's Disease, Parkinson's Disease and Vascular Dementia. | 11-13-2008 |
20080286260 | Diagnostic and Therapeutics for Diseases Associated with Peroxisome Proliferative Activated Receptor Alpha (Ppara) - The invention provides a human PPARA which is associated with the cardiovascular diseases, gastroenterological diseases, cancer, inflammation, hematological diseases, respiratory diseases, neurological diseases and urological diseases. The invention also provides assays for the identification of compounds useful in the treatment or prevention of cardiovascular diseases, gastroenterological diseases, cancer, inflammation, hematological diseases, respiratory diseases, neurological diseases and urological diseases. The invention also features compounds which bind to and/or activate or inhibit the activity of PPARA as well as pharmaceutical compositions comprising such compounds. | 11-20-2008 |
20080286261 | Methods of modulating hair growth - The invention features methods of promoting hair growth in a subject. The methods include inducing or mimicking the effects of Wnt promoted signal transduction, e.g., by increasing the level of Wnt protein or administering an agent which mimics an effect of Wnt promoted signal transduction, e.g., by administering lithium chloride. Methods of inhibiting hair growth are also provided. | 11-20-2008 |
20080286262 | Photosensitizers for Photodynamic Therapy at Infrared Excitation - A photosensitizer that is excitable via infrared radiation and is adapted to be used to treat a selected biological target. The photosensitizer comprises a core nanoparticle adapted to convert infrared radiation into a visible light emission, and a coating disposed about the core nanoparticle. The coating contains a light excitable agent that is adapted to be excited by the visible light emission from the core nanoparticle. The photosensitizer can be surface modified with an antibody to make the photosensitizer specific to the biological target that is to be treated. Such surface modified photosensitizer is introduced to the target site and irradiated with infrared radiation. | 11-20-2008 |
20080286263 | Diagnosis Of Neurodegenerative Diseases - The invention relates to a method of diagnosis of Huntington's Disease in a diagnostic sample of a valid body tissue taken from a human subject, which comprises detecting an altered concentration of a protein in the diagnostic sample, compared with a sample of a control human subject, the protein being selected from: Swiss Prot accession number: Protein name; P10909: Clusterin precursor; P00738: Haptoglobin precursor; P01009: Alpha-1-antitrypsin precursor; P01024: Complement C3 precursor; P01620: 1 g kappa chain V-III region; P01834: 1 g kappa chain C region P01842: 1 g lambda chain C regions; P01857: 1 g gamma-1 chain C region; P01859: Ig gamma-2 chain C region; P01876: 1 g alpha-1 chain C region P02647: Apolipoprotein A-I precursor; P02649: Apolipoprotein E precursor; P02652: Apolipoprotein A-II precursor; P02655: Apolipoprotein C-II precursor; P02656: Apolipoprotein C-II precursor P02671: Fibrinogen alpha/alpha-E chain precursor; P02763: Alpha-1-acid glycoprotein 1 precursor; P02766: Transthyretin precursor; P02768: Serum albumin precursor; P02787: Serotransferrin precursor; P04196: Histidine-rich glycoprotein precursor; P06727: Apolipoprotein A-IV precursor; P19652: Alpha-1-acid glycoprotein 2 precursor; P68871/P02042: Hemoglobin beta chain/Hemoglobin delta chain; P60709: Beta actin. | 11-20-2008 |
20080286264 | Modulation of Muc1 Activity - The invention provides methods of identifying and making compounds that inhibit the interaction between MUC1 and either p53 or TBP. Also embraced by the invention are in vivo and in vitro methods of inhibiting such an interaction and of inhibiting the expression of MUC1 by a cell. | 11-20-2008 |
20080286265 | SUBSTITUTED PHENOXY N-ALKYLATED THIAZOLIDINEDIONES AS ESTROGEN RELATED RECEPTOR-ALPHA MODULATORS - The present invention relates to compounds of Formula (I), | 11-20-2008 |
20080286266 | Novel Use of Il-1Beta Compounds - This invention relates to a novel use of IL-1β-ligand/IL-1 receptor disrupting compounds (herein referred to as “IL-1beta Compounds”); such as small molecular compounds disrupting IL-1β ligand-IL-1 receptor interaction, IL-1β antibodies or IL-1 receptor antibodies, e.g. IL-1β binding molecules described herein, e.g. antibodies disclosed herein, e.g. IL-1β binding compounds or IL-1 receptor binding compounds, and/or RNA compounds decreasing either IL-1β ligands or IL-1 receptor protein levels, in the treatment and/or prevention of auto-inflammatory syndromes, e.g. Juvenile rheumatoid arthritis or adult rheumatoid arthritis syndrome and to methods of treating and/or preventing auto-inflammatory syndromes, e.g. Juvenile rheumatoid arthritis or adult rheumatoid arthritis syndrome, in mammals, particularly humans. | 11-20-2008 |
20080286267 | Methods for treating nervous system inquiry and disease - The invention is directed to methods for treating nervous system injury and disease, in particular traumatic brain injury and degenerative nervous system disease. Such methods utilize novel compositions, including but not limited to trophic factor-secreting extraembryonic cells (herein referred to as TSE cells), including, but not limited to, amnion-derived multipotent progenitor cells (herein referred to as AMP cells) and conditioned media derived therefrom (herein referred to as amnion-derived cellular cytokine solution or ACCS), each alone or in combination with each other and/or other agents. | 11-20-2008 |
20080286268 | PROCESSED ECM MATERIALS WITH ENHANCED COMPONENT PROFILES - Described are medical graft materials and devices having improved properties relating to their component profiles. | 11-20-2008 |
20080292614 | DNA sequences for human angiogenesis genes - Novel nucleic acid sequences and encoded polypeptides involved in the process of angiogenesis are provided. In particular, provided are a BNO69 nucleic acid of SEQ ID NO: 1 and a BNO69 polypeptide of SEQ ID NO: 115. Methods are provided for treating subjects having pathologies associated with angiogenesis and for the screening of drugs for pro- or anti-angiogenic activity. | 11-27-2008 |
20080292615 | DIAGNOSIS AND TREATMENT OF DISEASE - We disclose a method of diagnosis of a disease, or susceptibility to a disease associated with abnormal cell-cell adhesion between epithelial cells, the method comprising detection of a mutation in a nucleic acid encoding an adhesion protein, a protease, or a protease inhibitor of an individual. Methods of making medicaments and methods of treatment and/or prophylaxis are also disclosed. | 11-27-2008 |
20080292616 | Topical Formulations of Histone Deacetylase Inhibitors and Methods Using the Same - Disclosed are topical compositions comprising at least one histone deacetylase (HDAC) inhibitor (HDI) and a carrier comprising petrolatum. Methods for using such compositions to treat or inhibit cancer and various skin diseases are also disclosed. | 11-27-2008 |
20080292617 | ANTIBODY AGAINST A PEPTIDE DERIVED FROM HUMAN MUTANT LAMIN A PROTEIN AND USES THEREOF - Nearly all subjects affected with Hutchinson Gilford progeria syndrome (HGPS) carry mutation LMNA G608G (GGC>GGT), within exon 11 of LMNA activating a splicing donor site which leads to a deletion of 50 amino acids at the carboxyl-terminal of prelamin A. The invention provides an isolated peptide of sequence GAQSPQNC. The lamin A G608G polypeptide comprises the GAQSPQNC peptide. The invention provides monoclonal and polyclonal antibodies, which specifically recognize GAQSPQNC peptide, and any polypeptide which comprises GAQSPQNC. The invention provides methods, which use the inventive antibodies to detect biological conditions associated with lamin A G608G; and to identify agents which inhibit expression or localization of lamin A G608G. | 11-27-2008 |
20080292618 | INTRANUCLEAR PROTEIN TRANSDUCTION THROUGH A NUCLEOSIDE SALVAGE PATHWAY - Provided herein are conjugate molecules containing a substrate for a nucleoside transport pathway linked to an active agent, wherein the conjugate can be transported into a cell or into the nucleus of a cell via a cellular nucleoside transport pathway. Further provided are methods of delivering a conjugate molecule to a target cell expressing a nucleoside transport pathway, wherein the conjugate contains a substrate for the nucleoside transport pathway linked to an active agent. Also provided are methods for screening for conjugates that are transported by nucleoside transport pathways. Further provided are methods of treating a patient having a disease or disorder affecting tissues expressing nucleoside transport pathways, in which a conjugate containing an agent effective in treating the disorder is administered to the patient. Also provided are methods of treating a patient having an autoimmune disorder involving administering to the patient a compound that inhibits a nucleoside transport pathway. | 11-27-2008 |
20080299110 | Methods and kits for diagnosing and treating acute joint injury - The present invention provides methods, reagents and kits for diagnosing and/or for the prognosis of non-autoimmune acute joint inflammation by detecting cytokine biomarkers in a sample obtained from an individual thought to be suffering from joint injury. The cytokine biomarkers used with the methods and kits of the present invention are IL-6, MIP-1β, MCP1 and IFNγ. | 12-04-2008 |
20080299111 | Prevention, treatment and diagnosis of diseases associated with beta-amyloid formation and/or aggregation - The invention provides compositions and methods for prevention and treatment of diseases associated with β-amyloid formation and/or aggregation. Such methods encompass the induction of an immune response against N-terminal truncated and/or post-translationally modified Aβ peptides. These peptides are further used in compositions and methods for the diagnosis of diseases associated with β-amyloid formation and/or aggregation. | 12-04-2008 |
20080305101 | Methods and Compositions Related to Clot Binding Compounds - Disclosed are compositions and methods related to clot binding compounds. The disclosed targeting is useful for treatment of cancer and other diseases and disorders. | 12-11-2008 |
20080305102 | Therapeutic Agent for Cancer Comprising Substance Capable of Inhibiting Expression or Function of Synoviolin as Active Ingredient and Screening Method for the Therapeutic Agent for Cancer - Inhibition of synoviolin function was found to activate the cancer-suppressing protein p53. Substances inhibiting the function of synoviolin are useful as cancer therapeutic agents. The inhibition of synoviolin function was also found to lead to the inhibition of p53 ubiquitination, increased activity of p53 phosphorylation proteins, and the like. Based on these findings, the present invention provides methods capable of efficiently screening for cancer therapeutic agents. Further, it was also found that regulation of the autoubiquitination of synoviolin protein suppresses the proliferation of rheumatoid arthritis synovial cells. Substances regulating the autoubiquitination of synoviolin protein are useful as anti-rheumatic agents. Moreover, the present invention provides methods of efficiently screening for anti-rheumatic agents. | 12-11-2008 |
20080305103 | Intraocular pressure-regulated early genes and uses thereof - The present invention relates to methods to treat glaucoma and glaucoma-related conditions through the regulation of changes in gene expression that are mediated by high intraocular pressure or α2 macgroglobulin administration. Glaucoma, retinal ganglion cell (RGC) death and chronic ocular hypertension are treated using pharmaceutical compositions which comprise substances that inhibit the expression or activity of intraocular pressure-regulated early genes (IPREGs) or their gene products that are up-regulated by high intraocular pressure or α2 macgroglobulin administration and/or which increase the expression or activity of IPREGs or their gene products that are down-regulated by high intraocular pressure or α2 macgroglobulin administration. The invention also relates to methods of identifying an IPREG and methods to test for chronic ocular degeneration and the onset of RGC stress in an individual by measuring the expression level of IPREG proteins. | 12-11-2008 |
20080311106 | Product Comprising a C4bp Core Protein and a monomeric Antigen, and Its Use - The invention provides a product which comprises a C4bp core protein and a monomeric antigen, desirably in the form of a fusion protein. Monomeric antigens include malarial and influenza antigens. The C4bp core protein provides for assembly of multimeric complexes of the monomeric antigen, or mixtures thereof. The complexes are useful as vaccines. | 12-18-2008 |
20080311107 | Novel Gene Disruptions, Compositions and Methods Relating Thereto - The present invention relates to transgenic animals, as well as compositions and methods relating to the characterization of gene function. Specifically, the present invention provides transgenic mice comprising disruptions in PRO188, PRO235, PRO266, PRO337, PRO361, PRO539, PRO698, PRO717, PRO846, PRO874, PRO98346, PRO1082, PRO1097, PRO1192, PRO1268, PRO1278, PRO1303, PRO1308, PRO1338, PRO1378, PRO1415, PRO1867, PRO1890, PRO3438, PRO19835, PRO36915, PRO36029, PRO4999, PRO5778, PRO5997, PRO6079, PRO6090, PRO7178, PRO21184, PRO7434, PRO9822, PRO9833, PRO9836, PRO9854, PRO9862, PRO10284, PRO37510, PRO35444, PRO20473, PRO21054 or PRO35246 genes. Such in vivo studies and characterizations may provide valuable identification and discovery of therapeutics and/or treatments useful in the prevention, amelioration or correction of diseases or dysfunctions associated with gene disruptions such as neurological disorders; cardiovascular, endothelial or angiogenic disorders; eye abnormalities; immunological disorders; oncological disorders; bone metabolic abnormalities or disorders; lipid metabolic disorders; or developmental abnormalities. | 12-18-2008 |
20080311108 | Polypeptides - The invention relates to antigenic polypeptides expressed by pathogenic microbes, vaccines comprising said polypeptides; therapeutic antibodies directed to said polypeptides and methods to manufacture said polypeptides, vaccines and antibodies. | 12-18-2008 |
20080311109 | COMPOSITIONS AND METHODS FOR THE THERAPY AND DIAGNOSIS OF BREAST CANCER - Compositions and methods for the therapy and diagnosis of cancer, particularly breast cancer, are disclosed. Illustrative compositions comprise one or more breast tumor polypeptides, immunogenic portions thereof, polynucleotides that encode such polypeptides, antigen presenting cell that expresses such polypeptides, and T cells that are specific for cells expressing such polypeptides. The disclosed compositions are useful, for example, in the diagnosis, prevention and/or treatment of diseases, particularly breast cancer. | 12-18-2008 |
20080311110 | Chimeric Vaccine for Haemophilus Influenzae-Induced Disease - The invention described herein relates to a chimeric protein comprising the NTHi twitching pilus major subunit protein (PilA) presenting a portion of the NTHi OMP P5 protein. The invention provides for vaccine compositions comprising the recombinant chimeric protein and methods of eliciting an immune response using the recombinant chimeric proteins of the invention. | 12-18-2008 |
20080311111 | Competitive Domain Antibody Formats That Bind Interleukin 1 Receptor Type 1 - The invention relates to dAb monomers that bind IL-1R1 and inhibit binding of IL-1 (e.g., IL-1α and/or IL-1β) and IL-1ra to IL-1R1, and to ligands comprising such dAb monomers. The invention relates to protease resist and dAb monomers, and to ligands comprising protease resistant dAb monomers. The invention also relates to nucleic acids including vectors that encode the dAb monomers and ligand, to host cells that comprise the nucleic acids and to method for producing a dAb monomer or ligand. The invention also relates to pharmaceutical compositions that comprise the dAb monomers or ligands, and to therapeutic methods that comprise administering a dAb monomer of ligand. | 12-18-2008 |
20080311112 | USE OF TOLL-LIKE RECEPTOR-9 AGONISTS, TOLL-LIKE RECEPTOR-4 ANTAGONISTS, AND/OR NUCLEAR OLIGOMERIZATION DOMAIN-2 AGONISTS FOR THE TREATMENT OR PREVENTION OF TOLL-LIKE RECEPTOR-4-ASSOCIATED DISORDERS - The present invention relates to the use of a TLR9 agonist and/or a TLR4 antagonist and/or a NOD2 agonist for treatment or prevention of disorders involving TLR4 activation, such as systemic sepsis and necrotizing enterocolitis. | 12-18-2008 |
20080311113 | METHOD FOR TREATING ADAMTS-5-ASSOCIATED DISEASE - The present invention relates to methods of treating ADAMTS-5-associated diseases and particularly osteoarthritis comprising administering an agent capable of modulating ADMATS-5 activity to a subject afflicted with the disease. The agent is preferably a biaryl sulfonamide compound. The invention is based, in part, on the discovery that transgenic animals that do not express functional ADAMTS-5 show a reduction in the degree of osteoarthritis after the induction of osteoarthritis as compared to WT animals. Furthermore, the ADAMTS-5 transgenic animals have reduced aggrecanase activity in articular tissue as compared to WT animals. These animals are good models for ADAMTS-5-associated diseases, and for screening of drugs useful in the treatment and/or prevention of these diseases. There are no other animal models in which the deletion of the activity of a single gene is capable of abrogating the course of osteoarthritis. Accordingly, these animals also show that osteoarthritis can be prevented and/or treated by administering to a subject an ADAMTS-5 inhibitory agent and particularly an agent capable of inhibiting the aggrecanase activity of ADAMTS-5. | 12-18-2008 |
20080311114 | USE OF MORPHOGENIC PROTEINS TO TREAT HUMAN DISC DISEASE - Bone morphogenetic proteins (BMPs) are introduced into an affected intervertebral disc without the inclusion of disc cells. The inventions applies to all known and yet-to-be developed or discovered BMPs, including BMP-1, -2, -3, -4, -5, -6, -7, -8, -9, -10, . . . BMPn. The BMP(s) may be obtained from natural and/or recombinant sources. The BMP(s) may be introduced using any surgical technique, including percutaneous or laparoscopic approaches. As one delivery mechanism, a passageway may be formed through the annulus, with the substances then being introduced through the passageway. Alternatively, a carrier may be sewn or otherwise adhered to the inside or outside of the existing annulus using standard surgical procedures. Additional therapeutic substances such as culture medium, growth factors, differentiation factors, hydrogels, polymers, antibiotics, anti-inflammatory medications, or immunosuppressive medications could be introduced in conjunction with the BMP(s). | 12-18-2008 |
20080317738 | Mylks as Modifiers of Branching Morphogenesis and Methods of Use - Human MYLK genes are identified as modulators of branching morphogenesis, and thus are therapeutic targets for disorders associated with defective branching morphogenesis function. Methods for identifying modulators of branching morphogenesis, comprising screening for agents that modulate the activity of MYLK are provided. | 12-25-2008 |
20080317739 | Method for Treating Skeletal Disorders Resulting from Fgfr Malfunction - The invention provides materials, reagents, systems, and methods for identifying agents useful for treating diseases resulting from abnormal (e.g., excessive) FGF receptor signaling. The invention also provides (therapeutic) agents thus identified, and methods of using such agents in treating such diseases. In certain embodiments, the invention relates to the treatment of various craniofacial disorders, or Craniosynostosis, that result from FGFR (e.g. FGFR2) malfunction, such as Crouzon, Apert, Jackson-Weiss, Pfeiffer Syndromes, Crouzon+acanthosis nigricans, Beare-Stevenson cutis gyrata, and non-syndromic craniosynostosis (NS). The methods comprise administering to the individuals a therapeutically effective amount of an inhibitor of the FGFR2c-FRS2 signaling. The inhibitor inhibits signaling by antagonizing FGFR2c-FRS2 interaction, inhibiting the expression and/or subcellular localization of wild-type or mutant FGFR2c and/or FRS2, inhibiting the kinase activity of FGFR2c (e.g. for autophosphorylation and/or phosphorylation of FRS2), and/or inhibiting downstream signaling of FRS2 (such as Sos-Ras-MAPK, Shp2, and/or Gab 1-PI3K pathways). | 12-25-2008 |
20080317740 | Use of Nk Cell Inhibition to Facilitate Persistence of Engrafted Mhc-I-Negative Cells - The present invention relates to the use of a means for inhibiting NK cell function to increase persistence and/or engraftment of MHC-I negative cells, such as MAPCs. | 12-25-2008 |
20080317741 | Biomarkers For Anti-Nogo-A Antibody Treatment in Spinal Cord Injury - This disclosure of this invention confirms, at the level of gene expression, the injured spinal cord and motor cortex as the primary sites of action of the anti-Nogo-A antibody treatment applied intrathecally. The disclosure further provides methods for predicting the response of a subject to a medicament comprising an anti-Nogo-A antibody. | 12-25-2008 |
20080317742 | BIOMARKERS OF FRANCISELLA INFECTION - The instant invention concerns | 12-25-2008 |
20090004178 | PHARMACEUTICAL COMPOUND FOR BLOCKING THE CRT OR ERP57 TRANSLOCATION - A pharmaceutical compound is used in the treatment of a health condition in a mammal. The compound comprises an antibody that interferes with an increased translocation of a protein, leading to an increased immunogenicity of cell death. The antibody may be, for example, anti-calreticulin and/or anti-ERP57. This antibody includes any one or more of blocking or neutralizing antibody. | 01-01-2009 |
20090004179 | POLYPEPTIDES WITH ENHANCED ANTI-INFLAMMATORY AND DECREASED CYTOTOXIC PROPERTIES AND RELATING METHODS - The invention provides methods of altering properties of Fc-containing molecule, comprising altering the sialylation of the oligosaccharides in the Fc region. Proteins having Fc regions having altered sialylation patterns are also provided. | 01-01-2009 |
20090004180 | Kifs as Modifiers of the Rho Pathway and Methods of Use - Human KIF23 genes are identified as modulators of the RHO pathway, and thus are therapeutic targets for disorders associated with defective RHO function. Methods for identifying modulators of RHO, comprising screening for agents that modulate the activity of KIF23 are provided. | 01-01-2009 |
20090010919 | Diagnostics and Therapeutics for Diseases Associated With Fibroblast Activation Protein (Fap) - The invention provides a human FAP which is associated with the cardiovascular diseases, respiratory diseases, cancer, dermatological diseases, metabolic diseases, inflammation, gastroenterological diseases, hematological diseases, muscle skeleton diseases, neurological diseases, urological diseases and endocrinological diseases. The invention also provides assays for the identification of compounds useful in the treatment or prevention of cardiovascular diseases, respiratory diseases, cancer, dermatological diseases, metabolic diseases, inflammation, gastroenterological diseases, hematological diseases, muscle skeleton diseases, neurological diseases, urological diseases and endocrinological diseases. The invention also features compounds which bind to and/or activate or inhibit the activity of FAP as well as pharmaceutical compositions comprising such compounds. | 01-08-2009 |
20090010920 | Fc Variants Having Decreased Affinity for FcyRIIb - The present invention relates to Fc variants having decreased affinity for FcγRIIb, methods for their generation, Fc polypeptides comprising optimized Fc variants, and methods for using optimized Fc variants. | 01-08-2009 |
20090010921 | Antigen binding molecules with increased Fc receptor binding affinity and effector function - The present invention relates to antigen binding molecules (ABMs). In particular embodiments, the present invention relates to recombinant monoclonal antibodies, including chimeric, primatized or humanized antibodies specific for human CD20. In addition, the present invention relates to nucleic acid molecules encoding such ABMs, and vectors and host cells comprising such nucleic acid molecules. The invention further relates to methods for producing the ABMs of the invention, and to methods of using these ABMs in treatment of disease. In addition, the present invention relates to ABMs with modified glycosylation having improved therapeutic properties, including antibodies with increased Fc receptor binding and increased effector function. | 01-08-2009 |
20090010922 | COMPOSITIONS AND METHODS FOR BINDING SPHINGOSINE-1-PHOSPHATE - The present invention relates to anti-S1P agents, for example, humanized monoclonal antibodies, and their uses for detection of S1P or for treatment of diseases and conditions associated with S1P. | 01-08-2009 |
20090010923 | TREATMENT OF CANCER WITH ANTI-MUSCARINIC RECEPTOR AGENTS - The present invention relates to methods of treating proliferative disorders of colon cells. The methods comprise administering to the cells an effective amount of at least one agent to reduce M3 muscarinic receptor-mediated transactivation of at least one epidermal growth factor receptor. | 01-08-2009 |
20090017008 | Compositions and methods for altering bone density and bone patterning - By exploiting cross-species sequence comparisons with in vitro and in vivo enhancer assays we were able to identify enhancer elements that drives human SOST expression in the adult mouse skeleton, and discovered a novel function for sclerostin during limb development. The enhancer elements and reagents described in the present invention facilitate the methods for development of products and methods to increase the mineral content of bone, which can consequently be utilized to treat a wide variety of bone related conditions, including, osteopenia, osteoporosis, fractures and other disorders in which low bone mineral density are the main cause of the disease as well as sclerosteosis, Van Buchem disease and other related disorders of the skeleton. Furthermore, the present invention provides enhancer elements and reagents useful for bone pattering and growth, limb development, and the formation of individual bones | 01-15-2009 |
20090017009 | METHOD FOR THE DIAGNOSIS AND PROGNOSIS OF MALIGNANT DISEASES - Methods for the treatment of tumors and cancer by exploiting the surface expression of the usually nuclear-localized protein, nucleolin. | 01-15-2009 |
20090017010 | NOVEL ARTEMIS/DNA-DEPENDENT PROTEIN KINASE COMPLEX AND METHODS OF USE THEREOF - In the present invention, it is disclosed that Artemis forms a complex with the 469 kDa DNA-dependent protein kinase (DNA-PK | 01-15-2009 |
20090017011 | MODULATION OF VEGF-C/VEGFR-3 INTERACTIONS IN THE TREATMENT OF RHEUMATOID ARTHRITIS - The present invention relates to methods for treating an individual exhibiting symptoms of chronic arthridites, as identified by an elevated level of VEGF-C expression at synovial sites, and provides materials and methods for the modulation of VEGF-C/VEGFR-3 ligand-receptor interactions as a treatment for chronic arthridites. | 01-15-2009 |
20090017012 | METHODS OF DIAGNOSING AND TREATING CANCER - The invention relates to methods of determining an appropriate cancer therapy for a subject based on intratumoral expression levels of Ribonucleotide Reductase M1 (RRM1) and thymidylate synthase (TS) gene expression, as well as to methods of predicting clinical outcome (prognosis) based on cytoplasmic levels of TS protein. Compositions and kits useful for the methods are also provided. | 01-15-2009 |
20090017013 | MOLECULES FOR THE TREATMENT OF LUNG DISEASE INVOLVING AN IMMUNE REACTION TO CONNECTIVE TISSUE FOUND IN THE LUNG - Various embodiments include methods for diagnosing and treating medical conditions that involve an autoimmune response to connective tissue such as collagen found in organs such as the lung. In one method pulmonary disease and disorders such as Idiopathic Pulmonary Fibrosis (IPF) are diagnosed by analyzing fluid or tissue samples obtained from a patient for evidence of an autoimmune response to various types of collagen including, for example, Type V. One type of assay for evidence of an autoimmune response to Type V collagen comprises the steps of obtaining a fluid or tissue sample from a patient, contacting at least a portion of the sample with antigen to anti-Type V collagen antibody and monitoring the mixture of sample and antigen for changes indicative of the presence of anti-Type V collagen in the sample. Another embodiment includes treating pulmonary diseases such as IPF by administering a therapeutically effective dose of epitopes of various collagens including Type V collagen. | 01-15-2009 |
20090017014 | COMPOSITIONS AND METHODS FOR THE TREATMENT OF IMMUNE RELATED DISEASES - The present invention relates to compositions containing a novel protein and methods of using those compositions for the diagnosis and treatment of immune related diseases. | 01-15-2009 |
20090022707 | Combinations of Antibodies Selective for a Tumor Necrosis Factor-Related Apoptosis-Inducing Ligand Receptor and Other Therapeutic Agents - An antibody of the invention interacts with human DR5 or with human DR4 to produce agonistic or antagonistic effects downstream of the receptor including inhibition of cell proliferation and apoptosis. Methods and uses for the antibodies, optionally in combination with various therapeutic agents, are detailed, including treatment of apoptosis-related disease and treatment of dysregulated cell growth. | 01-22-2009 |
20090022708 | Trefoil Factors and Methods of Treating Proliferation Disorders Using Same - The present invention relates to methods of regulation of cellular proliferation and/or survival, particularly methods for the treatment of proliferative disorders. The invention also relates to agents and compositions of use in such methods. | 01-22-2009 |
20090022709 | Control of sorbose utilization genes and uses thereof - This invention relates generally to the discovery of a novel control of sorbose utilization (CSU) genes. The invention further relates to the detection of these genes and their use in the diagnosis and treatment of fungal infections. | 01-22-2009 |
20090022710 | NUCLEAR FACTOR OF ACTIVATED T CELLS RECEPTOR - The present invention provides a novel transmembrane protein, which is a nuclear factor of activated T cells (‘NFAT’) receptor, and related compositions and methods. | 01-22-2009 |
20090022711 | METHODS OF MODULATING CELL DEATH BASED ON THE BIT-1/AES REGULATORY PATHWAY - The present invention provides a method of identifying an effective agent that alters the association of a Bit1 polypeptide with an AES polypeptide. The method is practiced by contacting a Bit1 polypeptide, or active fragment thereof, and an AES polypeptide, or active fragment thereof, with an agent under conditions that allow the Bit1 polypeptide or active fragment thereof to associate with the AES polypeptide or active fragment thereof; and detecting an altered association of the Bit1 polypeptide or active fragment thereof and the AES polypeptide or active fragment thereof, where an altered association indicates that the agent is an effective agent that alters the association of a Bit1 polypeptide with an AES polypeptide. Such an effective agent can modulate apoptosis and can be a useful therapeutic agent. | 01-22-2009 |
20090022712 | Compositions and Methods for Inhibiting Leukocyte Function - The present invention provides compositions and methods for regulating leukocyte migration and function. The present invention also provides compositions and methods for preventing and inhibiting lung injury and damage associated with neutrophil infiltration of the lung. | 01-22-2009 |
20090022713 | ANTI-PRO87299 ANTIBODIES - The present invention relates to compositions containing a novel protein and methods of using those compositions for the diagnosis and treatment of immune related disease | 01-22-2009 |
20090028843 | IgA allelic variants - The invention relates to a method for determining susceptibility to an IgA-related disorder in an animal, the method comprising: a) identifying the or each IgA allelic variant present in a sample from the animal; and b) thereby determining whether the animal is susceptible to an IgA-related disorder. | 01-29-2009 |
20090028844 | GALNTS AS MODIFIERS OF THE IGFR PATHWAY AND METHODS OF USE - Human MIGFR genes are identified as modulators of the IGFR pathway, and thus are therapeutic targets for disorders associated with defective IGFR function. Methods for identifying modulators of IGFR, comprising screening for agents that modulate the activity of MIGFR are provided. | 01-29-2009 |
20090028845 | Molecular Diagnostic Method and Treatment in Dementia With Lewy Bodies - The present invention describes methods of molecular diagnosis of a concrete form of a-synucleinopathy, the dementia with Lewy bodies (DLB), associated to the levels of ubiquitin carboxy-terminal hydrolase L1 (UCH-1) or the alteration of its ubiquityl-ligase activity. It also refers to the use of compounds that permit the modification of the UCH-L1 levels or of the enzymatic activity of UCH-L1. This invention has application in the diagnosis and treatment of patients suffering from DLB. | 01-29-2009 |
20090028846 | Immunoglobulin fractions - The present invention relates to novel pharmaceutical compositions comprising fractions of human immunoglobulin preparations, novel applications of these compositions and a method for manufacturing the compositions. | 01-29-2009 |
20090028847 | MULTIPLE MYELOMA AND AL AMYLOID IMMUNOTHERAPY TARGETING IMMUNOGLOBULIN LIGHT CHAINS AND USES THEREOF - The present invention relates generally to the prevention and treatment of disease states, and more particularly to the treatment and prevention of plasma cell disorders and plasma cell dyscrasias and other malignancies, amyloidosis and amyloid-associated diseases. In particular, the present invention relates to methods and compositions comprising immunogenic peptides for the treatment and prevention of diseases and malignancies, for example plasma cell disorders, plasma cell dyscrasias and amyloidosis or amyloid-associated diseases. The present invention also provides methods for an assay to screen for therapeutic vaccines for plasma cell disorders, plasma cell dyscrasias and amyloidosis or amyloid-associated diseases. | 01-29-2009 |
20090028848 | SEQUENCE BASED ENGINEERING AND OPTIMIZATION OF SINGLE CHAIN ANTIBODIES - The invention provides methods of using sequence based analysis and rational strategies to modify and improve the structural and biophysical properties of single chain antibodies (scFvs), including stability, solubility, and antigen binding affinity. These methods and strategies can be used individually or in combination. The methods of the present invention also include the use of a database comprising scFv sequences from an experimentally screened scFv library of antibodies that have been selected to have superior solubility and stability. The invention also provides methods of using the properties found for these selected antibodies in a general approach for reshaping scFv antibodies to improve stability and solubility properties of a single chain antibody fragment. | 01-29-2009 |
20090028849 | AGENTS AND METHODS FOR INHIBITION OF AIRWAY HYPERRESPONSIVENESS - The present invention provides methods and compositions for inhibition of Airway Hyperresponsiveness (“AHR”) by deleting, inactivating or inhibiting a subset of innate γδ T cells, alone or in conjunction with the inhibition of Natural Killer T (“NKT”) cells. The methods comprise selective leukophoresis to remove the γδ T cells from the individual's blood or administration of an agent that selectively targets and inhibits or inactivates the γδ T cells. The methods of the present invention can be used to treat AHR in a variety of different ailments, including allergen-induced conditions or respiratory conditions and diseases. | 01-29-2009 |
20090035295 | Screening Method, Process for Purifying of Non-Diffusible A-Beta Oligomers, Selective Antibodies Against Said Non-Diffusible a-Beta Oligomers and a Process for Manufacturing of Said Antibodies - The present invention is relates to non-diffusible globular Aβ(X-38 . . . 43) oligomers (“globulomers”) or derivatives thereof, methods for enriching said globulomers or derivatives, compositions comprising said globulomers or derivatives, antibodies and aptamers having specificity for said globulomers or derivatives, methods for preparing such antibodies and aptamers, uses of said globulomers or derivatives, or of said antibodies or aptamers for diagnostic, therapeutic and other purposes, and corresponding methods using said globulomers or derivatives, or said antibodies or aptamers. | 02-05-2009 |
20090035296 | COMPOUNDS AND METHODS FOR TREATMENT AND DIAGNOSIS OF CHLAMYDIAL INFECTION - Compounds and methods for the diagnosis and treatment of Chlamydial infection are disclosed. The compounds provided include polypeptides that contain at least one antigenic portion of a | 02-05-2009 |
20090035297 | Methods for treating diabetes - Methods for treating diabetes by administering an inhibitor of GDF-8, or a related member of Transforming Growth Factor-beta (TGF-β) superfamily of structurally-related growth factors (e.g., GDF-11) are disclosed. Also disclosed are methods for upregulating expression of hexose transporters, such as GLUT4 and GLUT1, in a subject by administering an inhibitor of GDF-8. Also disclosed are methods for increasing glucose uptake by cells in a subject, by administering an inhibitor of GDF-8. | 02-05-2009 |
20090035298 | METHODS TO TREAT ALZHEIMER'S DISEASE OR OTHER AMYLOID BETA ACCUMULATION ASSOCIATED DISORDERS - The present invention provides methods for treating amyloid-beta accumulation-associated disorders, such as Alzheimer's disease. The methods comprise modulating the concentration of amyloid-beta in the brain interstitial fluid. In particular, the methods comprise modulating the activity of corticotrophin-releasing factor (CRF), which in turn modulates the concentration of amyloid-beta. | 02-05-2009 |
20090035299 | Methods and compositions for treating diseases targeting MABA1 - Methods and compositions for diagnosing, detecting and treating a colon disease associated with differential expression of MABA1 in comparison to healthy cells. Also provided are antagonists or agonists of MABA1, and methods for screening agents that modulate the MABA1 level or activity in vivo or in vitro. | 02-05-2009 |
20090035300 | IMMUNOMODULATION OF DENDRITIC CELLS - The present invention relates to isolated nucleic acid molecule encoding the transcription regulator DC-SCRIPT or a derivative thereof. The invention further relates to its use in therapy and to compound for interfering with the biological function of the transcription factor DC-SCRIPT. Such compounds can be compounds interfering with expression of DC-SCRIPT; or compounds interfering with binding of DC-SCRIPT to DNA. | 02-05-2009 |
20090035301 | METHODS FOR DIAGNOSING AND TREATING BLADDER CANCER - The present invention relates to the diagnosis and treatment of bladder cancer. More specifically, this invention uses the levels of macrophage migration inhibitory factor (MIF) produced by the bladder epithelia (urothelia) as a marker for bladder cancer. Moreover, the present invention also provides a method for attenuating bladder carcinoma by inhibiting of macrophage MIF. | 02-05-2009 |
20090035302 | Rage Antagonists As Agents To Reverse Amyloidosis And Diseases Associated Therewith - Disclosed are RAGE antagonist compounds that have the ability to reverse pre-existing amyloidosis. Treatment with the RAGE antagonist compounds described herein may be used to reduce plaque size and improve cognition for subjects in the later stages of Alzheimer's disease. Additionally, the RAGE antagonists described herein may be used to reduce the onset of plaque formation and thereby prevent loss of cognition and other symptoms associated with Alzheimer's Disease and other diseases of amyloid deposition. | 02-05-2009 |
20090041749 | Compositions and methods for the diagnosis and treatment of tumor - The present invention is directed to compositions of matter useful for the diagnosis and treatment of tumor in mammals and to methods of using those compositions of matter for the same. | 02-12-2009 |
20090041750 | Treatment of spongiform encephalopathy by increased hydrogen peroxide degradation - The present invention relates to the treatment of CJD and other spongiform encephalopathies by increasing the level and/or activity of hydrogen peroxide degrading enzymes, such as catalase and glutathione peroxidase, in order to deplete hydrogen peroxide and prevent the build up of gaseous oxygen in the brains of patients. Various aspects are provided, including screening methods for agents for the treatment of spongiform encephalopathy. | 02-12-2009 |
20090041751 | Sepsis Prevention Through Adenosine Receptor Modulation - Methods for treating sepsis or septic shock in a patient comprising administering to said patient a therapeutically effective amount of a composition containing an adenosine A | 02-12-2009 |
20090041752 | Compositions and methods for the treatment and diagnosis of immune disorders - The present invention relates to methods and compositions for the treatment and diagnosis of immune disorders, especially T helper lymphocyte-related disorders, and also for the treatment of mast cell-related processes and disorders, ischemic disorders and injuries, including ischemic renal disorders and injuries. For example, genes which are differentially expressed within and among T helper (TH) cells and TH cell subpopulations, which include, but are not limited to TH0, TH1 and TH2 cell subpopulations are identified. Genes are also identified via the ability of their gene products to interact with gene products involved in the differentiation, maintenance and effector function of such TH cells and TH cell subpopulations. The genes identified can be used diagnostically or as targets for therapeutic intervention. In this regard, the present invention provides methods for the identification and therapeutic use of compounds as treatments of immune disorders, especially TH cell subpopulation-related disorders. Additionally, methods are provided for the diagnostic evaluation and prognosis of TH cell subpopulation-related disorders, for the identification of subjects exhibiting a predisposition to such conditions, for monitoring patients undergoing clinical evaluation for the treatment of such disorders, and for monitoring the efficacy of compounds used in clinical trials. Methods are also provided for the treatment of symptoms associated with mast cell-related processes or disorders and ischemic disorders and injuries using the genes, gene products and antibodies of the invention. | 02-12-2009 |
20090041753 | Cytokine signaling - The present invention relates to compositions and methods for targeting CXC-chemokine mediated signaling for treatment of a myelin disorder. | 02-12-2009 |
20090041754 | METHOD FOR IDENTIFYING TARGET PROTEIN OF DRUG AND METHOD FOR SCREENING THERAPEUTIC AGENT FOR DIABETES USING THE TARGET PROTEIN - A method for identifying a target protein of a compound having a pharmacological action by detecting a tertiary structural change of a target protein by binding a compound having a pharmacological action to a target protein with the use of a molecular chaperone protein having a characteristic of binding to a protein by recognizing a tertiary structural change of the protein is disclosed. Further, a method for screening a therapeutic agent for diabetes using a target protein of biguanide which is a therapeutic agent for diabetes and was found by the identification method, a screening tool which can be used in the screening method and a pharmaceutical composition for treating diabetes containing a substance obtained by the screening method are disclosed. | 02-12-2009 |
20090041755 | Methods and Compositions For PDGF-D Activation and Inhibition - Methods for inhibiting angiogenesis comprising administering urokinase plasminogen activator (uPA) inhibitors, and pharmaceutical compositions suitable for the methods comprising the uPA inhibitors. Also provided are methods for stimulating angiogenesis comprising administering uPA or an agonist thereof to a patient in need thereof, and pharmaceutical compositions comprising an effective amount of uPA or an agonist thereof for the methods of stimulation. The present invention discloses that uPA is a specific PDGF-D activatin rotease. | 02-12-2009 |
20090041756 | 121P1F1: A TISSUE SPECIFIC PROTEIN HIGHLY EXPRESSED IN VARIOUS CANCERS - A novel gene (designated 121P1F1) and its encoded protein are described. While 121P1F1 exhibits tissue specific expression in normal adult tissue, it is aberrantly expressed in multiple cancers including prostate, bladder, kidney, brain, bone, cervical, uterine, ovarian, breast, pancreatic, stomach, colon, rectal, leukocytic, liver and lung cancers. Consequently, 121P1F1 provides a diagnostic and/or therapeutic target for cancers, and the 121P1F1 gene or fragment thereof, or its encoded protein or a fragment thereof used to elicit an immune response. | 02-12-2009 |
20090041757 | Bone morphogenetic protein antagonist and uses thereof - The present invention relates to the use of proteins that are differentially expressed in tumor associated stromal cells, as compared to normal stromal, as biomolecular targets for tumor treatment therapies. The present invention also provides compounds and pharmaceutically acceptable compositions for administration in the methods of the invention. | 02-12-2009 |
20090041758 | MODIFIED BINDING MOLECULES COMPRISING CONNECTING PEPTIDES - The instant invention describes methods of separating or preferentially synthesizing dimers which are linked via at least one interchain disulfide linkage from dimers which are not linked via at least one interchain disulfide linkage from a mixture comprising the two types of polypeptide dimers. These forms can be separated from each other using hydrophobic interaction chromatography. In addition, the invention pertains to connecting peptides that result in the preferential biosynthesis of dimers that are linked via at least one interchain disulfide linkage or that are not linked via at least one interchain disulfide linkage. The invention also pertains to compositions in which a majority of the dimers are linked via at least one interchain disulfide linkage or are not linked via at least one interchain disulfide linkage. The invention still further pertains to novel binding molecules, e.g., comprising connecting peptides of the invention. | 02-12-2009 |
20090041759 | Materials and methods for treating ocular-related disorders - The invention is directed to a method of delivering a gene product to an animal. The method comprises administering an expression vector comprising a nucleic acid sequence operably linked to a promoter and encoding a gene product, and upregulating transcription of the nucleic acid sequence in the ocular cell. The expression vector can be an adenoviral vector. The invention further provides a method of prophylactically or therapeutically treating an animal for at least one ocular-related disorder. The method comprises contacting an ocular cell with an expression vector comprising a nucleic acid sequence encoding an inhibitor of angiogenesis and/or a neurotrophic agent. In one aspect, the method further comprises upregulating transcription of the nucleic acid sequence. Preferably, if 2×10 | 02-12-2009 |
20090041760 | RETROVIRAL IMMUNOTHERAPY - The present inventor has noted that at least two populations of immune cells are produced in response to retroviruses which infect mammals. More particularly, the immune system of a mammal infected with a retrovirus is capable of mounting an immune response against the virus through a group of cells herein generally referred to as “effector cells”, however, a second population of cells are also produced which regulate the “effector cells”, herein generally referred to as “regulator cells” (or suppressor cells), limiting the mammal's ability to effectively control or eradicate the retroviral infection. Accordingly, the present invention utilizes these observations to provide methods for treating a mammal with a retroviral infection. | 02-12-2009 |
20090047274 | Diagnostic and therapeutic target cdc2l6 proteins for neurodegenerative diseases - The present invention discloses a dysregulation of the CDC2L6 gene and the protein products thereof in Alzheimer's disease patients. Based on this finding, the invention provides methods for diagnosing and prognosticating Alzheimer's disease in a subject, and for determining whether a subject is at increased risk of developing Alzheimer's disease. Furthermore, this invention provides therapeutic and prophylactic methods for treating and preventing Alzheimer's disease and related neurodegenerative disorders using the CDC2L6 gene and its corresponding gene products. Screening methods for modulating agents of neurodegenerative diseases are also disclosed. | 02-19-2009 |
20090047275 | Nell-1 enhanced bone mineralization - The present invention provides Nell- | 02-19-2009 |
20090047276 | METHODS FOR INCREASING CELL OR TISSUE REGENERATION IN A VERTEBRATE SUBJECT - A method is provided for increasing the activity of adult and embryonic stem cells, progenitor cells and/or differentiated cells in vivo in a vertebrate subject. Methods are provided for increasing cell or tissue regeneration in a vertebrate subject by administering one or more Wnt/β-catenin signal-promoting agents and/or one or more inhibitors of β-catenin-independent signaling to the vertebrate subject in need thereof. | 02-19-2009 |
20090053194 | METHOD OF TREATING OR PREVENTING BIOLOGICAL OR IMMUNOLOGICAL RESPONSES TO A REACTIVE CHEMICAL OR BIOLOGICAL OR TOXIC AGENT - A method of treatment for treating, preventing, inhibiting or reducing a biological or immunological response to a reactive chemical agent, biological agent or toxin, by tissue of a subject, includes administering to a subject in need of such treatment an effective amount of a composition including a response-inhibiting agent including amino acid sequence LKKTET [SEQ ID NO: 1], a conservative variant thereof, or an agent that stimulates production of an LKKTET [SEQ ID NO: 1] peptide, or a conservative variant thereof, in the tissue, so as to inhibit the response. | 02-26-2009 |
20090053195 | BIOMARKERS FOR ACUTE GRAFT REJECTION - Methods are disclosed for the early non-invasive diagnosing of acute rejection (AR) in a transplanted subject, monitoring AR in a transplanted subject at risk of developing AR, preventing, inhibiting, reducing or treating AR in a transplanted subject, or identifying agents for use in the prevention, inhibition, reduction or treatment of AR, based on genes which are differentially expressed in peripheral blood or transplant biopsy tissues, before full clinical manifestation of AR is detected in the transplanted subject. | 02-26-2009 |
20090053196 | Chn-1/Chip-Antagonists For The Treatment Of Muscular Diseases - The present invention relates to a pharmaceutical composition comprising an inhibitor/negative regulator/antagonist of the mammalian ortholog of | 02-26-2009 |
20090053197 | Transfer Factor Compositions and Methods - Compositions are provided comprising transfer factor alone or combined with an antibody. The antibody may be contained in an antibody fraction. The transfer factor and/or the antibody or antibody fraction may be lyophilized. Also provided are formulations further comprising glucans, as well as additional optional components. Also provided are methods for making the compositions and formulations, as well as kits containing the compositions. Methods of preventing and/or treating a condition in a subject using the compositions and/or formulations are also provided. Such conditions may include malignant and benign tumors. | 02-26-2009 |
20090053198 | Cytokine Induction of Selectin Ligands on Cells - Methods and compositions for treating cells with cytokines are provided herein. | 02-26-2009 |
20090053199 | Stable Dairy Components Effective for Fat Loss - The present invention relates to methods comprising administering to individuals regulating body weight calcium-containing fresh whey products in an amount effective to manage body mass, by inducing weight and/or fat loss, preventing weight and/or fat gain, increasing the metabolic consumption of adipose tissue, and/or maintaining muscle mass. | 02-26-2009 |
20090053200 | Method for retarding unhealth manifestations brought by ageing of human beings - It is an object of the present invention to provide a solution for creating an effective method for retarding unhealthy manifestations brought by ageing of human beings (in particular, but not limited to the reduction of sexual activity and fertility, climax, changes in glucose tolerance, reduction of cognitive and mnestic functions, reduction of stress resistance, development of organ and tissue sclerosis) without directly affecting the genetic apparatus of the ageing cells. | 02-26-2009 |
20090053201 | HEPATITIS B VIRAL VARIANTS WITH REDUCED SUSCEPTIBILITY TO NUCLEOSIDE ANALOGS AND USES THEREOF - The present invention relates generally to viral variants exhibiting reduced sensitivity to particular agents and/or reduced interactivity with immunological reagents. More particularly, the present invention is directed to hepatitis B virus (HBV) variants exhibiting complete or partial resistance to nucleoside or nucleotide analogs and/or reduced interactivity with antibodies to viral surface components including reduced sensitivity to these antibodies. The present invention further contemplates assays for detecting such viral variants, which assays are useful in monitoring anti-viral therapeutic regimens and in developing new or modified vaccines directed against viral agents and in particular HBV variants. The present invention also contemplates the use of the viral variants to screen for and/or develop or design agents capable of inhibiting infection, replication and/or release of the virus. | 02-26-2009 |
20090053202 | Peptide fragment of LYVE-1 and antibody against the same - It is intended to provide a specific peptide fragment of LYVE-1 which can serve as an epitope of a lymphatic vessel-specific antibody, and an antibody recognizing the above peptide fragment. A peptide fragment comprising an amino acid sequence:
| 02-26-2009 |
20090053203 | Metal-binding therapeutic peptides - The present invention is related methods of delivering MBD peptide-linked agents into live cells. The methods described herein comprise contacting MBD peptide-linked agents to live cells under a condition of cellular stress. The methods of the invention may be used for therapeutic or diagnostic purposes. | 02-26-2009 |
20090053204 | Functional Genomic Pore Assay For Mixed Cell Populations - A method of assaying nucleotide receptor P2X | 02-26-2009 |
20090053205 | STABILIZED IMMUNE MODULATORY RNA (SIMRA) COMPOUNDS - The invention relates to the therapeutic use of novel stabilized oligoribonucleotides as immune modulatory agents for immune therapy applications. Specifically, the invention provides novel RNA-based oligoribonucleotides with improved nuclease and RNase stability and that have immune modulatory activity through TLR7 and/or TLR8. | 02-26-2009 |
20090053206 | NOVEL SYNTHETIC AGONISTS OF TLR9 - The invention relates to synthetic chemical compositions that are useful for modulation of Toll-Like Receptor (TLR)-mediated immune responses. In particular, the invention relates to agonists of Toll-Like Receptor 9 (TLR9) that generate unique cytokine and chemokine profiles. | 02-26-2009 |
20090053208 | Methods and Systems for Improving Tissue Perfusion - Methods and systems are disclosed for treating injured and/or ischemic tissue by delivering a platelet composition which induces neovascularization in the tissue and improves tissue perfusion. | 02-26-2009 |
20090053209 | Blockade of Pin1 Prevents Cytokine Production by Activated Immune Cells - The invention provides pharmaceutical compositions and methods of treating immunological disorders. The invention also provides pharmaceutical compositions and methods of inducing eosinophil apoptosis, and methods for treating eosinophil-associated disorders comprising inducing eosinophil apoptosis in an individual in need thereof. | 02-26-2009 |
20090060898 | Immune regulatory oligonucleotide (IRO) compounds to modulate toll-like receptor based immune response - The invention provides novel immune regulatory oligonucleotides (IRO) as antagonist of TLRs and methods of use thereof. These IROs have unique sequences that inhibit or suppress TLR-mediated signaling in response to a TLR ligand or TLR agonist. The methods may have use in the prevention and treatment of cancer, an autoimmune disorder, airway inflammation, inflammatory disorders, infectious disease, skin disorders, allergy, asthma or a disease caused by a pathogen. | 03-05-2009 |
20090060899 | COMPOSITION OF ORGANIC COMPOUNDS - The present invention relates to novel uses of a construct consisting of virus-like particle (VLP) structure chemically coupled to a fragment of the Aβ-1-42 peptide and its pharmaceutically acceptable salts (hereinafter CONSTRUCT), in particular to dosage regimens, modes of and dosage forms for the administration of a CONSTRUCT for the treatment of patients suffering from dementia, in particular dementia of the A | 03-05-2009 |
20090060900 | Methods for Screening Compounds That Modulate Lipid Metabolism - Drug screening assays useful in the discovery of pharmaceutically active compounds for use in the treatment of diseases involving abnormal lipid metabolism including diabetic neuropathy are taught. In particular, the control region of delta-5-desaturase gene is taught as a target for the drug screening methods, which serve to identify nucleotides, proteins, compounds and/or other pharmacological agents, which modulate the activity of desaturase enzymes or regulate the level of expression of the desaturase genes. Cell-based and cell lysate assays are taught for detecting components that interact with the desaturase enzymes and modify fatty acid profiles. In addition, cell-based and cell lysate assays are used to identify functional and regulatory elements controlling expression of the desaturase genes as well as to screen for components that modulate the transcriptional activity of the desaturase genes. Also taught is the gene for rat delta-5-desaturase. | 03-05-2009 |
20090060901 | DETOXIFICATION METHOD - The present invention provides a protein toxoid for use in a method of treating the human or animal body by therapy, wherein all cysteine residues in said protein toxoid which are free under reversibly denaturing conditions have been alkylated. | 03-05-2009 |
20090060902 | Methods and compositions for regulating T cell subsets by modulating transcription factor activity - Methods for modulating production of a T helper type 2 (Th | 03-05-2009 |
20090060903 | Pharmaceutical Compositions Comprising an Anti-Teratogenic Compound and Applications of the Same - Pharmaceutical compositions comprising anti-teratogenic agents are disclosed. Additionally, pharmaceutical compositions comprising anti-neoplastic agents and anti-teratogenic agents are disclosed. Methods of assessing the teratogenicity of a compound are disclosed. The present invention further comprises applications of the aforementioned compositions and methods. | 03-05-2009 |
20090060904 | Vegetarian Protein A Preparation and Methods Thereof - The invention relates to methods of producing Protein A without contamination of the Protein A by animal products. The invention also relates to a vegetarian fermentation media in which | 03-05-2009 |
20090060905 | Use of 15-Lipoxygenase Inhibitors for Treating Obesity - The invention concerns the treatment of obesity, in particular abdominal visceral obesity. More specifically, the invention concerns the use of selective 15-lipoxygenase (LO) inhibitors for preparing medicines useful in the treatment of obesity, or at least abdominal visceral obesity, and/or its consequences. | 03-05-2009 |
20090068169 | 2,4,6-triamino-s-triazine-based compounds which bind to the tail (fc) portion of immunoglobulins and their use - The present invention describes new compounds which are useful for binding to the tail or Fc portion of immunoglobulins and so have utility in those applications which require the non-covalent binding interaction of a molecule with the Fc portion of immunoglobulins. Such applications include the detection and purification of immunoglobulins as well as the treatment of certain autoimmune diseases. | 03-12-2009 |
20090068170 | DROPLET-BASED SELECTION - The present invention generally relates to fluidic droplets, and techniques for screening or sorting such fluidic droplets. In some embodiments, the fluidic droplets may contain cells (e.g., hybridoma cells) that can secrete various species, such as antibodies, for example. In one aspect, a plurality of fluidic droplets containing cells is screened to determine proteins, antibodies, polypeptides, peptides, nucleic acids, or the like. For example, cells able to secrete species such as antibodies may be selected according to certain embodiments of the invention. Examples of such cells include, for instance, immortal cells such as hybridomas, or non-immortal cells such as B-cells. For instance, blood cells may be encapsulated within a plurality of fluidic droplets, and the cells able to produce antibodies may be determined. In some cases, expression or secretion levels may be determined using signaling entities, for example, determinable microparticles present within the fluidic droplet. Other aspects of the invention relate to kits involving such fluidic droplets, methods of promoting the making or use of such fluidic droplets, and the like. | 03-12-2009 |
20090068171 | Protein markers for the detection of thyroid cancer metastasis - This invention relates, e.g., to a method for detecting the presence of lymph node metastases in a subject having papillary thyroid carcinoma (PTC), comprising measuring in a sample from the subject the amount of expression (e.g., the amount of protein, or the amount of mRNA encoding the protein) of one or more of the following proteins: (a) LIMD2, and/or (b) PTPRC, and/or (c) LTB, and/or (d) CD48, and/or (e) ABCC3, wherein a significant amount of over-expression of one or more of protein(s) (a)-(e), compared to the baseline value, indicates that lymph node metastases are likely to be present in the subject. | 03-12-2009 |
20090074745 | TREATMENT AND PREVENTION OF TISSUE DAMAGE - A method for the treatment or prevention of tissue damage in a subject having an inflammatory and/or tissue damaging condition, which comprises administering to the subject an effective amount of a compound capable of inhibiting the binding of C-reactive protein (CRP) to an autologous or extrinsic ligand. | 03-19-2009 |
20090074746 | Compounds to treat alzheimer's disease - The present invention is substituted amines of formula (X) | 03-19-2009 |
20090074747 | Methods and Compositions for Treating Allergic Diseases - Disclosed in the present invention are antibodies that specifically recognize and antagonize human TSLP receptor, and methods of employing these antibodies to treat or ameliorate diseases or disorder mediated by TSLP signaling. | 03-19-2009 |
20090074748 | Immunological control of beta-amyloid levels in vivo - Disclosed herein are compositions and methods useful for controlling β-amyloid levels. In particular, the instant invention relates to an antibody that catalyzes hydrolysis of β-amyloid at a predetermined amide linkage are provided. The present invention also provides a vectorized antibody that is capable of crossing the blood brain barrier and is also capable of catalyzing the hydrolysis of β-amyloid at a predetermined amide linkage. Also provided are methods for modulating β-amyloid levels in vivo using antibodies that bind to β-amyloid. These compositions and methods have therapeutic applications, including the treatment of Alzheimer's disease. | 03-19-2009 |
20090074749 | IMMUNOGLOBULIN G (IgG) CONCENTRATE DEPLETED OF ANTI-A AND ANTI-B ANTIBODIES AND OF POLYREACTIVE IgGs - The present invention relates to an immunoglobulin G concentrate for therapeutic use, in which the respective contents of anti-A and anti-B antibodies are in accordance with a negative result in the in vitro indirect Coombs test. This IgG concentrate also has a polyreactive IgG content of between 0.01% and 0.1%, in particular between 0.07% and 0.1%, relative to the total content of IgG. | 03-19-2009 |
20090074750 | REGULATOR OF BASAL CELLULAR CALCIUM CONCENTRATION AND METHODS OF USE - The invention features methods and compositions for determining states of basal intracellular calcium levels in a eukaryotic cell. Also provided are methods for identifying an agent (e.g., a gene product or small molecule compound) that modulates basal intracellular calcium levels (e.g., by modulating STIM-2 activity), as well as kits and systems for practicing the subject methods. | 03-19-2009 |
20090074751 | GROWTH FACTOR FRACTION COMPOSITIONS AND METHODS - Compositions and formulations are provided comprising a growth factor fraction and at least one glucan. Also provided are methods for making the compositions and formulations. Methods of promoting growth in an animal using the compositions and/or formulations are also provided. | 03-19-2009 |
20090074752 | Surrogate Therapeutic Endpoint For Anti-CTLA-4 Based Immunotherapy Of Disease - The present invention provides a method of treatment using human sequence antibodies against human CTLA-4. In particular, methods of treating cancer are provided. | 03-19-2009 |
20090074753 | PLATELET-DERIVED GROWTH FACTOR COMPOSITIONS AND METHODS OF USE THEREOF - A method for promoting growth of bone, periodontium, ligament, or cartilage in a mammal by applying to the bone, periodontium, ligament, or cartilage a composition comprising platelet-derived growth factor at a concentration in the range of about 0.1 mg/mL to about 1.0 mg/mL in a pharmaceutically acceptable liquid carrier and a pharmaceutically-acceptable solid carrier. | 03-19-2009 |
20090081189 | Process for in vitro differentiation of neuronal stem cells or of cells derived from neuronal stem cells - The process for in vitro differentiation of neuronal stem cells comprises contacting the cells with a substance which inhibits a reaction of the Wnt signal transduction pathway, and culturing of said cells under conditions which enable said cells to propagate and/or differentiate. | 03-26-2009 |
20090081190 | Methods for Antibody Library Screening - The present invention provides an improved method of screening a library of molecules to identify or select one or more members thereof which are candidate binding partners for one or more target entities: (a) contacting an expression library with one or more target entities; (b) subjecting said target entities to at least one washing step; (c) separating target entities which have become bound to one or more members of the expression library from unbound members of the expression library by separation through an organic phase, thereby separating candidate binding partners for said target entities from other library members. | 03-26-2009 |
20090081191 | Antibodies that bind human 17-A1/EpCAM tumor antigen - The present invention provides an anti-human antibody or fragment thereof that is low or not immunogenic in humans. In particular, the antibodies or fragments are directed to human tumor antigens, preferably to the human tumor antigen 17-1A, also known as EpCAM, EGP or GA 733-2. Also provided are pharmaceutical compositions comprising the aforementioned antibodies or fragments thereto. | 03-26-2009 |
20090081192 | METHODS OF SCREENING FOR COMPOUNDS HAVING ANTI-INFLAMMATORY ACTIVITY - A method screens compounds out of the group consisting of proteins, peptides, peptidomimetics, antibodies and small organic molecules that increase the activity of the protein Rac1 by virtue of their binding to the extracellular portion of this protein. The method includes the steps of: contacting a confluent layer of cultured endothelial cells with at least one of test compounds, lysing the endothelial cells with a lysation buffer, and measuring the amount of Rac1 activity. | 03-26-2009 |
20090081193 | HEMAGGLUTININ POLYPEPTIDES, AND REAGENTS AND METHODS RELATING THERETO - The present invention provides a system for analyzing interactions between glycans and interaction partners that bind to them. The present invention also provides HA polypeptides that bind to umbrella-topology glycans, and reagents and methods relating thereto. | 03-26-2009 |
20090081194 | COMPOSITIONS AND METHODS FOR REDUCING RISK OF DEVELOPMENT, OR SEVERITY, OF INAPPROPRIATE IMMUNE RESPONSE IN EYES - A composition for reducing the risk of development, or severity, of an inappropriate immune response in an eye comprises an antagonist to at least a human TLR, an antagonist to at least a coreceptor of human TLR, a compound that is capable of inhibiting an activation of a human TLR signaling pathway, or a combination thereof. The composition can be used to reduce the risk of development, or severity, of contact lens-associated corneal infiltrates. The composition can be formulated into an eye drop or a contact lens-treating, -storing, -cleaning, -disinfecting, or -wetting solution. | 03-26-2009 |
20090081195 | Inhibitors of Ste20-like Kinase (SLK) and Methods of Modulating Cell Cycle Progression and Cell Motility - The invention provides inhibitors of Ste20-like kinase (SLK inhibitors). The inhibitors may be employed to modulate proliferation of cells, including tumor and cancer cells. The inhibitors also may be employed to inhibit motility or migration of cells, including cancer and tumor cells. | 03-26-2009 |
20090081196 | Medicaments for fungal infections - The protein CAMP65p of | 03-26-2009 |
20090081197 | Methods for Selection of Melanocortin Receptor-Specific Agents for Treatment of Obesity - Provided are methods for selecting melanocortin receptor-specific compounds for attenuating food intake and for treatment of specific disease conditions, including treatment of obesity and related energy homeostasis or feeding disorders characterized by excess weight gain, without inducing a sexual response, and methods for selecting compounds for treatment of sexual dysfunction. Further provided are pharmaceutical preparations defined by such methods, and methods and preparations for attenuating food intake and treatment of said conditions. | 03-26-2009 |
20090081198 | IMMUNE REGULATORY OLIGONUCLEOTIDE (IRO) COMPOUNDS TO MODULATE TOLL-LIKE RECEPTOR BASED IMMUNE RESPONSE - The invention provides novel immune regulatory oligonucleotides (IRO) as antagonist of TLRs and methods of use thereof. These IROs have unique sequences that inhibit or suppress TLR-mediated signaling in response to a TLR ligand or TLR agonist. The methods may have use in the prevention and treatment of cancer, an autoimmune disorder, airway inflammation, inflammatory disorders, infectious disease, skin disorders, allergy, asthma or a disease caused by a pathogen. | 03-26-2009 |
20090081199 | Novel receptor trem (triggering receptor expressed on myeloid cells) and uses thereof - Novel activating receptors of the Ig super-family expressed on human myeloid cells, called TREM(s) (triggering receptor expressed on myeloid cells) are provided. Specifically, two (2) members of TREMs, TREM-1 and TREM-2 are disclosed. TREM-1 is a transmembrane glycoprotein expressed selectively on blood neutrophils and a subset of monocytes but not on lymphocytes and other cell types and is upregulated by bacterial and fungal products. Use of TREM-1 in treatment and diagnosis of various inflammatory diseases is also provided. TREM-2 is also a transmembrane glycoprotein expressed selectively on mast cells and peripheral dendritic cells (DCs) but not on granulocytes or monocytes. DC stimulation via TREM-2 leads to DC maturation and resistance to apoptosis, and induces strong upregulation of CCR7 and subsequent chemotaxis toward macrophage inflammatory protein 3-β. TREM-2 has utility in modulating host immune responses in various immune disorders, including autoimmune diseases and allergic disorders. | 03-26-2009 |
20090081200 | Tissue Factor Antibodies and Uses Thereof - The present invention provides antibodies capable of binding to human tissue factor, which do not inhibit tissue factor mediated blood coagulation compared to a normal plasma control. Further described are methods of making and methods of using the antibodies of the invention. | 03-26-2009 |
20090081201 | Methods for Identifying Compounds For the Treatment of Type 1 Diabetes - The present invention provides methods of identifying candidate compounds for the treatment of type I diabetes comprising contacting pancreatic β cells with an amount of apolipoprotein CIII (“apoCIII”) effective to increase intracellular calcium concentration, in the presence of one or more test compounds, and identifying those test compounds that inhibit an apoCIII-induced increase in intracellular calcium concentration in the pancreatic β cells. The present invention also provides methods for treating patients with type I diabetes comprising administering to the patient an amount effective of an inhibitor of apoCIII to reduce apoCIII-induced increase in intracellular calcium concentration in pancreatic β cells. | 03-26-2009 |
20090081202 | IMMUNOGENIC COMPOSITIONS AND METHODS - Disclosed are immunogenic compositions, and methods for their use in the formulation and administration of therapeutic and prophylactic pharmaceutical agents. In particular, the invention provides immunogenic compositions and methods for preventing, treating, and/or ameliorating microbial infection, including, for example, influenza, or one or more symptoms thereof. | 03-26-2009 |
20090081203 | Methods for treating lymphomas in certain patient populations and screening patients for said therapy - Methods for predicting a response of a patient having a lymphoma to a therapy regimen of 3-(4-amino-1-oxo-1,3-dihydro-isoindol-2-yl)-piperidine-2,6-dione using prognostic factors of a patient's disease burden, absolute lymphocyte count or time since last rituximab therapy are disclosed. Specific methods of treating a lymphoma encompass the administration of 3-(4-amino-1-oxo-1,3-dihydro-isoindol-2-yl)-piperidine-2,6-dione to a patient who has one or more of the favorable profiles, alone or in combination with immunosuppressive agents such as rituximab. | 03-26-2009 |
20090081204 | SYNTHETIC IMMUNOGENIC BUT NON-AMYLOIDOGENIC PEPTIDES HOMOLOGOUS TO AMYLOID BETA FOR INDUCTION OF AN IMMUNE RESPONSE TO AMYLOID BETA AND AMYLOID DEPOSITS - The present invention relates to synthetic immunogenic but non-amyloidogenic peptides homologous to amyloid β which can be used alone or conjugated to an immunostimulatory molecule in an immunizing composition for inducing an immune response to amyloid β peptides and amyloid deposits. | 03-26-2009 |
20090081205 | CONTINUOUS DOSING REGIMENS FOR NEURAL STEM CELL PROLIFERATING AGENTS AND NEURAL STEM CELL DIFFERENTIATING AGENTS - The present invention provides effective dosing regimes for neural stem cell proliferating agents, kits containing effective dosing regimes for neural stem cell proliferating agents, and uses thereof. In particular, neural stem cell proliferating agents, such as hCG, prolactin and EPO are delivered to mammalian subjects at low doses in a continuous fashion over several days, as opposed to delivery of high doses in a short period of time. | 03-26-2009 |
20090081206 | METHOD AND PHARMACEUTICAL COMPOSITION FOR INHIBITING PREMATURE RAPTURE OF FETAL MEMBRANES, RIPENING OF UTERINE CERVIX AND PRETERM LABOR IN MAMMALS - A method and a pharmaceutical composition for inhibiting premature rapture of the fetal membranes, ripening of the uterine cervix and preterm labor of female mammals including human. The method includes the step of administering compounds for reversing at least two biochemical conditions being associated with the above processes. The pharmaceutical composition includes compounds for reversing at least two biochemical conditions being associated with the above processes. | 03-26-2009 |
20090087423 | Novel protein complex and use thereof - The present invention provides a novel binding protein, a preventive/therapeutic agent for cancer or neurodegenerative diseases, etc. Specifically, the substance that inhibits the binding of (a) a protein comprising the same or substantially the same amino acid sequence as the amino acid sequence represented by SEQ ID NO: 26, a partial peptide thereof, or a salt thereof and (b) a protein comprising the same or substantially the same amino acid sequence as the amino acid sequence represented by SEQ ID NO: 27 or SEQ ID NO: 29, a partial peptide thereof, or a salt thereof is useful as an agent for the prevention/treatment of, e.g., cancer, etc., and the substance that promotes the above binding is useful as an agent for the prevention/treatment of, e.g., neurodegenerative diseases, etc. | 04-02-2009 |
20090087424 | Modulating Retinal Pigmented Epithelium Permeaion By Inhibiting Or Activating VEGFR-1 - Described is a method for use of an agonist or an antagonist of VEGFR-1 in the treatment or prevention of diseases wherein disorders of the retinal pigment epithelium permeation are involved. | 04-02-2009 |
20090087425 | Combination of nitroderivatized steroid and bronchodilator for treating respiratory disease - There is provided a pharmaceutical composition for treating respiratory disease comprising an NO-donating steroid and at least one bronchodilator. Also provided is a method for treating respiratory diseases associated with inflammation comprising administering an NO-donating steroid with at least one bronchodilator. Method of use of the combination of an NO-donating compound, and a steroid with at least one bronchodilator for treating respiratory disease is also provided. | 04-02-2009 |
20090087426 | Methods for Treatment of Allergic Asthma - Methods of treatment of allergic asthma with IgE antagonists, including anti-IgE antibodies, IgE variants, peptide antagonists, peptidomimetics and other small molecules, are described. | 04-02-2009 |
20090092592 | Methionyl tRNA Synthetase Polynucleotides - The invention provides metS polypeptides and DNA (RNA) encoding metS polypeptides and methods for producing such polypeptides by recombinant techniques. Also provided are methods for utilizing metS polypeptides to screen for antibacterial compounds. | 04-09-2009 |
20090092593 | THERAPEUTIC DRUG FOR HEART DISEASE AND VIRUS DISEASE - The present invention is related to provide a therapeutic drug for heart diseases and viral diseases. The invention provides a therapeutic drug for heart diseases and viral diseases, comprising a free immunoglobulin light chain or a constitutive polypeptide thereof as an active ingredient. | 04-09-2009 |
20090092594 | MAMMALIAN GENES INVOLVED IN VIRAL INFECTION AND TUMOR SUPPRESSION - The present invention provides methods of identifying cellular genes necessary for viral growth and cellular genes that function as tumor suppressors. Thus, the present invention provides nucleic acids related to and methods of reducing or preventing viral infection or cancer. The invention also provides methods of producing substantially virus-free cell cultures and methods for screening for additional such genes. | 04-09-2009 |
20090092595 | Suppression of sPLA2-integrin binding for treating an inflammatory condition - The present invention relates to the discovery that a secretory phospholipase A2 (sPLA2-IIA) plays an active role in mediating inflammatory signaling by way of its specific binding with integrin, especially integrin αvβ3 or α4β1. More specifically, the invention provides a method for identifying inhibitors of inflammatory signaling by screening for compounds that interrupt the specific binding of sPLA2 and integrin. The invention also provides the novel use of a substance that suppresses the specific binding between sPLA2 and integrin for treating or preventing an inflammatory condition. | 04-09-2009 |
20090092596 | Biological markers predictive of anti-cancer response to insulin-like growth factor-1 receptor kinase inhibitors - The present invention provides diagnostic and prognostic methods for predicting the effectiveness of treatment of a cancer patient with an IGF-1R kinase inhibitor. Methods are provided for predicting the sensitivity of tumor cell growth to inhibition by an IGF-1R kinase inhibitor, comprising assessing whether the tumor cell has undergone an epithelial to mesenchymal transition (EMT), by determining the expression level of epithelial and/or mesenchymal biomarkers, wherein tumor cells that have undergone an EMT are substantially less sensitive to inhibition by IGF-1R kinase inhibitors. Improved methods for treating cancer patients with IGF-1R kinase inhibitors that incorporate the above methodology are also provided. Additionally, methods are provided for the identification of new biomarkers that are predictive of responsiveness of tumors to IGF-1R kinase inhibitors. Furthermore, methods for the identification of agents that restore the sensitivity of tumor cells that have undergone EMT to inhibition by IGF-1R kinase inhibitors are also provided. pErk, HER3 and pHER are also demonstrated to be effective biomarkers for predicting sensitivity of tumor cells to IGF-1R kinase inhibitors. | 04-09-2009 |
20090098105 | Treatment of neurodegenerative diseases by the use of scd4 inhibitors - The present invention relates to the use of SCD4 interacting molecules, especially SCD4 inhibitors, for the preparation of a medicament for the treatment of neurodegenerative diseases, particularly Alzheimer's disease. | 04-16-2009 |
20090098106 | PHARMACEUTICAL COMPOSITIONS FOR TREATING DISEASES ASSOCIATED WITH NF-kB ACTIVITY - A method of treating a disease associated with NF-κB activity. The method is effected by providing to a subject in need thereof a therapeutically effective amount of an agent capable of modulating NIK-HC8 binding. | 04-16-2009 |
20090098107 | Method of Detecting Relative Risk for the Onset of Atopic Dermatitis by Gene Single Nucleotide Polymorphism Analysis - The present invention provides a method of discriminating a relative risk for the morbidity of atopic dermatitis of a test subject comprising: analyzing gene polymorphism of two or more of genes related to onset of atopic dermatitis using a sample isolated from a statistically significant number of normal persons and patients of atopic dermatitis to determine relative ratios (percentages (%)) related to the individual gene polymorphism of individual derived from the analysis; and calculating an odds ratio according to specified gene polymorphism from the relative ratio; and using, as a discrimination criterion, a combination of two or more of gene polymorphisms showing a synergetically higher odds ratio than odds ratios according to individual gene polymorphism. The method is useful for predicting susceptibility of an AD patient to chemicals based on genes and for selecting the diagnostic and/or therapeutic agent by eliminating harmful drug reactions from the analysis of principal factors related to onset and development of AD and interaction among these genes, and for determining a diagnostic method and therapeutic method using the detection method of morbidity risk. | 04-16-2009 |
20090098108 | USE OF LONG-ACTING GLP-1 RECEPTOR AGONISTS TO IMPROVE INSULIN SENSITIVITY AND LIPID PROFILES - The present invention provides to at least one novel human GLP-1 receptor agonist, or specified portion or variant, including isolated nucleic acids that encode at least one GLP-1 receptor agonist, or specified portion or variant, GLP-1 receptor agonist, or specified portion or variants, vectors, host cells, transgenic animals or plants, and methods of making and using thereof, including the use of long acting GLP-1 receptor agonists to improve insulin sensitivity or lipid profiles in obesity and related therapeutic and/or diagnostic compositions, methods and devices. | 04-16-2009 |
20090098109 | Compositions and Methods For Enhancing Neuronal Plasticity and Regeneration - The present invention relates PirB expression and function in nervous tissue. PirB expressed in neurons acts to restrict plasticity of neural circuits, and/or, restrict competition between circuits with different activity patterns or levels, for cortical representation. Thus, the present invention relates to methods of increasing nervous system plasticity and associated disorders and diseases in a subject comprising administering to the subject an agent which modulates the activity, signal transduction or expression of PirB in neurons of the subject. | 04-16-2009 |
20090098110 | INJECTABLE FORMS OF SOLID-FORMING CROSSLINKED BIOELASTIC BIOPOLYMERS FOR LOCAL DRUG DELIVERY - A method for delivering a compound of interest to a selected region in a subject is carried out by administering a composition to the region of interest, the composition comprising a cross-linked bioelastomer in combination with the compound of interest non-covalently combined with the cross-linked bioelastomer. In some embodiments, the composition is produced by the process of cross-linking a bioelastomer to produce a cross-linked polymer thereof, and then combining said cross-linked polymer with said compound of interest. Methods of making the compositions, and kits useful for carrying out the method, are also described. | 04-16-2009 |
20090098111 | Methods for modulating checkpoint activation through TopBP1 - ATR kinase is a key regulator of checkpoint responses to incompletely replicated and damaged DNA. Without this checkpoint, cells will enter mitosis prematurely, likely resulting in cell death. The invention provides methods and reagents to either block or activate the activation of the ATR kinase checkpoint, through, for example, either blocking or activating the expression of an ATR activator TopBP1. The invention also provides screening methods to identify additional ToBP1 inhibitors or activators that may be used to modulate the activity of the ATR checkpoint. | 04-16-2009 |
20090098112 | NOVEL ANTIBODIES - The present invention relates to the use of VEGF antagonists and a novel anti-α5β1 antibody for treating cancer and inhibiting angiogenesis and/or vascular permability, including inhibiting abnormal angiogenesis in diseases. The present invention also relates to compositions and kits comprising novel anti-α5β1 antibodies and methods of making and using them. | 04-16-2009 |
20090098113 | Activin-ActRIIa antagonists and uses for promoting bone growth - In certain aspects, the present invention provides compositions and methods for promoting bone growth and increasing bone density. | 04-16-2009 |
20090098114 | ALK7 and myostatin inhibitors and uses thereof - The invention relates to ALK7 soluble receptors and their uses as antagonists of the function of certain ligands such as GDF-8 (Myostatin) and GDF-11. The ALK7 soluble receptor of the invention is useful as antagonists of GDF-8 and GDF-11 in the treatment of neuronal diseases or conditions such as stroke, spinal cord injury, and all peripheral nerve diseases. The ALK7 soluble receptor of the invention is also useful as GH (growth hormone) equivalent, and for increasing muscle mass. | 04-16-2009 |
20090104177 | PEPTIDES FOR INHIBITING THE INTERACTION OF PROTEIN KINASE A AND PROTEIN KINASE A ANCHOR PROTEINS - The invention relates to a nucleic acid sequence encoding peptides which inhibit the interaction of protein kinase A (PKA) and protein kinase A anchor proteins (AKAP), to a host organism comprising said nucleic acid sequence and optionally expressing said peptides, to the use of said peptides and of said host organism in investigating diseases associated with said AKAP-PKA interaction, and to the use of said peptides as pharmaceutical agent for the treatment of such diseases. | 04-23-2009 |
20090104178 | Chemokine binding activity of viral tnf receptors and related proteins - Chemokine binding activity of viral TNF receptors and related proteins. The invention relates to a C-terminal domain (CTD) of viral tumour necrosis factor receptors (vTNFRs) CrmB or CrmD or CTD homologues (CTD1, CTD2 and CTD3) from poxvirus and their functional homologues, including derivatives, and fragments, for use in binding chemokines and their analogues and/or to enhance the immunomodulatory properties of TNFRs or in bloking binding of chemokines to their corresponding cell surface receptors and/or to modulate chemokine biological activity. | 04-23-2009 |
20090104179 | Ionizing-radiation-responsive compositions, methods, and systems - A method, composition and system respond to ionizing radiation to adjust biological activity. In some approaches the ionizing radiation is X-ray or extreme ultraviolet radiation that produces luminescent responses that induce biologically active responses. | 04-23-2009 |
20090104180 | NOVEL P-SELECTIN LIGAND PROTEIN - A novel P-selectin ligand glycoprotein is disclosed, comprising the amino acid sequence set forth in SEQ ID NO:2 or by the amino acid sequence set forth in SEQ ID NO:4. DNA sequences encoding the P-selectin ligand protein are also disclosed, along with vectors, host cells, and methods of making the P-selectin ligand protein. Pharmaceutical compositions containing the P-selectin ligand protein and methods of treating inflammatory disease states characterized by P-selectin- and E-selectin-mediated intercellular adhesion are also disclosed. | 04-23-2009 |
20090104181 | Antibodies for Discrimination of Prions - In the present invention, we described the use of anti-DNA antibody for the detection of prions and diagnosis of Transmissible Spongiform Encephalopathies (TSE) diseases in animals and humans. | 04-23-2009 |
20090104182 | INHIBITION OF TRISTETRAPROLINE FOR PROTECTION OF THE HEART FROM CARDIAC INJURIES - The present invention relates to compounds suitable for the treatment of conditions which may be improved, at least in part, by increasing TNF α production. The invention further relates to assays for the identification of an individual at increased risk for or suffering front such conditions and to methods of screening compounds for their ability to enhance TNF α biosynthesis. | 04-23-2009 |
20090104183 | GLUE COMPOSITION FOR LUNG VOLUME REDUCTION - The present invention relates to methods and compositions for sealing localized regions of damaged lung tissue to reduce overall lung volume. The glue compositions provide a glue featuring an adhering moiety coupled to one or more other moieties including, for example, a cross-linkable moiety and/or one other adhering moiety. The methods and compositions of the invention find use, for example, in treating pulmonary conditions, such as emphysema. | 04-23-2009 |
20090110676 | BAFF, Inhibitors Thereof and Their Use in the Modulation of B-Cell Response and Treatment of Autoimmune Disorders - The invention provides methods for treating or preventing disorders associated with expression of BAFF comprising BAFF and fragments thereof, antibodies, agonists and antagonists. | 04-30-2009 |
20090110677 | POLYPEPTIDE REGULATING PHOSPHATE METABOLISM, CALCIUM METABOLISM, CALCIFICATION AND VITAMIN D METABOLISM AND DNAS ENCODING THE SAME - A DNA, which encodes the following polypeptide (a), (b), (c) or (d):
| 04-30-2009 |
20090117095 | Methods and compositions for diagnosis and treatment of b cell chronic lymphocytic leukemia - Provided are isolated and purified preparations of a combination of a light chain antibody gene and a heavy chain antibody gene, where the light chain and heavy chain antibody genes are the same among more than one patient with B cell chronic lymphocytic leukemia (B-CLL). Vectors comprising those genes and cells comprising those vectors are also provided, as are isolated and purified antibodies encoded by the antibody genes. Anti-idiotype antibodies, peptides, and aptamers that bind to the antigen-binding region of an antibody encoded by the antibody genes are additionally provided, as are multimeric molecules comprising multiple binding sites that bind to the antigen-binding region of an antibody encoded by the antibody genes. Methods of determining whether a patient with B cell chronic lymphocytic leukemia (B-CLL) has a form of B-CLL that is susceptible to treatment directed to eliminating idiotype specific B cell receptor-bearing B-CLL cells are also provided, as are methods of following the progression of treatment of B-CLL in the patient. Additionally, methods of treating a patient having B-CLL are provided, as are methods of identifying a therapeutic agent for B-CLL. | 05-07-2009 |
20090117096 | METHODS AND COMPOSITIONS FOR INHIBITION OF METASTASIS - This invention generally relates to methods of producing an antibody phage population having affinity for a tumor cell target expressing a metastatic phenotype. The invention further relates to antibody compositions that specifically bind to a cell surface receptor on the metastatic cell. | 05-07-2009 |
20090117097 | Stabilizer for Protein Preparation Comprising Meglumine and Use Thereof - An objective of the present invention is to provide methods for stabilizing proteins and methods for suppressing protein aggregation, which comprise the step of adding for suppressing protein aggregation, which comprise meglumine. Still another objective of the present invention is to provide pharmaceutical compositions comprising antibody molecules stabilized by meglumine, methods for producing the pharmaceutical compositions, and kits comprising the pharmaceutical compositions. | 05-07-2009 |
20090117098 | Complement C1Q Inhibitors For The Prevention And Treatment Of Glaucoma - The invention concerns in one embodiment a method of treating glaucoma or elevated intraocular pressure comprising administering a pharmaceutically effective amount of a composition comprising a Complement C1q inhibitor. In another embodiment, the invention concerns a composition for the treatment of elevated intraocular pressure and glaucoma, the composition comprising a pharmaceutically effective amount of a Complement C1q inhibitor. | 05-07-2009 |
20090117099 | EXTRACELLULAR HISTONES AS BIOMARKERS FOR PROGNOSIS AND MOLECULAR TARGETS FOR THERAPY - Hyper-inflammatory responses can lead to a variety of diseases including sepsis. It is now shown that extracellular histones released in response to inflammatory challenge are mediators contributing to endothelial dysfunction, organ failure and death during sepsis. As such, they can be targeted pharmacologically by inhibitors, as well as used as biomarkers for prognosis of sepsis and other diseases. | 05-07-2009 |
20090117100 | Cysteine engineered anti-TENB2 antibodies and antibody drug conjugates - Cysteine engineered anti-TENB2 antibodies are engineered by replacing one or more amino acids of a parent anti-TENB2 antibody with non cross-linked, reactive cysteine amino acids. Methods of design, preparation, screening, and selection of the cysteine engineered anti-TENB2 antibodies are provided. Cysteine engineered anti-TENB2 antibodies (Ab) are conjugated with one or more drug moieties (D) through a linker (L) to form cysteine engineered anti-TENB2 antibody-drug conjugates having Formula I: | 05-07-2009 |
20090123456 | Treatment of pancreatitis using alpha 7 receptor-binding cholinergic agonists - A method of treating a patient suffering from pancreatitis comprising treating said patient with a therapeutically effective amount of a cholinergic agonist selective for an α7 nicotinic receptor in an amount sufficient to decrease the amount of the proinflammatory cytokine that is released from a macrophage wherein said condition is acute pancreatitis. The compounds of the present invention include a quaternary analog of cocaine; (1-aza-bicyclo[2.2.2]oct-3-yl)-carbamic acid 1-(2-fluorophenyl)-ethyl ester; a compound of formula (I), a compound of formula (II), a compound of formula (III), a compound of formula (IV), and an oligonucleotide or mimetic capable of attenuating the symptoms of acute pancreatitis wherein the oligonucleotide or mimetic consists essentially of a sequence greater than 5 nucleotides long that is complementary to an mRNA of an α7 cholinergic receptor. The variables of formulae (I), (II), (III) and (IV) are described herein. | 05-14-2009 |
20090123457 | Lumican proteoglycan in the diagnosis and treatment of atherosclerosis - The invention relates to methods of reducing formation of atheromas and methods of treating atherosclerotic lesions and/or atherosclerosis by reducing the amount of lumican proteglycan in the intima or an artery or in the lesion. The invention also relates to methods of identifying subjects having or at risk of having atherosclerosis comprising detecting an increased amount of lumican proteoglycan in a subject. | 05-14-2009 |
20090123458 | Protective Antigen Having Fluorinated Histidine Residues - The unnatural amino acid analogue 2-fluorohistidine (2-FHis) was incorporated into protective antigen to produce a protein which resists protonation at physiological pH by reducing the side-chain pKa. The protein structure was unperturbed by the incorporation of fluorinated histidine residues, and the heptameric (2-FHisPA | 05-14-2009 |
20090123459 | COMPOSITIONS AND METHOD FOR THE DIAGNOSIS, PREVENTION AND TREATMENT OF ALZHEIMER'S DISEASE - Disclosed herein are methods of diagnosing, preventing and treating Alzheimer's disease based on the use of an inhibitor for the binding of amyloid-β (Aβ) to FcγRIIb, and a method of screening the inhibitor. The inhibitor is selected from the group consisting of an FcγRIIb protein or a variant thereof, an FcγRIIb extracellular domain, an anti-FcγRIIb antibody, an FcγRIIb-specific peptide and an FcγRIIb-specific siRNA. The inhibitor reduces the toxic signaling and intracellular translocation of Aβ and the neurotoxicity, neuronal cell death and memory impairment mediated by Aβ by inhibiting the binding between Aβ and FcγRIIb. Thus, the inhibitor is useful in the diagnosis, prevention and treatment of Alzheimer's disease. | 05-14-2009 |
20090123460 | IMMUNOSTIMULATORY COMBINATIONS - The present invention provides immunostimulatory combinations. Generally, the immunostimulatory combinations include a TLR agonist and a TNF/R agonist. Certain immunostimulatory combinations also may include an antigen. | 05-14-2009 |
20090123461 | HUMAN PODOCALYXIN ALTERNATIVE-SPLICED FORMS AND USES THEREOF - The present invention provides a method for diagnosing and detecting cancer. The present invention provides one or more proteins or fragments thereof, peptides or nucleic acid molecules differentially expressed in cancer (podocalyxin) and antibodies that bind podocalyxins. The present invention provides that podocalyxins are used as targets for screening agents that modulate podocalyxin activities. Further the present invention provides methods for treating diseases associated with podocalyxin expression. | 05-14-2009 |
20090123462 | FGFR AGONISTS - The present invention relates to the use of Fibroblast-Growth Factor Receptor (FGFR) agonists for the diagnosis, prevention and/or treatment of pathological conditions including, but not limited to hyperproliferative disorders, bone diseases and vascular diseases. Particularly, the use of FGFR-4 agonists, e.g. anti-FGFR-4 antibodies is described. Further, the invention relates to a pharmaceutical composition comprising the agonist as described above and a screening procedure. | 05-14-2009 |
20090130088 | Compositions and methods for regulating RNA translation via CD154 CA-dinucleotide repeat - Compositions and methods for regulating CD154 gene expression are provided that rely on the interaction of hnRNP L with the CA-dinucleotide rich sequence of the 3′-untranslated region of CD154. | 05-21-2009 |
20090130089 | ANTI-CD20 ANTIBODIES AND METHODS OF USE - Compositions and methods are provided for treating diseases associated with CD20, including lymphomas, autoimmune diseases, and transplant rejections. Compositions include anti-CD20 antibodies capable of binding to a human CD20 antigen located on the surface of a human CD20-expressing cell, wherein the antibody has increased complement-dependent cell-mediated cytotoxicity (CDC) that is achieved by having at least one optimized CDR engineered within the variable region of the antibody. Compositions also include antigen-binding fragments, variants, and derivatives of the monoclonal antibodies, cell lines producing these antibody compositions, and isolated nucleic acid molecules encoding the amino acid sequences of the antibodies. The invention further includes pharmaceutical compositions comprising the anti-CD20 antibodies of the invention, or antigen-binding fragments, variants, or derivatives thereof, in a pharmaceutically acceptable carrier, and methods of use of these anti-CD20 antibodies. | 05-21-2009 |
20090130090 | N-amide Derivatives of 8-Azabicyclo[3.2.1]OCT-3-YL AS CCR1 Antagonists - New antagonists of the interaction between the CCR1 Chemokine receptor and its ligands, including MIP-1α (CCL3), represented by formula (I) are disclosed, as well as pharmaceutical compositions comprising them and their use in therapy for the treatment of pathological conditions or diseases susceptible of being improved by antagonism of the CCR1 receptor. | 05-21-2009 |
20090130091 | COMPOUNDS FOR HEDGEHOG PATHWAY BLOCKADE IN PROLIFERATIVE DISORDERS, INCLUDING HEMATOPOIETIC MALIGNANCIES - Elevated Hedgehog (Hh) pathway activity, including ligand stimulated Hh pathway activity, was detected in hematopoietic malignancy cells, and determined to be associated with growth and proliferation of the malignancy cells. Accordingly, methods are provided for treating a hematopoietic cell malignancy associated with elevated Hh pathway activity by reducing or inhibiting the Hh pathway activity. Also provided are methods of determining the responsiveness of a hematopoietic cell malignancy to treatment with an Hh pathway antagonist. | 05-21-2009 |
20090130092 | NUCLEOTIDE PHOSPHATE DISSIPATION AS A TREATMENT FOR VASCULAR DISORDERS - The present invention provides a method of treating or preventing immunoinflammatory, vascular, thrombotic or ischemic disorders in a subject, the method comprises administering to the subject an agent which dissipates nucleotide phosphates or generates a product which stimulates adenosine receptors. The present invention also provides a method of treating or preventing immunoinflammatory, thrombotic or ischemic disorders in a subject by inhibiting leukocyte infiltration into a site which comprises administering to the subject an effective amount a described agent. Agents described for use in the methods of the invention include CD73, a fragment a mutant, or a modified form thereof. | 05-21-2009 |
20090130093 | BINDING MEMBER FOR GM-CSF RECEPTOR - Binding members for alpha chain of receptor for granulocyte macrophage colony stimulating factor (GM-CSFRα), especially antibody molecules. Use of the binding members in treating inflammatory and autoimmune diseases, e.g. rheumatoid arthritis, asthma, allergic response, multiple sclerosis, myeloid leukaemia and atherosclerosis. | 05-21-2009 |
20090136479 | Ubiquitin-like protein isg15 for hiv inhibition - The instant invention provides methods for the treatment and prevention of viral infection, e.g., HIV infection, based on the discovery that viral replication utilizes the ubiquitination pathway of the host cell to replicate. Specifically, the invention provides methods for the treatment and prevention of viral infection, e.g., HIV infection, by modulation of ISG15 conjugation and deconjugation, e.g., by modulation of the activity or expression of UBP43 or UBEL-1. | 05-28-2009 |
20090136480 | Transcutaneous immunostimulation - Transcutaneous immunostimulation administers at least one adjuvant by transcutaneous immunization to a subject who has undergone, is undergoing, or will undergo conventional vaccination or another immune response. A subject is selected for treatment to stimulate the immune response to a conventional vaccine or other immuno-therapy. A suspicion, medical history, or determination by a physician or veterinarian that the subject may fail to respond or only poorly respond to conventional vaccination or other immunotherapy because of age, acquired or congenital immunodeficiency, immunosuppression caused by disease or ablative therapy, or the use of reduced amounts of antigen in the conventional vaccine can be used to select subjects in need of treatment. | 05-28-2009 |
20090136481 | Use of Myostatin (GDF-8) Antagonists for Treatment of Sarcopenia (Age-Related Muscle-Wasting) - The present invention relates to a method of treating sarcopenia in a human or animal patient by inhibiting the activity of myostatin using one or more myostatin antagonists. | 05-28-2009 |
20090136482 | DRUG TARGET PROTEIN AND TARGET GENE, AND SCREENING METHOD - The present invention provides target proteins and target genes for bioactive substances such as drugs, and means that enable the development of novel bioactive substances using the same. More specifically, the present invention provides target proteins and target genes for bioactive substances; screening methods for substances capable of regulating bioactivities; bioactivity regulators; a bioactive substance derivative production method; a complex comprising a bioactive substance and a target protein, and a method of producing the complex; and kits comprising a bioactive substance or a salt thereof; determination methods for the onset or risk of onset of a specified disease or condition, determination methods for susceptibility to a bioactive substance, and determination kits used for the determination methods, and the like. | 05-28-2009 |
20090136483 | Compositions and Methods for Binding Lysophosphatidic Acid - Compositions and methods for making and using anti-LPA agents, for example, monoclonal antibodies, are described. | 05-28-2009 |
20090136484 | Novel antibody molecules and nucleic acids - An scFv peptide comprising a V | 05-28-2009 |
20090136485 | Methods and compositions for inhibiting CD32B expressing cells - The present invention relates to immunoglobulins that bind FcγRIIb+ cells and coengage the antigen on the cell's surface and an FcγRIIb on the cell's surface, methods for their generation, and methods for using the immunoglobulins. | 05-28-2009 |
20090136486 | Biomarkers for human papilloma virus-associated cancer - Cervical cancer cells and HPV | 05-28-2009 |
20090136487 | BMX MEDIATED SIGNAL TRANSDUCTION IN IRRADIATED VASCULAR ENDOTHELIUM - Provided are methods for modulating the proliferation of cells and tissues. In some embodiments, the methods include administering to a subject an effective amount of a modulator of a biological activity of a bone marrow X kinase (Bmx) gene product. Also provided are methods for increasing the radiosensitivity of a target cell or tissue, methods for suppressing tumor growth, methods for inhibiting tumor blood vessel growth, and compositions that include modulators of a biological activity of a bone marrow X kinase (Bmx) gene product. | 05-28-2009 |
20090136488 | Inhibition of cancer metastasis - P-Selectin on platelets and endothelium binds cell surface chondroitin sulfate (CS) proteoglycans, which are abundantly and stably expressed on the surface many cancer cells. Binding of the cancer cells through the CS moieties may be blocked to inhibit the interaction of cancer cells with platelets and endothelium. The present inventors disclose compositions and methods for the inhibition of cancer metastasis. | 05-28-2009 |
20090136489 | METHODS FOR THE TREATMENT, DIAGNOSIS, AND PROGNOSIS OF CANCER - We have discovered that antizyme inhibitor (AZI) is expressed at increased levels in highly proliferating cells. We have also discovered that inhibiting antizyme inhibitor, including inhibiting its expression, reduces the growth of cancer cells. The present invention is directed to the use of inhibitors of antizyme inhibitor for the treatment of cancer, the use of antizyme inhibitor for the diagnosis and prognosis of cancer, and methods for identifying novel cancer treatments. | 05-28-2009 |
20090142332 | Identification of Biomarkers by Serum Protein Profiling - The present invention relates to methods of determining colorectal cancer status in a subject. The invention further relates to kits for determining colorectal cancer status in a subject. The invention further related to methods of identifying biomarker for determining colorectal cancer status in a subject. | 06-04-2009 |
20090142333 | Activin-actriia antagonists and uses for promoting bone growth in cancer patients - In certain aspects, the present invention provides compositions and methods for promoting bone growth and increasing bone density, as well as for the treatment of multiple myeloma. | 06-04-2009 |
20090142334 | DETECTION AND MODULATION OF IAPs AND NAIP FOR THE DIAGNOSIS AND TREATMENT OF PROLIFERATIVE DISEASE - Disclosed are diagnostic and prognostic kits for the detection and treatment of proliferative diseases such as ovarian cancer, breast cancer, and lymphoma. Also disclosed are cancer therapeutics utilizing IAP antisense nucleic acids, IAP fragments, and antibodies which specifically bind IAP polypeptides. | 06-04-2009 |
20090142335 | Methods of diagnosis and treatment of metabolic disorders - The invention features diagnostic methods for metabolic disorders (e.g., diabetes and obesity), methods for screening for compounds useful in the treatment of metabolic disorders, and methods for treatment of metabolic disorders that involve sirtuin2. | 06-04-2009 |
20090142336 | METABOLIC REGULATORS AND USES THEREOF - The present invention relates to metabolic regulators that affect metabolic function, for example metabolic regulators that affect muscle mass, muscle regeneration, muscle hypertrophy, fat mass, insulin and glucose sensitivity, angiogenesis and cardiovascular function. In particular, the present invention relates to modulating metabolic function by administering an effective amount of a pharmaceutical composition comprising an agent, where the agent activates or inhibits the activity and/or gene expression of the metabolic regulator. The metabolic regulators of the present invention are, for example MSP1 (2160028F08Rik; SEQ ID NO: 16); MSP2 (2310043I08Rik; SEQ ID NO: 17); MSP3 (NM_026754;1 110017116Rik; SEQ ID NO: 1); MSP4 (4732466D17Rik; SEQ BD NO: 18); MSP 5 (NM_024237; 1600015H20Rik; SEQ ID NO: 12); Ins16 (AF_156094; SEQ ID NO: 20). The present invention also provides methods to screen for agents that affect the metabolic regulators of the present invention. | 06-04-2009 |
20090142337 | Pharmaceutical Combinations of Diazole Derivatives for Cancer Treatment - The invention provides a combination comprising (or consisting essentially of) an ancillary compound and a compound of the formula (I): or salts, tautomers, solvates and N-oxides thereof; wherein: R | 06-04-2009 |
20090148434 | Antibody Compositions and Methods - Provided are concentrated preparations comprising single immunoglobulin variable domain polypeptides that bind target antigen with high affinity and are soluble at high concentration, without aggregation or precipitation, providing, for example, for increased storage stability and the ability to administer higher therapeutic doses. | 06-11-2009 |
20090148435 | ANTIBODY PURIFICATION BY CATION EXCHANGE CHROMATOGRAPHY - A method for purifying an antibody by cation exchange chromatography is described in which a high pH wash step is used to remove of contaminants prior to eluting the desired antibody using an elution buffer with increased conductivity. | 06-11-2009 |
20090148436 | ANTIBODY TO GDF8 AND USES THEREOF - The disclosure provides novel molecules related to growth and differentiation factor-8 (GDF8), in particular epitopes specific to GDF8 and other specific antagonists of GDF8 in particular anti-GDF8 antibodies or antigen binding protein or fragment thereof which may inhibit GDF8 activity and signal in vitro and/or in vivo. The disclosure also provides for an immunoassay used to detect and quantitate GDF8. The disclosure also provides methods for diagnosing, preventing, ameliorating, and treating GDF8-associated disorders, e.g., degenerative orders of muscle, bone, and insulin metabolism. Finally, the disclosure provides pharmaceuticals for the treatment of such disorders by using the antibodies, polypeptides, polynucleotides, and vectors of the invention. | 06-11-2009 |
20090148437 | POLYPEPTIDES, ANTIBODY VARIABLE DOMAINS & ANTAGONISTS - The present invention relates to polypeptides e.g. protease resistant polypeptides, immunoglobulin (antibody) single variable domains e.g. which are protease resistant and also to vascular endothelial growth factor (VEGF) antagonists comprising these. The invention further relates to uses, formulations, and compositions comprising such polypeptides e.g. for delivery to the eye. | 06-11-2009 |
20090155241 | Prophylactic/therapeutic agent for cancer - A compound or its salt that inhibits the activity of a protein having the same or substantially the same amino acid sequence as the amino acid sequence represented by SEQ ID NO: 1; a compound or its salt that inhibits the expression of a gene for the protein; an antisense polynucleotide comprising a nucleotide sequence complementary or substantially complementary to the nucleotide sequence of a polynucleotide encoding the protein or a partial peptide thereof or a part of the nucleotide sequence; an antibody against the protein; etc. are useful as preventive/therapeutic agents for cancer, apoptosis promoters for cancer cells, or the like. | 06-18-2009 |
20090155242 | MAMMALIAN GENES; RELATED REAGENTS AND METHODS - Nucleic acids encoding mammalian, e.g., primate or rodent, genes, purified proteins and fragments thereof. Antibodies, both polyclonal and monoclonal, are also provided. Methods of using the compositions for both diagnostic and therapeutic utilities are provided. | 06-18-2009 |
20090155243 | NON-HUMAN MODEL OF AUTOIMMUNE DISEASE - The invention is directed to a method of producing a non-human mammal having one or more pathological characteristics of retinal degeneration and/or age-related macular degeneration. In particular, the invention provides a method of producing a non-human mammal having age-related macular degeneration (AMD). The invention is also directed to non-human animals produced by the methods described herein. Methods of identifying an agent for use in inhibiting one or more pathological characteristics of retinal degeneration and/or AMD is also encompassed by the invention. Also provided is a method of treating AMD in an individual in need thereof comprising, administering to the individual an agent identified herein. | 06-18-2009 |
20090155244 | METHODS AND COMPOSITIONS FOR POXVIRUS A35R PROTEIN - The present invention provides methods and compositions for modulating an immune response in a subject, comprising administering to the subject an effective amount of an A35R protein or active fragment thereof of vaccinia virus or other poxvirus. | 06-18-2009 |
20090155245 | Treatment for Organ Regeneration with Combination of Drug and Biologics - Combination therapies of drugs and biologics for treatment of acute and chronic organ degeneration are disclosed. More specifically, the use of morphogens, stem cells, and anti-inflammatories or inhibitors for the renin-angiotensin-aldosterone system (RAAS) for the treatment of acute and chronic renal disease is disclosed. | 06-18-2009 |
20090162345 | Materials and Methods for Reversing Type-1 Diabetes - In accordance with the subject invention, anti-thymocyte globulin (ATG) can be used to modulate a patient's immune response in order to prevent and/or delay the onset or the progression of type 1 diabetes. ATG treatment augments CD4+CD25+ cell frequencies and their functional activities. | 06-25-2009 |
20090162346 | Genetic polymorphisms associated with rheumatoid arthritis, methods of detection and uses thereof - The present invention provides compositions and methods based on genetic polymorphisms that are associated with autoimmune disease, particularly rheumatoid arthritis. For example, the present invention relates to nucleic acid molecules containing the polymorphisms, variant proteins encoded by these nucleic acid molecules, reagents for detecting the polymorphic nucleic acid molecules and variant proteins, and methods of using the nucleic acid molecules and proteins as well as methods of using reagents for their detection. | 06-25-2009 |
20090162347 | METHODS, COMPOSITIONS, AND KITS RELATING TO CHITINASES AND CHITINASE-LIKE MOLECULES AND INFLAMMATORY DISEASE - The present invention includes compositions and methods for the treatment of inflammatory disease (e.g., asthma, COPD, inflammatory bowel disease, atopic dermatitis, atopy, allergy, allergic rhinitis, scleroderma, and the like), relating to inhibiting a chitinase-like molecule. The invention further includes methods to identify new compounds for the treatment of inflammatory disease, including, but not limited to, asthma, COPD and the like. This is because the present invention demonstrates, for the first time, that expression of IL-13, and of a chitinase-like molecule, mediates and/or is associated with inflammatory disease and that inhibiting the chitinase-like molecule treats and even prevents, the disease. Thus, the invention relates to the novel discovery that inhibiting a chitinase-like molecule treats and prevents an inflammatory disease. | 06-25-2009 |
20090162348 | GENETIC POLYMORPHISMS ASSOCIATED WITH PSORIASIS, METHODS OF DETECTION AND USES THEREOF - The present invention is based on the discovery of genetic polymorphisms that are associated with psoriasis and related pathologies. In particular, the present invention relates to nucleic acid molecules containing the polymorphisms, including groups of nucleic acid molecules that may be used as a signature marker set, such as a haplotype, a diplotype, variant proteins encoded by such nucleic acid molecules, reagents for detecting the polymorphic nucleic acid molecules and proteins, and methods of using the nucleic acid and proteins as well as methods of using reagents for their detection. | 06-25-2009 |
20090162349 | METHOD FOR PREVENTION OR TREATMENT OF DISEASES OR DISORDERS RELATED TO EXCESSIVE FORMATION OF VASCULAR TISSUE OR BLOOD VESSELS - This invention concerns a method for treating or preventing a disease or disorder related to excessive formation of vascular tissue or blood vessels in a patient, said method comprising administering to said patient an agent affecting the NPY Y2 receptor. | 06-25-2009 |
20090169540 | Use Of An Antagonist Of Epac For Treating Human Cardiac Hypertrophy - The present invention relates to the use of at least one Epac (Exchange Protein directly Activated by cAMP) antagonist for the manufacture of a medicament intended for the prevention or the treatment of pathologies selected from the list comprising cardiac hypertrophy, cardiac arrhythmias, valvulopathies, diastolic dysfunction, chronic heart failure, ischemic heart failure, and myocarditis. | 07-02-2009 |
20090169541 | Humanized Anti-CCR2 Antibodies and Methods of Use Therefor - The present invention relates to a humanized antibody or functional fragment thereof which binds to a mammalian (e.g., human) CC-chemokine receptor 2 (CCR2) or a portion of the receptor and blocks binding of a ligand to the receptor. The invention further relates to a method of inhibiting the interaction of a cell bearing mammalian CCR2 with a ligand thereof, and to use of the antibodies and fragments in therapeutic, prophylactic and diagnostic methods. | 07-02-2009 |
20090169542 | Modulators of neuronal regeneration - The present invention provides methods and compositions related to CNS function and diseases. | 07-02-2009 |
20090169543 | Method for regulating immune function in primates using the Foxp3 protein - Isolated nucleic acid molecules are provided which encode Fkh | 07-02-2009 |
20090169544 | FORMULATION - A stable, aqueous pharmaceutical composition comprising an antibody having a heavy chain amino acid sequence of SEQ ID No: 3 and a light chain amino acid sequence of SEQ ID No: 4 and a pharmaceutically-acceptable adjuvant, diluent, carrier or excipient, wherein said composition has a pH of 4 to 6. | 07-02-2009 |
20090169545 | 5-HT4 RECEPTOR ANTAGONISTS FOR THE TREATMENT OF HEART FAILURE - This invention provides the use of a 5-HT | 07-02-2009 |
20090175844 | METHOD OF DIAGNOSING BLADDER CANCER - Objective methods for detecting and diagnosing bladder cancer (BLC) are described herein. In one embodiment, the diagnostic method involves determining the expression level of a BLC-associated gene that discriminates between BLC cells and normal cells. The present invention further provides means for predicting and preventing bladder cancer metastasis using BLC-associated genes having unique altered expression patterns in bladder cancer cells with lymph-node metastasis. Finally, the present invention provides methods of screening for therapeutic agents useful in the treatment of bladder cancer, methods of treating bladder cancer and method for vaccinating a subject against bladder cancer. In particular, the present application provides novel human genes C2093, B5860Ns and C6055s whose expression is markedly elevated in bladder cancers. The genes and polypeptides encoded by the genes can be used, for example, in the diagnosis of bladder cancers, as target molecules for developing drugs against the disease, and for attenuating cell growth of bladder cancer. | 07-09-2009 |
20090175845 | METHODS FOR IDENTIFYING COMPOUNDS THAT MODULATE PHB DOMAIN PROTEIN ACTIVITY AND COMPOSITIONS THEREOF - The invention relates to the finding that PHB domain polypeptides can bind cholesterol and related compounds and are involved in the regulation of various cellular activities. Accordingly, the invention includes methods of identifying compounds that can bind to and/or modulate activity of a PHB domain polypeptide such as Podocin or MEC2. | 07-09-2009 |
20090175846 | Oligodendrocyte-Myelin Glycoprotein Compositions and Methods of Use Thereof - The present invention is based on the discovery that oligodendrocyte-myelin glycoprotein (OMgp), which is ex-pressed by oligodendrocytes and CNS myelin, negatively regulates oligodendrocyte and neuronal differentiation and survival. Based on these discoveries, the invention relates generally to methods of promoting neuronal and oligodendrocyte survival and differentiation by administration of an OMgp anatagonist. Additionally, the invention generally relates to methods of treating various diseases, disorders or injuries associated with demyelination, dysmyelination, oligodendrocyte/neuronal cell death, axonal injury and/or differentiation by the administration of an OMgp antagonist. | 07-09-2009 |
20090175847 | HUMANIZED ANTIBODIES TO AB (20-42) GLOBULOMER AND USES THEREOF - The present invention relates to binding proteins and, in particular, humanized antibodies that may be used, for example, in the diagnosis, treatment and prevention of Alzheimer's Disease and related conditions. | 07-09-2009 |
20090175848 | Modulation of the Cooperativity Between the Ion Channels TRPM5 and TRPA1 - The present invention is related to modulating TRPA1 ion channel activity by targeting the ion channel TRPM5. The cooperativity between the ion channels can be used to modulate pain, mechanosensation and taste responses triggered through TRPA1 by modulating the activity of TRPM5 | 07-09-2009 |
20090175849 | NOTCH inhibition in the treatment or prevention of atherosclerosis - The present invention is directed to methods of treating or preventing atherosclerosis and other cardiovascular diseases by administering agents that inhibit or modulate the NOTCH signaling pathway. In addition, the invention encompasses methods for assaying compounds for their ability to treat atherosclerosis based upon their effects on NOTCH signaling, and for measuring levels of amount, function, or activity of NOTCH pathway components in biological samples. | 07-09-2009 |
20090175850 | NOGO Receptor Homologs - The invention relates generally to genes that encode proteins that inhibit axonal growth. The invention relates specifically to genes encoding NgR protein homologs in humans and mice. The invention also includes compositions and methods for modulating the expression and activity of Nogo and the NgR proteins. Specifically, the invention includes peptides, proteins and antibodies that block Nogo-mediated inhibition of axonal extension. The compositions and methods of the invention are useful in the treatment of cranial or cerebral trauma, spinal cord injury, stroke or a demyelinating disease. | 07-09-2009 |
20090175851 | BIVALENT, BISPECIFIC ANTIBODIES - The present invention relates to novel domain exchanged, bivalent, bispecific antibodies, their manufacture and use. | 07-09-2009 |
20090175852 | IMIDAZOPYRAZINES AS PROTEIN KINASE INHIBITORS - In its many embodiments, the present invention provides a novel class of imidazopyrazine compounds as inhibitors of protein and/or checkpoint kinases, methods of preparing such compounds, pharmaceutical compositions including one or more such compounds, methods of preparing pharmaceutical formulations including one or more such compounds, and methods of treatment, prevention, inhibition, or amelioration of one or more diseases associated with the protein or checkpoint kinases using such compounds or pharmaceutical compositions. | 07-09-2009 |
20090175853 | METHOD FOR TREATING AMYLOID DISEASE - Disclosed herein are methods for treating amyloid disease in humans by clearing amyloid peptides from one or more bodily fluids such as, e.g. blood, of a patient. In particular, the methods are based on the administration of compounds capable of binding to amyloid-beta (Aβ) or on dialysis of blood or plasma exchange in order to remove Aβ peptides from the blood circulation, and/or brain or other affected organs. | 07-09-2009 |
20090181008 | METHODS OF TREATING ALZHEIMER'S DISEASE - The invention provides biomarkers that are modulated in Alzheimer's disease including IL-1α, PDGF-BB, TNF-α, M-CSF, G-CSF, GNDF, eotaxin 2, MCP-3, PARC, AgRP, MSP-α, and BTC. Described are methods for preventing, treating, alleviating symptoms of, or delaying the development of Alzheimer's Disease (AD) in an individual diagnosed with Alzheimer's Disease or at risk for developing the disease by modulating the biological activity of, or the levels of any one or more of these AD-associated biomarkers. Modulation of biomarker levels by administration of biomarker proteins, biologically active fragments thereof, agonists, antagonists and antibodies are provided. | 07-16-2009 |
20090181009 | ANTIBODIES TO NTB-A - Anti-NTB-A antibodies and antigen-binding fragments thereof, as well as pharmaceutical compositions comprising such antibodies and antigen-binding fragments are described. Also described are methods of using such antibodies and antigen-binding regions to bind NTB-A and treat diseases, such as hematologic malignancies, which are characterized by expression of NTB-A. | 07-16-2009 |
20090181010 | Arginase II: a target for the prevention of atherosclerosis - The instant invention provides methods and compositions for the treatment of. atherosclerotic disease. Specifically, the invention provides methods and compositions for modulating the activity of Arginase II, the production of Arginase II or the amount of free Arginase II for the treatment of atherosclerotic disease. | 07-16-2009 |
20090181011 | Compounds, Compositions and Methods for the Endocytic Presentation of Immunosuppressive Factors - Immunomodulating agents comprising at least one Fc receptor ligand and at least one immunosuppressive factor are provided as are methods for their manufacture and use. The immunomodulating agents may be in the form of polypeptides or chimeric antibodies and preferably incorporate an immunosuppressive factor comprising a T cell receptor antagonist. The compounds and compositions of the invention may be used to selectively suppress the immune system to treat symptoms associated with immune disorders such as allergies, transplanted tissue rejection and autoimmune disorders including lupus, rheumatoid arthritis and multiple sclerosis. | 07-16-2009 |
20090181012 | METHOD FOR DETECTING REGULATORY T CELLS USING EXPRESSION OF FOLATE RECEPTOR 4 AS INDICATOR, METHOD FOR TREATING DISEASES USING THE DETECTION METHOD, PHARMACEUTICAL COMPOSITION FOR IMMUNOSTIMULATION, AND METHOD FOR TREATING DISEASES USING THE COMPOSTION - An object of the present invention is to provide a technique to distinguish between T | 07-16-2009 |
20090186014 | METHOD FOR TREATMENT OF PANCREATITIS - A method for treating acute or chronic pancreatitis in a subject comprises administering to the subject a therapeutically effective amount of an ACE2 inhibitor. | 07-23-2009 |
20090186015 | MICRORNAS DIFFERENTIALLY EXPRESSED IN LUNG DISEASES AND USES THEREOF - The present invention concerns methods and compositions for identifying a miRNA profile for a particular condition, such as lung cancer, and using the profile in assessing the condition of a patient. | 07-23-2009 |
20090186016 | AUGMENTATION OF ENDOTHELIAL THROMBORESISTANCE - Stretch-induced increased hemodynamic load adversely affects endothelial cell function and is an important contributor to thromboembolus formation in heart failure, valvular heart disease, atrial fibrillation, venous insufficiency, and pulmonary hypertension, and in thrombus occluded vein grafts. Local thrombus formation and thromboenbolic events can be reduced by inhibiting the TGF-beta signaling pathway or TGF-beta per se. Inhibitors can be administered to patients or veins (prior to interposition) at risk for thromboembolic events or local thrombus formation. Inhibitors can be applied to harvested veins to be used as arterial grafts. | 07-23-2009 |
20090191181 | METHODS OF MODULATING SMYD3 FOR TREATMENT OF CANCER - The present invention features a method for determining the methyltransferase activity of a polypeptide and screening for modulators of methyltransferase activity, more particularly for modulators of the methylation of retinoblastoma by SMYD3. The invention further provides a method or pharmaceutical composition for prevention or treating of colorectal cancer, hepatocellular carcinoma, bladder cancer and/or breast cancer using a modulator so identified. N-terminal truncated forms of SMYD3 (alias ZNFN3A1) have higher methylating activity. Lys 824 is a preferred methylation site on the RB1 protein for SMYD3. | 07-30-2009 |
20090191182 | Compositions, Kits, and Methods for the Modulation of Immune Responses Using Galectin-1 - The present invention is based, in part, on the discovery that galectin-1 (Gal1) plays a role in immune disorders, including Hodgkin lymphoma. Accordingly, the invention relates to compositions, kits, and methods for detecting, characterizing, modulating, preventing, and treating immune disorders, e.g., Hodgkin lymphoma. | 07-30-2009 |
20090191183 | SUBSTITUTED INDOLES - Disclosed herein are substituted indole cysteinyl leukotriene receptor modulators of Formula I, process of preparation thereof, pharmaceutical compositions thereof, and methods of use thereof. | 07-30-2009 |
20090191184 | DcR3 polypeptide, A TNFR homolog - A TNFR homolog, identified as DcR3, is provided. Nucleic acid molecules encoding DcR3, chimeric molecules and antibodies to DcR3 are also provided. | 07-30-2009 |
20090191185 | Reducing Cancer Cell Invasion Using an Inhibitor of Toll Like Receptor Signaling - Provided herein are methods and compositions for reducing the invasiveness of cancer cells. Such methods and compositions are particularly useful for cancer cells that express a member of the Toll Like Receptor9 (TLR9) subfamily and are useful in selecting the proper treatment for a subject with cancer. | 07-30-2009 |
20090191186 | Antibodies to the PcrV Antigen of Pseudomonas aeruginosa - The current invention provides high-affinity antibodies to the | 07-30-2009 |
20090191187 | ANTIBODIES AGAINST INTERLEUKIN-1 RECEPTOR AND USES THEREOF - The present invention relates to antibodies against interleukin-1 receptor (IL-1R), methods for their production, pharmaceutical compositions containing said antibodies, and uses thereof. The antibodies of the present invention are particularly useful for treating a variety of inflammatory diseases including, but not limited to, rheumatoid arthritis. | 07-30-2009 |
20090191188 | IMMUNOSTIMULATORY NUCLEIC ACIDS - The invention relates to immunostimulatory nucleic acid compositions and methods of using the compositions. The T-rich nucleic acids contain poly T sequences and/or have greater than 25% T nucleotide residues. The TG nucleic acids have TG dinucleotides. The C-rich nucleic acids have at least one poly-C region and/ore greater than 50% c nucleotides. These immunostimulatory nucleic acids function in a similar manner to nucleic acids containing CpG motifs. The invention also encompasses preferred CpG nucleic acids. | 07-30-2009 |
20090191189 | REPLIKIN PEPTIDES IN RAPID REPLICATION OF GLIOMA CELLS AND IN INFLUENZA EPIDEMICS - Peptides of influenza virus hemagglutinin protein and | 07-30-2009 |
20090196868 | METHODS AND COMPOSITIONS FOR PREVENTING RADIATION-INDUCED PNEUMONITIS - Disclosed are methods of minimizing the risk for a patient of developing pneumonitis during radiotherapy for a thorax-associated neoplasm and compositions for use in such methods. A preferred composition comprises a CD95/CD95L inhibitor. Further disclosed is a method of increasing the radiation dose administered to a patient during radiotherapy for a thorax-associated neoplasm. | 08-06-2009 |
20090202518 | Treatment of sepsis and inflammation with alpha2A Adrenergic antagonists - Provided are methods for treating a mammal undergoing sepsis, or at risk for sepsis. Also provided are methods of preventing or treating a physiological effect of sepsis in a mammal. Additionally provided are methods of inhibiting an inflammatory response in a mammal. Further provided is the use of an α | 08-13-2009 |
20090202519 | Compositions and methods for treating gram positive bacterial infection in a mammalian subject - Compositions and methods are provided for treating Gram positive bacterial infection in a mammalian subject. Compositions and methods are further provided for treating Gram positive bacterial skin infection in the mammalian subject. Compositions and method are provided that comprise administering to the mammalian subject an effective amount of a compound that activates Scd1 gene expression or activates Scd1 gene product. | 08-13-2009 |
20090202520 | Treatment and diagnostic methods for fibrosis related disorders - Compositions and methods are provided for the treatment of fibrosis related disorders utilizing the ratio of the concentration of serum amyloid P(SAP) to C-reactive protein (CRP) in a patient. The methods may further comprise determining the R131/H131 polymorphism of FcγRIIA. Diagnostic methods are also provided. | 08-13-2009 |
20090202521 | Bifunctional Polyazamacrocyclic Chelating Agents - A bifunctional polyazamacrocyclic chelating agent of the formula (I): wherein: and the variables A, L, Q, Q | 08-13-2009 |
20090202522 | Use of goat serum for veterinary treatment - Methods for veterinary treatment of mammals are described, for treatment of conditions having an inflammatory component. The methods are particularly suited to treatment of cats, dogs, or horses. | 08-13-2009 |
20090202523 | ANTIBODIES AGAINST A PEPTIDE EPITOPE OF APOLIPOROTEIN B - The present invention relates to antibodies raised against fragments of apolipoprotein B, in particular defined peptides thereof, for immunization or therapeutic treatment of mammals, including humans, against ischemic cardiovascular diseases, using one or more of said antibodies. | 08-13-2009 |
20090202524 | PAI-1 EXPRESSION AND ACTIVITY INHIBITORS FOR THE TREATMENT OF OCULAR DISORDERS - The invention concerns in one embodiment a method for treating glaucoma or elevated IOP in a patient comprising administering to the patient an effective amount of a composition comprising an agent that inhibits PAI-1 expression or PAI-1 activity. Another embodiment of the present invention is a method of treating a PAI-1-associated ocular disorder in a subject in need, comprising administering to the patient an effective amount of a composition comprising an agent that inhibits PAI-1 activity or expression. | 08-13-2009 |
20090202525 | DIHYDROISOINDOLONES AS ALLOSTERIC MODULATORS OF GLUCOKINASE - The present invention relates to compounds of Formula (1), | 08-13-2009 |
20090208482 | HUMAN OBESITY SUSCEPTIBILITY GENE ENCODING A MEMBER OF THE NEUREXIN FAMILY AND USES THEREOF - The present invention more particularly discloses the identification of a human obesity susceptibility gene, which can be used for the diagnosis, prevention and treatment of obesity and associated disorders, as well as for the screening of therapeutically active drugs. The invention more specifically discloses certain alleles of the contactin associated protein-like 2 (CNTNAP2) gene related to susceptibility to obesity and representing novel targets for therapeutic intervention. The present invention relates to particular mutations in the CNTNAP2 gene and expression products, as well as to diagnostic tools and kits based on these mutations. The invention can be used in the diagnosis of predisposition to, detection, prevention and/or treatment of coronary heart disease and metabolic disorders, including but not limited to hypoalphalipoproteinemia, familial combined hyperlipidemia, insulin resistant syndrome X or multiple metabolic disorder, coronary artery disease, diabetes and associated complications and dyslipidemia. | 08-20-2009 |
20090208483 | ANTIBODY SELECTIVE FOR DR4 AND USES THEREOF - An antibody of the invention interacts with human DR5 or with human DR4 to produce agonistic or antagonistic effects downstream of the receptor including inhibition of cell proliferation and apoptosis. Nucleic acid sequences and amino acid sequences of DR5 and DR4 antibodies have been elucidated and vectors and cells containing and expressing these sequences have been generated. Methods and uses for the antibodies are detailed including treatment of apoptosis-related disease and treatment of dysregulated cell growth. | 08-20-2009 |
20090208484 | R-SPONDIN COMPOSITIONS AND METHODS OF USE THEREOF - The invention provides for a method for screening compounds that bind to and modulate a regulator of Wnt signaling, R-spondin 4. The invention further provides for methods for diagnosing a keratin-related abnormality, such as anonychia congenital, in a subject. The invention also provides for isolated RSPO4 mutant molecules. | 08-20-2009 |
20090208485 | 3-AMINOCYCLOPENTANECARBOXAMIDES AS MODULATORS OF CHEMOKINE RECEPTORS - The present invention is directed to compounds of Formula I: | 08-20-2009 |
20090214514 | GUS3 NEUROPEPTIDES FOR REGULATING HYPOTHALAMIC FUNCTION - The present invention relates to use of GUS3 neuropeptides or functional variants in a medicament. The invention furthermore relates to specific medical uses of such neuropeptides, for regulating hypothalamic function. | 08-27-2009 |
20090214515 | METHODS OF PREPARATION OF RECOMBINANT FORMS OF HUMAN BETA-AMYLOID PROTEIN AND USES OF THESE PROTEINS - The subject invention relates to the cloning, expression and isolation of recombinant forms of beta-amyloid protein containing a N-terminal methionine (or one or more amino acids) as well as to methods of using this recombinant protein in the production of therapeutic antibodies, in the identification of therapeutic small molecules, and in the performance of diagnostic assays. | 08-27-2009 |
20090214516 | Inhibitors of Reglll Proteins as Asthma Therapeutics - Methods of screening for agents for treating asthma are provided. The methods involve screening for agents that decrease the production or activity of a RegIII protein that has been discovered herein to play a role in producing the symptoms and pathological complications involved in asthma. Methods of treating asthma, as well as screening for and treating with inhibitors of a RegIII protein are also provided. | 08-27-2009 |
20090214517 | Compositions and methods of use for modulators of nectin 4, semaphorin 4b, igsf9, and kiaa0152 in treating disease - Microarray analysis, confirmed by RT-PCT, demonstrated that mRNA derived from cancerous tissues hybridized specifically and preferentially to human nectin 4, semaphorin 4b, IgSF9, and KIAA0152. Microarray analysis also demonstrated that RNA from malignant bladder, pancreas, and stomach tissue hybridized specifically to human nectin 4, semaphorin 4b, IgSF9, and KIAA0152, all of which are transmembrane proteins that provide a therapeutic target for treating cancer. Modulators of nectin 4, semaphorin 4b, IgSF9, and KIAA0152 are provided for the diagnosis and treatment of proliferative disorders such as cancer and psoriasis. The invention further provides methods of treating cancer with therapeutic agents directed toward nectin 4, semaphorin 4b, IgSF9, and KIAA0152. | 08-27-2009 |
20090214518 | Methods and compositions for treating solid tumors and enhancing tumor vaccines - The present invention provides methods of treating and enhancing efficacy of immunotherapy for a solid tumor in a subject, comprising the step of contacting the subject with a compound or composition that modulates the expression or activity of ETRB, ET-1, ICAM-1, or another protein found herein to play a role in homing of T cells to a solid tumor. The present invention also provides methods of prognosticating a solid tumor in a subject, comprising the step of measuring an expression level of a protein found herein to play a role in homing of T cells to a solid tumor, or a nucleotide molecule encoding same. | 08-27-2009 |
20090214519 | Compositions and Methods for Treating Inflammation - The present invention relates to compositions to treat inflammation (LIGHT pathway) related disorders, and specifically liver inflammation or hepatitis. The invention also relates to methods treating LIGHT pathway related disorders. The invention further relates to kits for treating LIGHT pathway related disorders in a subject. The invention further relates to methods of identifying novel treatments for treating LIGHT pathway related disorders in a subject. | 08-27-2009 |
20090214520 | Soluble CLCA-1 and antagonists to CLCA-1 - The invention relates to methods of treating a disease or condition, wherein expression or activity of soluble CLCA1 is up-regulated, by administering inhibitors of soluble CLCA1. The invention also relates to methods of isolating soluble CLCA1 from a bodily fluid. | 08-27-2009 |
20090214521 | Bone morphogenetic protein-2 in the treatment and diagnosis of cancer - The present invention pertains to the use of BMP-2, which is overexpressed in most common cancers, as 1) a target for cancer treatment therapies and 2) a means to diagnose cancer. The therapeutic component of this invention involves administering to a patient a composition that inhibits bone morphogenetic-2 activity. Such inhibition may be accomplished by ligands or antibodies that bind to BMP-2 or BMP-2 receptors. It may also be achieved by preventing the processing of pro-BMP-2, or blocking transcription or replication of BMP-2 DNA or translation of BMP-2 mRNA. The diagnostic component of the invention involves measuring the BMP-2 level in biological samples from both a patient and a subject and comparing those levels. Elevated levels of BMP-2 in the patient compared to the non-cancerous subject indicate cancer. | 08-27-2009 |
20090214522 | PROCESS FOR CONCENTRATION OF ANTIBODIES AND THERAPEUTIC PRODUCTS THEREOF - The present disclosure provides a process for concentrating proteins including an ultrafiltering, a diafiltering, and a second ultrafiltering sequence, at elevated temperatures, such as above about 30° C. The disclosure also includes a process for preparing highly concentrated antibody compositions, and highly concentrated antibody products. | 08-27-2009 |
20090220484 | Rage/Diaphanous Interaction and Related Compositions and Methods - This invention provides a polypeptide consisting essentially of all or a portion of the cytoplasmic domain of RAGE. This invention further provides a polypeptide consisting essentially of a portion of Diaphanous that binds to the cytoplasmic domain of RAGE. Additionally, this invention provides related nucleic acids, vectors, cells and methods. | 09-03-2009 |
20090220485 | Method for isolation of soluble polypeptides - Polypeptides with desirable biophysical properties such as solubility, stability, high expression, monomericity, binding specificity or non-aggregation, including monomeric human VHs and VLs, are identified using a high throughput method for screening polypeptides, comprising the steps of obtaining a phage display library, allowing infection of a bacterial lawn by the library phage, and identifying phage which form larger than average plaques on the bacterial lawn. Sequences of monomeric human VHs and VLs are identified, which may be useful for immunotherapy or as diagnostic agents. Multimer complexes of human VHs and VLs are also identified. The VHs and VLs identified may be used to create further libraries for identifying additional polypeptides. Further, the VHs and VLs may be subjected to DNA shuffling to select for improved biophysical properties. | 09-03-2009 |
20090220486 | ANTIBODIES AND USES THEREOF - The present invention provides antibodies or fragments thereof that bind to cancer cells and is important in physiological phenomena, such as cell rolling and metastasis. Therapeutic and diagnostic methods and compositions using such antibody fragments thereof are also provided. The methods and compositions according to the present invention can be used in targeting therapeutic agents and in diagnosis, prognosis, and staging of and therapy for such diseases as cancer, including tumor growth and metastasis, leukemia, auto-immune disease, and inflammatory disease. Also provided is a library of immunoglobulin binding domains having a diverse antigen-binding domain for complementary binding, wherein the library has diversity only in heavy chain CDR3. | 09-03-2009 |
20090220487 | Methods and Compositions for Inhibition of Vascular Permeability - The present invention relates to methods and compositions for regulating vascular permeability. The present invention relates to methods and compositions for blocking proteins and signal transduction pathways involved in increasing vascular permeability. | 09-03-2009 |
20090220488 | EVALUATING AND TREATING SCLERODERMA - The expression of a number of genes is altered in scleroderma. Therapeutic methods for treating scleroderma can include counteracting the effects of the altered gene expression profile. Further, scleroderma can be diagnosed and monitored by evaluating the expression of one or more of the altered genes. | 09-03-2009 |
20090220489 | ANTAGONIST ANTIBODIES DIRECTED AGAINST CALCITONIN GENE-RELATED PEPTIDE AND METHODS USING SAME - The invention features methods for preventing or treating CGRP associated disorders such as vasomotor symptoms, including headaches (e.g., migraine, cluster headache, and tension headache) and hot flushes, by administering an anti-CGRP antagonist antibody. Antagonist antibody G1 and antibodies derived from G1 directed to CGRP are also described. | 09-03-2009 |
20090220490 | Compositions and Assays for Inhibiting HCV Infection - The present invention provides isolated compounds, peptides, antibodies, vaccines that inhibit one or more functional domains of HCV E2 protein from interacting with associated proteins selected from the group consisting of AP-50, HSC70, Cyclin A, and Cyclin G. Pharmaceutical compositions and method of use thereof comprising the same for inhibiting HCV infection are also provided. The present invention further provides a primary hepatocyte cell culture comprising hepatocytes from a health individual and bodily fluid from a HCV infected individual, and method of use thereof, for screening compounds for inhibiting HCV infection. | 09-03-2009 |
20090220491 | Binding agents which inhibit myostatin - The present invention provides binding agents comprising peptides capable of binding myostatin and inhibiting its activity. In one embodiment the binding agent comprises at least one myostatin-binding peptide attached directly or indirectly to at least one vehicle such as a polymer or an Fc domain. The binding agents of the present invention produced increased lean muscle mass when administered to animals and decreased fat to muscle ratios. Therapeutic compositions containing the binding agents of the present invention are useful for treating muscle-wasting disorders and metabolic disorders including diabetes and obesity. | 09-03-2009 |
20090220492 | PROTEIN PURIFICATION - A method for purifying a polypeptide by ion exchange chromatography is described which involves changing the conductivity and/or pH of buffers in order to resolve a polypeptide of interest from one or more contaminants. | 09-03-2009 |
20090226418 | Food Products Comprising Probiotic Micro-Organisms and Antibodies - The present invention relates to food products or pharmaceutical preparations comprising antibodies or antibody fragments which are active in the gut and probiotic micro-organisms independent from the antibodies or antibody fragments. In particular, the invention relates to a method for preparing food products and pharmaceutical preparations comprising the antibodies or antibody fragments and probiotic micro-organisms and the use of these products to deliver health benefits to humans. | 09-10-2009 |
20090232793 | Elastase inhibitor and acute leukemia - The invention relates to the use of an elastase inhibitor in the manufacture of a medicament for the treatment of leukemia, preferably acute leukemia and more preferably for the treatment of AML | 09-17-2009 |
20090232794 | Modulators of neuronal regeneration - The present invention provides methods and compositions related to CNS function and diseases. | 09-17-2009 |
20090232795 | 1B20 PCSK9 ANTAGONISTS - Antagonists of human proprotein convertase subtilisin-kexin type 9 (“PCSK9”) are disclosed. The disclosed antagonists are effective in the inhibition of PCSK9 function and, accordingly, present desirable antagonists for use in the treatment of conditions associated with PCSK9 activity. The present invention also discloses nucleic acid encoding said antagonists, vectors, host cells, and compositions comprising the antagonists. Methods of making PCSK9-specific antagonists as well as methods of using the antagonists for inhibiting or antagonizing PCSK9 function are also disclosed and form important additional aspects of the present disclosure. | 09-17-2009 |
20090232796 | METHOD OF TREATING CANCER BY ADMINISTERING AN IMMUNOMODULATORY COMPOUND IN COMBINATION WITH A CD40 ANTIBODY OR CD40 LIGAND - Provided herein relates to the field of cancer and its treatment by administering immunomodulatory compounds in combination with other compounds. In particular, a combination of an immunomodulatory compound and an anti-CD40 antibody and/or a CD40 ligand is provided. | 09-17-2009 |
20090232797 | PLASMODIUM MALARIAE AND PLASMODIUM OVALE GENES AND USES THEREOF - The subject invention relates to nucleic acid sequences and amino acid sequences encoded thereby, derived from the Merozoite Surface Protein (MSP1) gene of the | 09-17-2009 |
20090232798 | METHODS AND COMPOSITIONS FOR TREATING HERPES INFECTIONS - A method of treatment or prophylaxis of herpes infections and associated disease states by administration of compositions comprising immunoglobulins. Methods comprising intravenous and topical administration of immunoglobulins are provided. | 09-17-2009 |
20090238815 | Nondegradable Hydrogels For Medical Device Application - Disclosed are nondegradable hydrogels used to coat or form at least a portion of a medical device. The hydrogels may be formed from functionalized PEG based macromers. These hydrogels are easy to sterilize, transport and store. Methods of forming these hydrogels as described herein are included. | 09-24-2009 |
20090238816 | METHOD FOR IMMUNIZING AN AVIAN SPECIES - The present invention relates to a method for generating a plurality of different IgY antibodies, by immunizing each of a plurality of avian organisms of the same or different species with a composition comprising a plurality of different antigens, thereby generating a plurality of different IgY antibodies. | 09-24-2009 |
20090238817 | ANTI-CELL PROLIFERATIVE COMPOUNDS AND METHODS OF USE - The invention provides compounds such as proteins, peptides, peptidomimetics and small molecules, methods for treating cell proliferative disorders such as neoplasia, tumor, or cancer, and metastasis thereof, and methods for identifying and screening for active compounds. | 09-24-2009 |
20090238818 | Induction of Antigen Specific Immunnologic Tolerance - Antigen specific immune tolerance is induced in a mammalian host by administration of a toleragen in combination with a regimen of immunosuppression. The methods optionally include a preceding conditioning period, where immunosuppressive agents are administered in the absence of the toleragen. After the tolerizing regimen, the host is withdrawn from the suppressive agents, but is able to maintain specific immune tolerance to the immunogenic epitopes present on the toleragen. Optimally, the toleragen will have high uptake properties that allow uptake in vivo at low concentrations in a wide variety of tolerizing cell types. | 09-24-2009 |
20090238819 | THERAPEUTIC AND DIAGNOSTIC AGENTS - The present invention relates generally to therapeutic and diagnostic agents. More particularly, the present invention provides molecules having structural features characteristic of immunoregulatory signalling (IRS) molecules and which are expressed by cells of haematopoietic lineages such as, in particular, leukocytes. The molecules of the present invention find broad application inter alia as diagnostic markers for cells, targets for cell therapy and as validated drug targets in order to modulate the immune response and to treat, prevent and diagnose a range of diseases conditions including cancer, genetic disease, inflammatory conditions and conditions associated with aberrant haematopoietic cell function or activity. The present invention extends to binding partners of the instant molecules such as, for example, antibodies, ligands, adaptor and other signalling associated molecules, agonists and antagonists and to methods of screening for same. | 09-24-2009 |
20090246189 | Methods for Promoting Neurite Outgrowth and Survival of Dopaminergic Neurons - The present invention relates generally to methods for promoting regeneration, outgrowth and survival of dopaminergic neurons comprising contacting said dopaminergic neurons with an effective amount of a composition comprising an Sp35 antagonist. Additionally, the invention is related generally to methods of treating various diseases, disorders or injuries associated with dopaminergic neuronal degeneration or death by administration of an Sp35 antagonist. | 10-01-2009 |
20090246190 | ANTI-VEGF ANTIBODY - An antibody is provided. In certain cases, the antibody comprises: a) a heavy chain variable domain that comprises CDR regions that are substantially identical to the heavy chain CDR regions of a selected antibody and b) a light chain variable domain that comprises CDR regions that are substantially identical to the light chain CDR regions of the selected antibody, where the antibody binds a selected target. | 10-01-2009 |
20090246191 | Preparation of Purified Covalently Cross-linked Abeta Oligomers and Uses Thereof - The present invention provides a method of purifying cross-linked oligomers. The purified cross-linked oligomers are useful as immunogen for generating and isolating cross-linked oligomer reactive antibodies. The cross-linked oligomer reactive antibodies are useful for detecting amyloid deposition and for diagnosing and treating diseases and conditions associated with amyloid deposition. | 10-01-2009 |
20090246192 | 1D05 PCSK9 antagonists - Antagonists of human proprotein convertase subtilisin-kexin type 9 (“PCSK9”) are disclosed. The disclosed antagonists are effective in the inhibition of PCSK9 function and, accordingly, present desirable antagonists for use in the treatment of conditions associated with PCSK9 activity. The present invention also discloses nucleic acid encoding said antagonists, vectors, host cells, and compositions comprising the antagonists. Methods of making PCSK9-specific antagonists as well as methods of using the antagonists for inhibiting or antagonizing PCSK9 function are also disclosed and form important additional aspects of the present disclosure. | 10-01-2009 |
20090246193 | INACTIVATING ORGANISMS USING CARBON DIOXIDE AT OR NEAR ITS SUPERCRITICAL PRESSURE AND TEMPERATURE CONDITIONS - Whole organisms are inactivated by at least a factor of 10 | 10-01-2009 |
20090252721 | Differentially expressed tumour-specific polypeptides for use in the diagnosis and treatment of cancer - The invention relates to agents and methods for the diagnosis, prognosis and treatment of cancer. Specifically, the invention relates to the use of nucleic and amino acid sequences encoding transmembrane superfamily member 6 (TM4SF6), synaptophysin like protein (SYPL), stomatin like 2 (STOML2), Ras related GTP binding protein RAGA), nucleotide sensitive chloride channel 1A (CLNS1A), prion protein (p27-30) (PRNP), guanine nucleotide binding protein beta 2-like 1 (GNB2L1), guanine nucleotide binding protein 4 (GNG4), integral membrane protein 2B (ITM2B), integral membrane protein 1 (ITM1), transmembrane 9 superfamily member 2 (TM9SF2), opiate receptor-like 1 protein (OPRL1), low density lipoprotein receptor-related protein 4 (LRP4), human glomerular epithelial protein 1 (GLEPP1), toll-like receptor 3 (TLR3), and/or zona pellucida glycoprotein 3A (ZP3) for the diagnosis of both early and late stage non-steroid specific cancers, cancer prognosis, as well as screening for therapeutic agents that regulate the gene expression and/or biological activity of said proteins. This invention further relates to the biological technologies designed to inhibit the gene expression and/or biological activity of said proteins including using agents identified in screening assays described herein, vector delivery of antisense polynucleotide sequences, and antibody targeting of said proteins. In specific embodiments, the proteins are of human origin. | 10-08-2009 |
20090252722 | Botulinum Neurotoxin a Protein Receptor and Uses Thereof - The invention relates to a polypeptide comprising an amino acid sequence, at least 70 percent of which are identical to the amino acid sequence of the synaptic vesicle glycoprotein of | 10-08-2009 |
20090258001 | Administration of anti-CD3 antibodies in the treatment of autoimmune diseases - A method of treating an autoimmune disease, such as, diabetes or psoriasis, by administering an anti-CD3 antibody, or anti-CD3 antibody fragment. The anti-CD3 antibody, or antibody fragment, is administered over a course of treatment wherein, during the course of treatment, the anti-CD3 antibody, or anti-CD3 antibody fragment is administered in a total amount which does not exceed 300 μg/kg when administered intravenously or, when administered other than intravenously, is administered in a total amount that does not exceed a total amount bioequivalent to 300 μg/kg of intravenous administration thereof. | 10-15-2009 |
20090258002 | Biomarkers for Tissue Status - The invention relates to methods of accurately and quickly diagnosing and monitoring the progression of cancer and ischemally injured tissue. The invention also provides methods of treatment as well as methods of screening for compositions useful for treating the disorders. | 10-15-2009 |
20090258003 | Genetic polymorphisms associated with venous thrombosis, methods of detection and uses thereof - The present invention is based on the discovery of genetic polymorphisms that are associated with coronary heart disease and in particular VT and response to drug treatment. In particular, the present invention relates to nucleic acid molecules containing the polymorphisms, variant proteins encoded by such nucleic acid molecules, reagents for detecting the polymorphic nucleic acid molecules and proteins, and methods of using the nucleic acid and proteins as well as methods of using reagents for their detection. | 10-15-2009 |
20090258004 | HUMAN BLOOD PROTEINS EXPRESSED IN MONOCOT SEEDS - The invention is directed to blood proteins produced in monocot seeds and isolated therefrom for use in therapeutic compositions, and to methods of making these isolated blood proteins and to therapeutic compositions comprising them. | 10-15-2009 |
20090258005 | Therapeutic compositions and methods - The present application provides novel binding proteins, including human binding proteins that specifically bind to the human ErbB2. | 10-15-2009 |
20090258006 | METHOD OF MODULATING NEOVASCULARIZATION - The invention provides a method of inhibiting neovascularization in a subject. The method comprises administering to the subject an agent that interferes with fibronectin (Fn) matrix assembly in an amount effective to inhibit neovascularization. The invention also provides a method of identifying an agent that inhibits neovascularization. The method comprises detecting fibronectin (Fn) matrix assembly by stimulated endothelial cells cultured in three-dimensional culture gel in the presence and absence of an agent. A decrease in Fn matrix assembly in the presence of the agent compared to Fn matrix assembly in the absence of the agent is indicative of an agent that inhibits neovascularization. Alternatively, the method of identifying an agent that inhibits neovascularization comprises detecting changes in nuclear architecture in stimulated endothelial cells cultured in three-dimensional culture gel in the presence and absence of an agent. A reduction in nuclear architecture organization identifies an agent that inhibits neovascularization. | 10-15-2009 |
20090263375 | NOVEL POLY(A) POLYMERASE - The present invention relates to novel poly(A) polymerases and their use in the treatment of diseases, disorders and conditions. More specifically, the poly(A) polymerases of the present invention include polymerases which are directly modulated by components of the phosphoinositide signaling pathway. Such components may include phosphatidylinositol phosphate kinases and phosphoinositide second messengers. | 10-22-2009 |
20090263376 | Breaking immunological toterance with a genetically encoded unnatural amino acid - The present invention comprises methods and compositions for producing and/or enhancing an immunological response in a subject against a target moiety such as a disease-related moiety by administration of an antigenic version of the target moiety having one or more unnatural amino acid and/or by administration of an antibody against a version of a target moiety having one or more unnatural amino acid which antibody is cross reactive with the natural target moiety. | 10-22-2009 |
20090263377 | IL-32B-TARGETED DIAGNOSIS AND THERAPY - Methods for the diagnosis and treatment of IL-32β over-expressing cancers are provided. Also provided are methods for the treatment of wounds, hair loss and the promoting and/or restoration of hair growth utilized IL-32β antagonists. Finally, a sepsis model utilizing IL-32β is provided, as are methods for treating sepsis and inflammation using IL-32β antagonists. | 10-22-2009 |
20090263378 | METHODS OF IDENTIFYING ANTI-INFLAMMATORY COMPOUNDS - A mammalian C-type lectin receptor type is identified which is shown to bind IgG antibodies or Fc fragments, thus inducing IVIG-related reversal of inflammation associated with various immune disorders. The identification of a DC-SIGN receptor type which interacts with IgG to promote a biological response reducing inflammation associated with immune disorders provides for methods of screening and selecting compounds which may be useful in treating various immune disorders by acting to modulate a DC-SIGN | 10-22-2009 |
20090263379 | MONOCLONAL ANTIBODIES FOR INHIBITION OF LAMININ-8 EXPRESSION TO INHIBIT HUMAN GLIOMAS - Using gene array technology, we observed that an increase of the alpha-4 chain-containing Laminin-8 correlated with poor prognosis for patients with brain gliomas. We established that inhibition of Laminin-8 expression by a new generation of highly specific and stable antisense oligonucleotides (Morpholino™) against chains of Laminin-8 could slow or stop the spread of glioma. This was demonstrated in an in vitro model using human glioblastoma multiforme cell lines M059K and U-87MG co-cultured with normal human brain microvascular endothelial cells (HBMVEC). Using Western blot analysis and immunohistochemistry, we confirmed that antisense treatment effectively blocked laminin-8 protein synthesis. Antisense oligonucleotides against both alpha-4 and β1 chains of laminin-8 blocked significantly the invasion of co-cultures through Matrigel. The results show that Laminin-8 may not only contribute to glioma progression and recurrence as part of the neovascularization process but also by directly increasing the invasive potential of tumor cells. | 10-22-2009 |
20090269329 | Combination Therapeutic products and systems - Combination therapeutics, computer program products, and systems are described that include at least one combined prescription psychiatric medication and at least one artificial sensory experience for treating a psychiatric disorder | 10-29-2009 |
20090269330 | FATTY ACID TRIGLYCERIDES FOR MAKING BIOCOMPATIBLE COATINGS - The invention relates to a mixture (a) of fatty acid triglycerides having a slip melting point above | 10-29-2009 |
20090269331 | CASPASE-8 AND INFLAMMATION, INFECTION AND WOUND HEALING - The present invention relates to the regulatory role of caspase-8 in infection by intracellular pathogen, inflammation and wound healing | 10-29-2009 |
20090269332 | Human diacylglycerol acyltransferase 2 (DGAT2) family members and uses therefor - The present invention relates to compositions and methods for the diagnosis and treatment of obesity and related metabolic disorders. The invention provides isolated nucleic acids molecules, designated DGAT2 family member nucleic acid molecules, which encode diacylglycerol acyltransferase family members. The invention also provides recombinant expression vectors containing DGAT2 family member nucleic acid molecules, host cells into which the expression vectors have been introduced, and nonhuman transgenic animals in which a DGAT2 family member gene has been introduced or disrupted. The invention still further provides isolated DGAT2 family member proteins, fusion proteins, antigenic peptides and anti-DGAT2 family member antibodies. Methods of use of the provided DGAT2 family member compositions for screening, diagnostic and therapeutic methods in connection with obesity disorders are also disclosed. | 10-29-2009 |
20090269333 | REPLIKIN PEPTIDES IN RAPID REPLICATION OF GLIOMA CELLS AND IN INFLUENZA EPIDEMICS - Peptides of influenza virus hemagglutinin protein and | 10-29-2009 |
20090269334 | BIOMARKERS FOR GRAFT REJECTION - Methods are disclosed for diagnosing rejection in a transplanted subject, monitoring rejection in a transplanted subject at risk thereof, preventing, inhibiting, reducing or treating rejection in a transplanted subject, or identifying agents for use in the prevention, inhibition, reduction or treatment of rejection, based on genes which are differentially expressed in transplanted subjects. | 10-29-2009 |
20090274684 | Methods for the Identification of Modulators of OSGPR114 or OSGPR78 Activity, and their use in the Treatment of Disease - This invention relates to the identification of LPA as a ligand for the G-protein coupled receptors OSGPR 114 and OSGPR78. The invention is directed to new methods for screening candidate drugs for their ability to modulate the activity of OSGPR114 or OSGPR78, and new pharmaceutical agents identified by these methods. It is also directed to the use of such agents in the manufacture of medicaments for the treatment of OSGPR114 or OSGPR78 mediated diseases, and methods of treating diseases such as cancers by administering to an individual a therapeutic amount of a modulator of OSGPR114 or OSGPR78 identified by these methods. | 11-05-2009 |
20090274685 | ILT3 POLYPEPTIDES AND USES THEREOF - This invention provides a method for inhibiting the rejection of transplanted islet cells, comprising administering to the subject a polypeptide comprising all or a portion of the extracellular domain of ILT3, wherein the polypeptide is water soluble. This invention further provides a method of treating diabetes, by inhibiting the rejection of transplanted islet cells through the administration of the polypeptide to the subject. | 11-05-2009 |
20090274686 | NUCLEOSIDE PHOSPHONATE DERIVATIVES - The present invention discloses compounds of formula (I) or (II), or pharmaceutically acceptable salts, esters, or prodrugs thereof: | 11-05-2009 |
20090274687 | ATTENUATION OF HYPOXIA INDUCED CARDIOVASCULAR DISORDERS - Blockade of stromal derived factor-1 (SDF-1), a stem cell mobilizer and/or its receptor, chemokine receptor 4 (CXCR4) attenuates and reverses hypoxia-induced cardiopulmonary remodeling in vivo. Compositions for treating hypoxia-induced cardiovascular disorders modulate the SDF-1/CXCR4 axis. | 11-05-2009 |
20090280108 | SERUM AMYLOID A PROTEIN IN INFLAMMATION AND OBESITY - The present invention relates to the discovery that acute-phase serum amyloid protein A (A-SAA) is a biomarker for obesity and certain abnormal conditions. The present invention, therefore, provides methods of diagnosing obesity or an abnormal condition in a subject The present invention also provides methods of monitoring the progression of obesity or an abnormal condition in a subject. The present invention also relates to treating obesity or an abnormal condition comprising reducing the levels of active SAA1 and/or SAA2 in a subject in need thereof. | 11-12-2009 |
20090280109 | ILT3 and ILT4-related compositions and methods - This invention provides compositions which comprise at least two of a CD4+CD25+ cell, IL-10, a CD8+CD28− cell and a vitamin D | 11-12-2009 |
20090280110 | Cell Model for Alzheimer's Disease Pathology - The present invention encompasses compositions and methods for studying in cell culture the pathologic changes associated with Alzheimer's disease. The present invention further relates to methods for studying and detecting early events in the conversion of healthy neurons to Alzheimer's disease neurons. | 11-12-2009 |
20090280111 | Isolation of the Mitotic Spindle Matrix and its Methods of Use - The invention encompasses a purified preparation of the mitotic spindle matrix essential for mitotic spindle assembly, which allows for identifying an agent that modulates a cell division and/or differentiation signaling pathway comprising determining the effect of the agent on spindle formation, MT nucleation, or lamin matrix assembly wherein the change in spindle formation, MT nucleation or lamin matrix assembly. | 11-12-2009 |
20090280112 | INHIBITORY EFFECTS OF NORDIHYDROGUAIARETIC ACID (NDGA) ON THE IGF-1 RECEPTOR AND ANDROGEN DEPENDENT GROWTH OF LAPC-4 PROSTATE CANCER CELLS - Disclosed herein are methods and compositions for the treatment of prostate cancer with an IGF-1 receptor kinase inhibitor. Methods are also provided for the treatment of prostate cancer by identifying a level of IGF-1 receptor expression and making a decision whether to treat with an IGF-1 receptor kinase inhibitor. | 11-12-2009 |
20090280113 | TARGET FOR REGULATING MULTIPLE SCLEROSIS - Methods are provided for decreasing demyelinating inflammatory disease in a subject by inhibiting the activity of chemokine-like receptor 1 (CMKLR1). Methods are also provided for screening for agents that find use in treating demyelinating inflammatory disease in a subject. | 11-12-2009 |
20090280114 | PREVENTION OF BRAIN INFLAMMATION AS A RESULT OF INDUCED AUTOIMMUNE RESPONSE - A disease characterized by amyloid aggregation in a patient may be prevented or treated by causing antibodies against a peptide component of the amyloid deposit to come into contact with the aggregated or soluble amyloid. In order to decrease the risk of inflammation in such a method, the Fc receptors of the patient are blocked, preferably by administration of an effective amount of IVIg, prior to the procedure of causing the antibodies to come into contact with the amyloid. | 11-12-2009 |
20090285795 | Method for the Production of a Monoclonal Antibody to CD20 for the Treatment of B-Cell Lymphoma - The present invention relates to the recombinant method used for the production of soluble form of an antibody that binds to CD20 for treatment of patients with relapsed or refractory, low-grade or follicular, CD20-positive, B-cell non-Hodgkin's lymphoma (NHL). The treatment will comprise the use of immunologically active anti-CD20 antibodies; or radiolabeled anti-CD20 antibodies and or cooperative strategies where both labeled and non-labeled antibodies will be used for treatment of NHL. The procedure describes the de novo synthesis of the nucleic acid sequence encoding anti-CD20, transformation of the constructed nucleic acid sequences into competent bacteria and the sub-cloning of the same into mammalian expression vectors for expression of the desired protein. DNA constructs comprising the control elements associated with the gene of interest has been disclosed. The nucleic acid sequence of interest has been codon optimized to permit expression in the suitable mammalian host cells. | 11-19-2009 |
20090285796 | MUTANT JAK3 KINASE IN HUMAN LEUKEMIA - In accordance with the invention, a novel activating mutation (alanine 572 to valine) in JAK3 kinase has been discovered in human acute myelogenous leukemia (AML). The mutant JAK3 kinase was confirmed to drive the proliferation and survival of acute megakaryoblastic leukemia (AML-M7). The invention therefore provides, in part, isolated polynucleotides and vectors encoding the disclosed mutant JAK3 kinase polypeptides, probes for detecting it, isolated mutant polypeptides, recombinant polypeptides, and reagents for detecting the mutant polypeptides. The disclosed identification of this new mutant protein and enables new methods for determining the presence of mutant JAK3 kinase polypeptides in a biological sample, methods for screening for compounds that inhibit the mutant proteins, and methods for inhibiting the progression of a cancer characterized by the mutant polynucleotides or polypeptides, which are also provided by the invention. | 11-19-2009 |
20090285797 | USE OF INHIBITORS OF CYP2A6 FOR REGULATING NICOTINE METABOLISM - The invention relates to methods and compositions for regulating nicotine metabolism. Also provided are methods for screening and assessing substances for regulating nicotine metabolism. Methods are provided for assessing nicotine metabolism. | 11-19-2009 |
20090285798 | CD4 MIMIC PEPTIDES AND THEIR USES - An isolated peptide comprising the sequence (I): TPA-Asn-Leu-His-Phe-Cys-Gln-Leu-Xaa | 11-19-2009 |
20090285799 | Antibody Antagonists of Interleukin-13 Receptor Alpha1 - Antibody antagonists of human interleukin-13 receptor alpha 1 are disclosed. The antibody molecules are useful in the inhibition of IL-13Rα1-mediated activities and, accordingly, present desirable antagonists for the use in the treatment of conditions associated with hIL-13Rα1 activity. The present invention also discloses nucleic acid encoding said antibody molecules, vectors, host cells, and compositions comprising the antibody molecules. Methods of using the antibody molecules for inhibiting or antagonizing IL-13Rα1-mediated activities are also disclosed. | 11-19-2009 |
20090285800 | Aberrant expression of CKS1 and CKS2 and uses thereof - The present invention is drawn to providing a therapeutic strategy for prostate cancer. In this regard, the present invention demonstrates that elevated expression of Cks1 contributes to tumorigenicity of prostate tumor cells by promoting cell growth and elevated expression of Cks2 protects cells from apoptosis. Accordingly, the present invention discloses methods to diagnose and treat prostate cancer by targeting expression of Cks1 and Cks2 proteins. | 11-19-2009 |
20090285801 | Calcium-Sensing Receptor 2 (CaR2) and Methods for Using - The current disclosure provide a novel human calcium sensing receptor named CaR2 and the nucleotide sequence that encodes the receptor. The disclosure further provides antibodies specific for CaR2. Also disclosed are methods of identifying modulators of the receptor and methods of using the identified modulators to treat calcium receptor mediated conditions. | 11-19-2009 |
20090285802 | HIGHLY CONCENTRATED STABILIZED IGM SOLUTION - The present inventors discovered that stable and highly concentrated IgM solutions can be prepared by using, as an additive, a compound comprising a polyvalent cationic ion, such as magnesium chloride or arginine hydrochloride, to suppress IgM aggregation in solutions. | 11-19-2009 |
20090291072 | MEANS AND METHODS FOR THE TREATMENT OF TUMOROUS DISEASES - Provided are pharmaceutical means and methods for the prevention, treatment or amelioration of indolent or aggressive B cell non-Hodgkin lymphoma (B NHL) and B cell leukemia comprising the administration of a bispecific single chain antibody construct to a subject in the need thereof and the use of said bispecific single chain antibody construct for the preparation of a pharmaceutical composition for the prevention, treatment or amelioration of indolent or aggressive B cell non-Hodgkin lymphoma (B NHL) and B cell leukemia, whereby said construct is to be administered for at least 1 week in specified daily doses. Moreover, the invention relates to kits comprising a bispecific single chain antibody construct to be used in accordance with this invention. | 11-26-2009 |
20090291073 | Compositions Comprising PKC-theta and Methods for Treating or Controlling Ophthalmic Disorders Using Same - Compositions for treating or controlling: (i) an eye condition, disorder, or disease, or (ii) a degeneration of a component of an optic nerve system in a subject, comprise a PKC-θ inhibitor. The compositions can further include an anti-inflammatory or anti-glaucoma medicament. Such a condition or degeneration has an inflammatory component. | 11-26-2009 |
20090291074 | MUTATIONS IN OAS1 GENES - Modified amino acid sequences of OAS1 proteins in non-human primates, and genes related thereto, are provided. | 11-26-2009 |
20090291075 | BINDING AGENTS AND THEIR USE IN TARGETING TUMOR CELLS - The present invention concerns methods and compositions for administering a binding agent to a patient wherein the patient generates a response to autologous tumor. The binding agents target apoptotic tumor cells and facilitates the uptake of these apoptotic tumor cell are taken up by dendritic cells or other antigen presenting cells for processing and presentation to the immune system without the expression of circulating tumor-associated antigen (or without the need of circulating tumor antigen). | 11-26-2009 |
20090297500 | NON-SMALL CELL LUNG CANCER-RELATED GENE, ANLN, AND ITS INTERACTION WITH RhoA - The present invention provides compositions and methods for identifying compounds for treating cancer as well as methods for predicting a prognosis of cancer. In particular, the present invention provides methods and kits for identifying inhibitors of the interaction between ANLN and RhoA which find utility in the treatment and prevention of cancer, particularly lung cancers such as non-small cell lung cancer (NSCLC). Also disclosed herein are compositions for treating or preventing cancer identified by the screening method of the present invention and methods of using same in the treatment and prevention of cancer. | 12-03-2009 |
20090297501 | Structural Isomers of sc(Fv)2 - Structural isomers in sc(Fv)2 compositions of anti-human Mpl antibody and humanized anti-human Mpl antibody were separated, and the obtained structural isomers were cleaved at their linkers to confirm that the structural isomers are of single chain diabody type and bivalent scFv type. In addition, the agonistic activities of these structural isomers were revealed to be significantly different. Furthermore, the present inventors discovered that the content ratio of the structural isomers in sc(Fv)2 compositions could be regulated by altering temperature, modifying lengths of the linkers of sc(Fv)2, or amino acids in their variable regions. | 12-03-2009 |
20090297502 | CCR2 ANTAGONISTS FOR CHRONIC ORGAN TRANSPLANTATION REJECTION - Anti-chemokine monoclonal antibody therapy is provided for the prevention, control or reversal of chronic rejection mediated vascular remodeling, including, e.g., but not limited to MCP-1/CCR2 antagonist antibody therapy for the modulation of cardiovascular pathologies associated with cardiac graft rejection including intimal thickening, arteritis, fibrosis, and necrosis. | 12-03-2009 |
20090297503 | Blood Coagulation Factor VIII Activation-Enhancing Antibodies - For the first time, the present invention provides antibodies that enhance the generation of activated blood coagulation factor VIII. The antibodies enhance the cleavage of blood coagulation factor VIII at the Arg of position 372 and suppress the cleavage at the Arg of position 336 by recognizing and binding to the A2 domain of blood coagulation Factor VIII. Such antibodies are expected to be useful in preventing or treating diseases that develop or progress due to decrease or loss of the blood coagulation factor VIII activity, for example, hemophilia A, acquired hemophilia, and von Willebrand's disease. | 12-03-2009 |
20090297504 | BCMA POLYPEPTIDES AND USES THEREOF - The present invention relates to polypeptides that inhibit APRIL and/or BAFF binding to BCMA, nucleic acid molecules encoding the polypeptides, and compositions comprising the polypeptides. The present invention also relates to methods for treating an immune-related disease or cancer using the polypeptides and compositions of the invention. The present invention also relates to methods for identifying inhibitors of APRIL/BAFF binding to BCMA and APRIL/BAFF signaling. | 12-03-2009 |
20090297505 | ABETA BINDING MOLECULES - The present invention encompasses isolated antibodies, or fragments thereof, that are humanized variants of murine antibody 266 which employ complementarily determining regions derived from murine antibody 266. The variant antibodies are useful for treatment or prevention of conditions and diseases associated with Aβ, including Alzheimer's disease. Down's syndrome, cerebral amyloid angiopathy, mild cognitive impairment, and the like. | 12-03-2009 |
20090304674 | METHODS FOR TREATING DISEASE BY REGULATING CLL CELL SURVIVAL - The present teachings include methods for regulating apoptosis in a cell comprising contacting the cell with an agent capable of neutralizing BAFF or APRIL. In yet another teaching a method for treating leukemia is provided. In yet another embodiment, a method for detecting inhibitors of CLL is provided. These and other features, aspects and advantages of the present teachings will become better understood with reference to the following description, examples and appended claims. | 12-10-2009 |
20090304675 | METHOD OF MODULATION OF MULLERIAN INHIBITORY SUBSTANCE (MIS) RECEPTOR FOR THE TREATMENT OF NEURODEGENERATIVE DISEASES - This invention relates to methods for modulating neuronal cell death or impairment, and methods for the treatment, prevention, and/or amelioration of symptoms of one or more conditions or diseases in a mammal caused by neuronal cell death or dysfunction. | 12-10-2009 |
20090304676 | COMPOSITIONS AND METHODS FOR ENHANCING COGNITIVE FUNCTION - The present application provides methods and compositions for improving cognitive function and enhancing mental performance in subjects, including those suffering from memory deficiencies, by regulating the activity of beta amyloid (Aβ) in the brain of such subjects. | 12-10-2009 |
20090304677 | Extracorporeal Removal of Microvesicular Particles - The invention described herein teaches methods of removing microvesicular particles, which include but are not limited to exosomes, from the systemic circulation of a subject in need thereof with the goal of reversing antigen-specific and antigen-nonspecific immune suppression. Said microvesicular particles could be generated by host cells that have been reprogrammed by neoplastic tissue, or the neoplastic tissue itself. Compositions of matter, medical devices, and novel utilities of existing medical devices are disclosed. | 12-10-2009 |
20090304678 | Means for Inhibiting the Expression of Protein Kinase 3 - The present invention is related to a nucleic acid molecule comprising a double-stranded structure, whereby the double-stranded structure comprises a first strand and a second strand, whereby the first strand comprises a first stretch of contiguous nucleotides and said first stretch is at least partially complementary to a target nucleic acid, and whereby the second strand comprises a second stretch of contiguous nucleotides and said second stretch is at least partially complementary to the first stretch, whereby the first stretch comprises a nucleic acid sequence which is at least partially complementary to a nucleotide core sequence of the nucleic acid sequence according to SEQ ID NO:1 (NM_013355), or part thereof, whereby the nucleotide core sequence comprises the nucleotide sequence from nucleotide positions 482 to 500 of SEQ ID NO:1 (SEQ ID NO:2); from nucleotide positions 1555 to 1573 of SEQ ID NO:1 (SEQ ID NO:4); from nucleotide positions 1556 to 1574 of SEQ ID NO:1 (SEQ ID NO:6); from nucleotide positions 1559 to 1577 of SEQ ID NO:1 (SEQ ID NO:8); from nucleotide positions 1566 to 1584 of SEQ ID NO:1 (SEQ ID NO:10); from nucleotide positions 2094 to 2112 of SEQ ID NO:1 (SEQ ID NO:12); from nucleotide positions 2102 to 2120 of SEQ ID NO:1 (SEQ ID NO:14); from nucleotide positions 2286 to 2304 of SEQ ID NO:1 (SEQ ID NO:16); from nucleotide positions 2761 to 2779 of SEQ ID NO:1 (SEQ ID NO:18); from nucleotide positions 2763 to 2781 of SEQ ID NO:1 (SEQ ID NO:20); from nucleotide positions 2764 to 2782 of SEQ ID NO:1 (SEQ ID NO:22); from nucleotide positions 2843 to 2861 of SEQ ID NO:1 (SEQ ID NO:24); from nucleotide positions 2844 to 2862 of SEQ ID NO:1 (SEQ ID NO:26); or from nucleotide positions 2846 to 2864 of SEQ ID NO:1 (SEQ ID NO:28), preferably the nucleotide core sequence comprises the nucleotide sequence from nucleotide positions 1555 to 1573 of SEQ ID NO:1 (SEQ ID NO:4); from nucleotide positions 1556 to 1574 of SEQ ID NO:1 (SEQ ID NO:6); from nucleotide positions 1559 to 1577 of SEQ ID NO:1 (SEQ ID NO:8); from nucleotide positions 1566 to 1584 of SEQ ID NO:1 (SEQ ID NO:10); from nucleotide positions 2094 to 2112 of SEQ ID NO:1 (SEQ ID NO:12); or from nucleotide positions 2286 to 2304 of SEQ ID NO:1 (SEQ ID NO:16), whereby preferably the first stretch is additionally at least partially complementary to a region preceding the 5′ end of the nucleotide core sequence and/or to a region following the 3′ end of the nucleotide core sequence. | 12-10-2009 |
20090304679 | Antibodies as T cell receptor mimics, methods of production and uses thereof - The presently disclosed and claimed invention relates to a methodology of producing and utilizing antibodies that recognize peptides associated with a tumorigenic or disease state, wherein the peptides are displayed in the context of HLA molecules. These antibodies may be utilized in therapeutic methods of mediating cell lysis. | 12-10-2009 |
20090304680 | DIAGNOSIS AND TREATMENT OF KAWASAKI DISEASE - A molecule for use in a method of treatment or diagnosis of Kawasaki Disease in an individual, the molecule comprising: (a) CACNA2D3; (b) CAMK2D; (c) KCNIP4; (d) ANGPT1; (e) NAALADL2; (f) ZFHX3; (g) MPHOSPH10; (h) a sequence having at least 90% sequence identity to any of (a) to (g); or (i) a modulator of any of (a) to (e). We also describe the use of Pregabalin ((3S)-3-(aminomethyl)-5-methyl-hexanoic acid) in the treatment or prevention of Kawasaki Disease in an individual. | 12-10-2009 |
20090311241 | Human antibodies that bind human IL-12 and methods for producing - Human antibodies, preferably recombinant human antibodies, that specifically bind to human interleukin-12 (hIL-12) are disclosed. Preferred antibodies have high affinity for hIL-12 and neutralize hIL-12 activity in vitro and in vivo. An antibody of the invention can be a full-length antibody or an antigen-binding portion thereof. The antibodies, or antibody portions, of the invention are useful for detecting hIL-12 and for inhibiting hIL-12 activity, e.g., in a human subject suffering from a disorder in which hIL-12 activity is detrimental. Nucleic acids, vectors and host cells for expressing the recombinant human antibodies of the invention, and methods of synthesizing the recombinant human antibodies, are also encompassed by the invention. | 12-17-2009 |
20090311242 | Diagnostics and therapeutics for diseases associated with 5-hydroxytryptamine 2a receptor (5ht2a) - The invention provides a human 5HT2a which is associated with the cardiovascular diseases, respiratory diseases, dermatological diseases, gastroenterological diseases, cancer, inflammation, metabolic diseases, hematological diseases, muscle skeleton diseases, neurological diseases, urological diseases. The invention also provides assays for the identification of compounds useful in the treatment or prevention of cardiovascular diseases, respiratory diseases, dermatological diseases, gastroenterological diseases, cancer, inflammation, metabolic diseases, hematological diseases, muscle skeleton diseases, neurological diseases, urological diseases. The invention also features compounds which bind to and/or activate or inhibit the activity of 5HT2a as well as pharmaceutical compositions comprising such compounds. | 12-17-2009 |
20090311243 | Methods for Identifying FZD8 Modulators and the Use of such Modulators for Treating Osteoarthritis - Methods and kits for identifying agents that modulate the function of the Methods and kits for identifying agents that modulate the function of the receptor Fzd8 are provided. Accordingly, the present invention makes available methods for identifying agents useful as modulators of Wnt-Fzd8 signalling. Therapeutic uses of the identified agents for treating osteoarthitis are also provided. | 12-17-2009 |
20090311244 | Screening Method - This invention relates to a novel screening method that identifies simple molecular markers that are predictive of whether a particular disease condition is responsive to a specific treatment. Also, a method of diagnosing the susceptibility of an individual suffering from a disease to treatment with an HDAC inhibitor is provided. Also provided is a method of treating a proliferative disease or a condition which involves a change in cell differentiation or growth rate in a patient. | 12-17-2009 |
20090311245 | METALLOPROTEINASE 9 BINDING PROTEINS - Proteins that bind to matrix metalloproteinase 9 and methods of using such proteins are described. | 12-17-2009 |
20090311246 | Method of Enhancing Remyelination in Demyelinating Diseases of the Central Nervous System - The present invention provides methods for enhancing remyelination or decreasing or inhibiting demyelination in central nervous system (CNS) of a mammalian subject by administering to the subject an effective amount of a Semliki Forest Virus (SFV) epitope E2 137-151 peptide together with a pharmaceutically acceptable carrier, or an antibody to E2 137-151 peptide (“E2 137-151 antibody”). The present invention also provides a method for treating a CNS disease, particularly, multiple sclerosis (MS), in a mammalian subject by administering to the subject a therapeutically effective amount of an E2 137-151 peptide together with a pharmaceutically acceptable carrier, or an anti E2 137-151 antibody. A polyclonal and a monoclonal E2 137-151 antibody are also provided by the present invention. | 12-17-2009 |
20090317376 | Compositions And Methods For Lipo Modeling - Methods for lipomodeling by peripherally administering a modulator of a Y receptor are provided. Methods may comprise reduction of a fat depot by administering a Y receptor antagonist proximally and/or directly to the site of the fat depot. Other methods comprise increasing or stabilizing a fat depot or fat graft by administering a Y receptor agonist proximally and/or directly to the site of the fat depot or fat graft. Also provided are methods for stimulating wound healing by administering a Y receptor agonist proximally to a wound site. | 12-24-2009 |
20090317377 | Therapy procedure for drug delivery for trigeminal pain - The present invention relates to methods for the treatment or prevention of trigeminal nerve-associated pain, in particular chronic, acute and procedural-related pain. The methods comprise administration of analgesic agents to the trigeminal nerve system which results in analgesia to the facial or head region. | 12-24-2009 |
20090317378 | Antimicrobial composition and uses thereof - A composition for prophylactic and/or therapeutic medicinal applications, or plant protection applications, in particular for the control of microorganisms, either planktonic or organized in biofilms. The composition includes at least one ion selected from hypohalite, at least one compound selected from lactoferrin, lactoferrin peptide, lysozyme, immunoglobulins or a combination thereof, optionally hypothiocyanite, and optionally at least one growth factor. | 12-24-2009 |
20090317379 | AUTOPHILIC ANTIBODIES AND METHOD OF MAKING THE SAME - Antibodies having noncovalent, autophilic properties are disclosed. The autophilic antibodies are derived from antibodies conjugated with an autophilic peptide. Such autophilic antibodies can promote apoptosis of target cells and enhance therapeutic efficacies in the treatment of patients with diseases or disorders responsive to antibody therapy. Compositions containing the antibodies, and methods of making and using the antibodies are also disclosed. | 12-24-2009 |
20090317380 | USE OF PRION CONVERSION MODULATING AGENTS - The use of Apolipoprotein B, Apoliporpotein E, fragments and mimetics thereof is provided for diagnostic, detection, prognostic and therapeutic applications in prion diseases. More specifically, the invention provides the use of Apolipoprotein B or fragments thereof for modulating or identifying modulators of the prion protein replication which are implicated in the pathogenesis of transmissible spongiform encephalopathies and other prion diseases. | 12-24-2009 |
20090324579 | Anti-apoptotic protein antibodies - Single-domain anti-bodies that bind pro-apoptotic proteins Bax and caspase-3 are identified and isolated. These single-domain antibodies may be used to modulate the active of Bax and caspase-3, thereby modulating the symptoms and steps of oxidative stress and/or cell apoptosis, including Bax dimerization, mitochondrial permeabilization and the release of apoptotic proteins. | 12-31-2009 |
20090324580 | Use of Inhibitors of Scavenger Receptor Class Proteins for the Treatment of Infectious Diseases - The present invention relates to the use of inhibitors of scavenger receptor class proteins, in particular ScarB1 for the production of a medicament for treatment of and/or prophylaxis against infections, involving liver cells and/or hematopoietic cells, in particular malaria. | 12-31-2009 |
20090324581 | HETEROARYLAMIDE LOWER CARBOXYLIC ACID DERIVATIVE - To provide a novel compound which has S1P receptor agonistic activity, exhibits excellent immunosuppressing effect, gives less adverse side effects, and can be orally administered. | 12-31-2009 |
20090324582 | PROCESS FOR IDENTIFICATION OF MOLECULAR MIMICRY AND THE USES THEREOF - The present invention discloses a process for simple and rapid detection and identification of molecular mimicry or mimic antigens or molecules existing in/on humans, animals and plants. The molecular mimicry can be related to infections, autoimmune diseases, cancers, obesity and other disorders. Therefore, novel methods for the diagnosis, prevention, and treatment of infections, autoimmune diseases, cancers, obesity and other disorders obtainable based on these mimic antigens or molecules can be developed. Furthermore, the present invention also reveals a new functional mechanism of vaccine and passive immunity and novel vaccines obtainable based on the new mechanism. | 12-31-2009 |
20090324583 | METHODS FOR INDUCING THE DIFFERENTIATION OF HEMATOPOIETIC STEM CELLS INTO MEGAKARYOCYTES AND PLATELETS, AND GENE CONTROLLING THE DIFFERENTIATION - The present invention relates to a method for inducing the differentiation of CD34+ hematopoietic stem cells into megakaryocytes and platelets, more particularly, a method for inducing the differentiation of CD34+ hematopoietic stem cells into megakaryocytes and platelets comprising the steps of coculturing CD34+ hematopoietic stem cells with stromal cells and adding the compound of Formula 1. Further, the present invention relates to a composition for detecting the differentiation of hematopoietic stem cells into megakaryocytes and platelets, comprising an agent measuring expression level of a gene that is selected from the group consisting of KLF2 (Kiruppel-like factor2), LOC138255 (OTTHUMP00000021439), GDF15 (growth differentiation factor 15) and INHBE (inhibin, betaE), a kit comprising the composition, a method for detecting the differentiation into megakaryocytes and platelets by using the marker genes, a method for regulating the differentiation into megakaryocytes and platelets, and a method for screening a candidate compound that regulates the differentiation into megakaryocytes and platelets. | 12-31-2009 |
20090324584 | Nucleic Acid of Formula (I): GIXmGn, or (II): CIXmCn, in Particular as an Immune-Stimulating Agent/Adjuvant - The present invention relates to a nucleic acid of the general formula (I): G | 12-31-2009 |
20090324585 | COMPLEMENT INHIBITORY AGENTS AS THERAPEUTICS IN POSTTRAUMATIC AND DEGENERATIVE ARTHRITIS - The present disclosure is directed to methods and compositions for treating osteoarthritis and preventing osteoarthritis, by administering a compound that modulates one or more components in the complement system. In one embodiment, a compound that inhibits a component in the complement system is administered to prevent, delay the progression of, or treat osteoarthritis. In other embodiments, compounds with specific inhibition of a component in a particular pathway in the complement system, such as the alternative, mannose binding lectin, and/or classical pathway, are administered to a subject having osteoarthritis or at risk of developing osteoarthritis. | 12-31-2009 |
20090324586 | LYOPHILIZATION CYCLE ROBUSTNESS STRATEGY - The present invention provides methods for assessing and optimizing lyophilization cycle robustness. In particular, the present invention provides rapid assessment of cycle robustness with respect to a variety of lyophilization process deviations by varying a relatively small number of parameters. | 12-31-2009 |
20100003239 | ANTI-HEDGEHOG ANTIBODIES - The invention relates to anti-hedgehog antibodies, their use in the detection of hedgehog expression in tissue, and to the use of such detection in the treatment of cancer. | 01-07-2010 |
20100003240 | CANCER TREATMENT WITH ENDOTHELIN RECEPTOR ANTAGONISTS - The present invention relates to therapeutic protocols and pharmaceutical compositions designed to treat and prevent cancer. More specifically, the present invention relates to a novel method of treating cancer using antagonists to the endothelin B receptor (ETB) or inactive mimic forms of endothelin-1. The pharmaceutical compositions of the invention are capable of selectively inhibiting the early events associated with the development of cancer. The present invention further relates to screening assays to identify compounds which inhibit ETB activation. | 01-07-2010 |
20100008900 | ANNEXIN II COMPOSITIONS FOR TREATING OR MONITORING INFLAMMATION OR IMMUNE-MEDIATED DISORDERS - Methods and compositions for treating, detecting, diagnosing or assisting in the diagnosis of an inflammatory or immunological disorder are provided. The authors have made the novel discovery that anti-dsDNA antibodies are reactive to cell surface annexin II and through this interaction, anti-dsDNA antibodies are bound and then internalized and translocated into the cytoplasm and/or nucleus where they mediate altered cellular functions. Compositions that inhibit or interfere with the interaction of annexin II with anti-dsDNA antibodies can be used to treat one or more symptoms or pathological processes of an inflammatory or immunological disorder, preferably an auto-immune disorder. Methods for monitoring the progression or severity of an inflammatory or immunological disorder are also provided. In certain embodiments, levels of annexin II and/or anti-dsDNA antibodies, including anti-dsDNA antibodies that can bind to annexin II, are assessed and compared to a reference level of annexin II and/or anti-dsDNA antibodies that corresponds to a specific stage or severity of the disorder. | 01-14-2010 |
20100008901 | METHODS FOR THE TREATMENT AND PREVENTION OF CANCER - The present inventions features methods for treating or preventing cancer (e.g., cancer of the central nervous system) by administering a compound that inhibits PAK kinase activity and/or merlin phosphorylation to a mammal (e.g., a human). The invention also provides screening methods for identifying additional inhibitors of PAK kinase activity and/or merlin phosphorylation. | 01-14-2010 |
20100008902 | P450RAI-2 (P450 CYTOCHROME 26B), ENCODING NUCLEIC ACID MOLECULES AND METHODS AND USES THEREOF - The present invention provides a novel all-trans-RA inducible all-trans-RA metabolizing cytochrome P450, P450RAI-2, that is predominantly expressed in the brain, cerebellum in particular. It is also expressed in normal and tumour lung tissue and in breast cancer cells and may have a correlation with lung and breast cancer. Human P450RAI-2 show 42% amino acid identity to human P450RAI-1 and when transfected into COS-1 cells causes the rapid conversion of all-trans-RA into more polar metabolites including the inactive products 4-oxo-RA, 4-OH-RA and 18-OH-RA. P450RAI-2, as with P450RAI-1, is also inducible in certain cultured cell lines exposed to all-trans-RA. Methods for and uses of the new polynucleotide, polypeptide, fragments thereof and inhibitors thereof, include the treatment of dermatological disorders, cancer and certain brain disorders. | 01-14-2010 |
20100008903 | TARGETING OF LONG CHAIN TRIACYLGLYCEROL HYDROLASE GENE FOR TUBERCULOSIS TREATMENT - Disclosed herein are novel methods for screening for compounds useful in treating or preventing tuberculosis. In exemplary embodiments, screening methods are based on the implementation or manipulation of triacylglycerol hydrolase like polypeptides or polynucleotides encoding the same. The methods are useful in identifying agents active against TB infection. | 01-14-2010 |
20100008904 | Treatment Of Insulin Resistance - Disclosed are a method of for treating insulin resistance and a method identifying a compound for treating insulin resistance. | 01-14-2010 |
20100015124 | Modulation of epidermal growth factor heterodimer activity - Provided is a method for screening a plurality of compounds for an ability to bind to a heterodimer of EGFR and another ERBB family member. Also provided are compounds that bind to heterodimers of EGFR and another ERBB family member; and methods of using the identified compounds to suppress the growth of a tumor associated with EGFR heterodimer activity in a subject. | 01-21-2010 |
20100015125 | METHODS AND COMPOSITIONS FOR ENHANCING IMMUNE MEMORY BY BLOCKING INTRAHEPATIC ACTIVATED T CELL DELETION - The present invention discloses a method of inhibiting CD8+ T cell deletion by the liver via the use of Toll-like receptor-4 inhibitors. Also disclosed are compositions of Toll-like receptor-4 inhibitors and either immunogenic agents or activated CD8+ T cells, which can be used to enhance secondary immune responses in normal and immunocompromised subjects. The administration of Toll-like receptor-4 inhibitors, alone or in combination with one or both of immunogenic agents or activated CD8+ T cells, to subjects to enhance secondary immune responses is also disclosed. | 01-21-2010 |
20100015126 | Methods of Binding of Cross-Beta Structures By Chaperones - The invention relates to the field of biochemistry, biophysical chemistry, molecular biology, structural biology, immunology, cellular biology and medicine. More in particular, the invention relates to the capability (or property) of chaperones to bind a crossbeta structure. Even more in particular, the invention relates to extracellular chaperones such as BiP, haptoglobin, hsp72 or clusterin. The present invention provides the insight that a chaperone molecule and more in specific an extra-cellular chaperone molecule (such as for example BiP, clusterin, hsp72 or haptoglobin) is capable of interacting with a crossbeta structure and/or a molecule comprising a crossbeta structure and/or a molecule comprising a crossbeta structure precursor. Based on this insight, the present inventors have developed multiple methods and means. | 01-21-2010 |
20100015127 | TREATMENT FOR DEMYELINATING DISEASE - The invention relates to a method of treatment or prophylaxis of demyelinating disease, in particular the neurodegenerative phase of demyelinating disease, which comprises administration of an acid sensing ion channel (ASIC) antagonist. The invention also relates to a pharmaceutical composition comprising an ASIC antagonist in combination with an additional therapeutic agent, in particular an anti-inflammatory or immunmodulatory agent. | 01-21-2010 |
20100015128 | GRP78 as a Predictor of Responsiveness to Therapeutic Agents - The present application provides methods for detecting, diagnosing, monitoring, predicting responsiveness to therapeutic agents and staging cancer. The present application provides methods and compositions useful for suppression of GRP78 expression or activity in cancer cells to overcome resistance of certain therapeutic agents. The present application also provides methods for predicting whether a subject with cancer is at risk for developing resistance to certain therapeutic agents. | 01-21-2010 |
20100015129 | Methods of using F-spondin as a biomarker for cartilage degenerative conditions and bone diseases - Methods for identifying subjects having, or at risk for developing, osteoarthritis or other cartilage degenerative conditions by measuring levels of expression of F-spondin are provided. Assays, kits and methods for determining and assaying the presence of F-spondin in individual patients are disclosed. Oligonucleotide probes and primers for use in the assays, kits and methods are described. Assays and methods are disclosed for identifying candidate compounds that modulate F-spondin levels of expression and/or function or for determining and evaluating an individual's response to drugs and therapeutic agents, are provided. The invention further relates to the modulation of F-spondin, particularly the inhibition of F-spondin, for increasing or stimulating bone formation and/or growth and mediating the alleviation of bone disease, disorders or conditions. The use of F-spondin, an active fragment thereof, or a modulator thereof for enhancing cartilage repair or preventing or treating cartilage degeneration, degenerative diseases or arthritic conditions is also provided. | 01-21-2010 |
20100015130 | DISC-1 PATHWAY ACTIVATORS IN THE CONTROL OF NEUROGENESIS - The invention relates to methods of treating neurological disorders in a subject, by activating a DISC1 pathway. Methods of promoting neurogenesis in adult neural progenitor cells, enhancing nerve generation and treating GSK3 disorders as well as related compositions are also provided. | 01-21-2010 |
20100015131 | Composition Comprising Antibodies to LINGO or Fragments Thereof - Endogenous LINGO-1 is a negative regulator for neuronal survival, axon regeneration, oligodendrocyte differentiation and myelination. Molecules that block endogenous LINGO-1 function, such anti-LINGO-1 antibodies can be used as therapeutics for the treatment of neuron and oligodendrocyte dysfunction. The present invention provides antibodies specific for LINGO-1, and methods of using such antibodies as antagonists of endogenous LINGO-1 function. The invention further provides specific hybridoma and phage library-derived monoclonal antibodies, nucleic acids encoding these antibodies, and vectors and host cells comprising these antibodies. The invention further provides methods of promoting oligodendrocyte survival and myelination in a vertebrate, comprising administering to a vertebrate in need of such treatment an effective amount of an anti-LINGO-1 antibody | 01-21-2010 |
20100015132 | USES OF MAMMALIAN CYTOKINES AND AGONISTS; RELATED REAGENTS - Provided are methods of treatment for tumors. In particular, provided are methods of using of a cytokine molecule and its receptor. | 01-21-2010 |
20100021451 | Uses and compositions for treatment of ankylosing spondylitis - The invention provides methods, uses and compositions for the treatment of ankylosing spondylitis (AS). The invention describes methods and uses for treating ankylosing spondylitis, wherein a TNFα inhibitor, such as a human TNFα antibody, or antigen-binding portion thereof, is used to reduce signs and symptoms of ankylosing spondylitis in a subject. Also described are methods for determining the efficacy of a TNFα inhibitor for treatment of ankylosing spondylitis in a subject. | 01-28-2010 |
20100021452 | COMPOSITIONS AND METHODS OF USE FOR THERAPEUTIC ANTIBODIES - The present invention relates to antibodies that specifically bind to the BAFF receptor (BAFFR). The invention more specifically relates to specific antibodies that are BAFFR antagonists with in vivo B cell depleting activity and compositions and methods of use for said antibodies to treat pathological disorders that can be treated by killing or depleting B cells, such as systemic lupus erythematosus or rheumatoid arthritis or other autoimmune diseases or lymphomas, leukemias and myelomas. | 01-28-2010 |
20100021453 | TARGETING OF TRIACYLCLYCEROL SYNTHASE GENE FOR TUBERCULOSIS TREATMENT - Disclosed herein are novel methods for screening for compounds useful in treating or preventing tuberculosis. In exemplary embodiments, screening methods are based on the implementation or manipulation of triacylglycerol synthase like polypeptides or polynucleotides encoding the same. The methods are useful in identifying agents active against TB infection. | 01-28-2010 |
20100021454 | Antibodies With Immune Effector Activity And That Internalize In Endosialin-Positive Cells - This invention relates to the use of monoclonal and polyclonal antibodies that specifically bind to and have the ability in the alternative to become internalized by cells expressing endosialin and to induce an immune effector activity such as antibody-dependent cellular cytotoxicity. The antibodies are useful in specific delivery of pharmacologic agents to endosialin-expressing cells as well as in eliciting an immune-effector activity particularly on tumor and neovascular cells and precursors. The invention is also related to nucleotides encoding the antibodies of the invention, cells expressing the antibodies; methods of detecting cancer and neovascular cells; and methods of treating cancer and neovascular disease using the antibodies, derivatives and fragments. | 01-28-2010 |
20100028326 | DIAGNOSIS OF HYPERINSULINEMIA AND TYPE II DIABETES AND PROTECTION AGAINST SAME BASED ON PROTEINS DIFFERENTIALLY EXPRESSED IN SERUM - Mouse proteins differentially expressed in serum, in comparisons of normal vs. hyperinsulinemic, hyperinsulinemic vs. type 2 diabetic, and normal vs. type 2 diabetic white adipose tissue have been identified, as have corresponding human proteins. The human molecules, or antagonists thereof, may be used for protection against hyperinsulinemia or type 2 diabetes, or their sequalae. | 02-04-2010 |
20100028327 | NOVEL LOW DENSITY LIPOPROTEIN BINDING PROTEINS AND THEIR USE IN DIAGNOSING AND TREATING ATHEROSCLEROSIS - Isolated polynucleotides encoding novel polypeptides which are capable of binding to native and methylated LDL (low density lipoprotein), the isolated polypeptides, called LBPs (LDL binding proteins), and biologically active fragments and analogs thereof, are described. Also described are methods for determining if an animal is at risk for atherosclerosis, methods for evaluating an agent for use in treating atherosclerosis, methods for treating atherosclerosis, and methods for treating a cell having an abnormality in structure or metabolism of LBP. Pharmaceutical compositions and vaccine compositions are also provided. | 02-04-2010 |
20100028328 | TOPICAL TREATMENT FOR DISEASES OF EYE SURFACE - A topical eye solution for the treatment of corneal, scleral, or conjunctival diseases. In one embodiment of the present invention, the eye solution comprises a saline-based fluid, and an effective amount of at least one therapeutic compound or agent, wherein when at least one drop of the eye solution is applied to the surface of an eye, the therapeutic compound or agent is released to the cornea and conjunctiva of the eye. | 02-04-2010 |
20100028329 | METHOD FOR PRODUCING GLYCOSYLATED INDOLE COMPOUND AND ANTIBODY AGAINST THE COMPOUND - This invention provides a method of producing a large amount of an α-form or β-form of N-pyranosyl-tryptophan having a specified structure and preparing an antibody therefrom. The method comprises a step of allowing a pyranose compound to react with a 3-pyrazyl-indole compound in the presence of a first base to obtain a 1-pyranosyl-3-pyrazyl-indole compound, and a step of treating the 1-pyranosyl-3-pyrazyl-indole compound with an acid, treating the resultant with a hydrogenation catalyst, and further treating the resultant with a second base to synthesize N-pyranosyl-tryptophan, thereby producing an antibody therefrom. | 02-04-2010 |
20100028330 | METHODS OF UPMODULATING ADAPTIVE IMMUNE RESPONSE USING ANTI-PD1 ANTIBODIES - This disclosure provides antibodies and antigen-binding fragments that can act as agonists and/or antagonists of PD-1 (Programmed Death 1), thereby modulating immune responses in general, and those mediated by TcR and CD28, in particular. The disclosed compositions and methods may be used for example, in treating autoimmune diseases, inflammatory disorders, allergies, transplant rejection, cancer, and other immune system disorders. | 02-04-2010 |
20100028331 | Antagonists of activin-actriia and uses for increasing red blood cell levels - In certain aspects, the present invention provides compositions and methods for increasing red blood cell and/or hemoglobin levels in vertebrates, including rodents and primates, and particularly in humans. | 02-04-2010 |
20100028332 | Antagonists of actriib and uses for increasing red blood cell levels - In certain aspects, the present invention provides compositions and methods for increasing red blood cell and/or hemoglobin levels in vertebrates, including rodents and primates, and particularly in humans. | 02-04-2010 |
20100028333 | RECEPTOR FOR AMYLOID BETA AND USES THEREOF - Compositions and methods for identifying modulators of sortilin are described. The methods are particularly useful for identifying analytes that antagonize sortilin s effect on processing of amyloid precursor protein to Aβ peptide and thus useful for identifying analytes that can be used for treating Alzheimer disease. | 02-04-2010 |
20100028334 | COMPOSITIONS AND METHODS TO POTENTIATE COLISTIN ACTIVITY - A pharmaceutical composition comprising an antimicrobial agent and an enhancer of an antimicrobial agent, wherein the enhancer of an antimicrobial agent is an inhibitor of gene, that by inactivating the gene product potentiates the effectiveness of the antimicrobial agent. In some embodiments, the pharmaceutical composition further comprises a pharmaceutically acceptable carrier. In some embodiments, the antimicrobial agent is an antimicrobial peptide such as a polymyxin, for example but not limited to colistin. In some embodiments of the present invention provides methods to treat and/or prevent infection of a subject with a microorganism by administering a pharmaceutical composition comprising an antimicrobial agent and an enhancer of an antimicrobial agent. In some embodiments, the present invention provides methods to inhibit growth of a microorganism by administering a pharmaceutical composition comprising an antimicrobial agent and an enhancer of an antimicrobial agent. | 02-04-2010 |
20100028335 | Compositions and Methods to Treat Bone Related Disorders - The present invention relates to the use of modulators of the sclerostin: sclerostin-binding-partner interaction for the treatment, amelioration, and diagnosis of sclerostin-related disorders, e.g., osteoporosis and sclerosteosis, and sclerostin-related disorders, e.g., cancers and cardiovascular disorders. The invention also relates to the use of sclerostin-binding-partner mimetics for the treatment amelioration, and diagnosis of sclerostin-related disorders. Assays for the identification of modulators of the sclerostin: sclerostin-binding-partner interaction, as well as the resulting signaling, are also provided. | 02-04-2010 |
20100028336 | Anti-Mesothelin Antibodies - This invention relates to the use of monoclonal and polyclonal antibodies that specifically bind to and become internalized by mesothelin-positive cells and also induce an immune effector activity such as antibody dependent cellular cytotoxicity. The antibodies are useful in specific delivery of pharmacologic agents to mesothelin expressing cells as well as eliciting an immune-effector activity particularly on tumor cells and precursors. The invention is also related to cells expressing the monoclonal antibodies, polyclonal antibodies, antibody derivatives, such as human, humanized, and chimeric monoclonal antibodies, antibody fragments, mammalian cells expressing the monoclonal antibodies, derivatives and fragments, and methods of treating cancer using the antibodies, derivatives and fragments. | 02-04-2010 |
20100028337 | METHODS AND COMPOSITIONS FOR MODULATING HYPERSTABILIZED C-MET - The invention provides methods and compositions for modulating the HGF/c-met signaling pathway, in particular by inhibiting a hyperstabilized c-met protein. | 02-04-2010 |
20100034805 | KALLIKREIN-INHIBITOR THERAPIES - Methods are described for preventing or reducing ischemia, e.g., cerebral ischemia, and/or reperfusion injury, e.g., reperfusion injury associated with cerebral ischemia, in a patient. | 02-11-2010 |
20100034806 | Methods and Compositons for the Treatment of Marfan Syndrome and Associated Disorders - The instant invention provides methods and compositions for the treatment and prevention of Marfan syndrome and related diseases, disorders and conditions. The invention further provides pharmaceutical compositions and kits for the treatment and prevention of Marfan syndrome and related diseases, disorders and conditions. | 02-11-2010 |
20100034807 | METHODS AND COMPOSITIONS FOR DISCOVERY OF TARGET-SPECIFIC ANTIBODIES USING ANTIBODY REPERTOIRE ARRAY (ARA) - The invention provides antibody arrays specific for target antigens. Methods for discovery and compositions comprising native human antibodies, arrays comprising such antibodies, immortalized B cells expressing such antibodies and non-immortalized B cell libraries comprising B cells expressing such antibodies are provided. The invention provides a method for screening monoclonal antibodies for functional effects on cell surface molecules such as receptors using antibody repertoire arrays specific for target cell surface molecules. Functional antibodies directed to a target and therapeutics derived from such antibodies are also provided. High throughput and parallel screening for potentially therapeutic antibodies are provided. Antibodies directed to functional epitope clusters corresponding to a target and vaccines and therapeutics derived from such antibodies are also provided. | 02-11-2010 |
20100034808 | COMPOSITIONS AND METHODS FOR PRESERVING CELLS OF THE EYE - The invention provides a method of preserving ocular cells in a patient having or at risk of developing glaucoma. In particular, microglial cell activation can be decreased, oligodendrocyte loss can be reduced, and/or the viability of retinal ganglion cells can be preserved by administering a selective TNFR2 antagonist to an individual having or at risk of developing glaucoma. | 02-11-2010 |
20100034809 | Compositions and Methods for Antibodies Targeting Complement Protein C5 - The present invention relates to antibodies targeting complement protein C5 and compositions and methods of use thereof. | 02-11-2010 |
20100034810 | PYRIMIDINE DERIVATIVES FOR THE PREVENTION OF HIV INFECTION - This invention concerns the use of a compound for the manufacture of a medicament for the prevention of HIV infection via sexual intercourse and related intimate contact between partners, wherein the compound is a compound of formula | 02-11-2010 |
20100040600 | Agents for Promoting the Growth of Hematopoietic Stem Cells - The present inventors discovered that the administration of an agonistic minibody (VB22B sc(Fv)2) against the TPO receptor resulted in not only the induction of human megakaryocyte-specific differentiation (increase in platelet precursor cells), but also the engraftment of transplanted hematopoietic stem cells derived from human cord blood (CD34-positive cells) and significant increase in multi-lineage hematopoietic precursor cells. TPO and TPO receptor agonists can be used as agents for promoting the growth of CD34-positive hematopoietic cells or agents for promoting the engraftment of transplanted cells in the bone marrow, which can be effective when administered alone (without using G-CSF and erythropoietin in combination) after hematopoietic stem cell transplantation (in particular, cord blood transplantation). Furthermore, TPO and TPO receptor agonists can be used as agents for promoting the growth and/or differentiation of multilineage hematopoietic precursor cells and agents for promoting the recovery of multilineage hematopoiesis. | 02-18-2010 |
20100040601 | COMPOSITIONS AND METHODS FOR TREATING HERPES SIMPLEX VIRUS INFECTIONS AND RELATED DISEASES - A method of treatment or prophylaxis of herpes infection and associated diseases by administration of compositions comprising pooled immunoglobulins. The active component of IVIG includes sialylated IgG species. Treatment and prophylaxis of herpes infection include herpes simplex virus 1 infection, its associated encephalitis and herpes stromal keratitis. | 02-18-2010 |
20100040602 | Antibodies against Human Cytimegalovirus (HCMV) - The present invention provides novel antibody sequences that bind human cytomegalovirus (hCMV) and neutralize hCMV infection. The novel sequences can be used for the medical management of hCMV infections, in particular for preparing pharmaceutical compositions to be used in the prophylactic or therapeutic treatment of hCMV infections. | 02-18-2010 |
20100040603 | METHODS FOR PROMOTING PROTECTION AND REGENERATION OF BONE MARROW USING CXCL9 AND ANTI-CXCL9 ANTIBODIES - CXCL9 promotes bone marrow regeneration, increases peripheral white blood cells, and increases survival if administered prior to treatment of a subject with chemotherapeutic drugs such as 5-FU or radiotherapy. Similar effects are obtained by administering an anti-CXCL9 antibody following chemotherapy or radiotherapy. Compositions and methods are presented for the treatment of cancer and bone marrow diseases. | 02-18-2010 |
20100040604 | HUMAN ANTIBODIES THAT BIND HUMAN TNFalpha - Human antibodies, preferably recombinant human antibodies, that specifically bind to human tumor necrosis factor α (hTNFα) are disclosed. These antibodies have high affinity for hTNFα (e.g., K | 02-18-2010 |
20100047230 | ANTI HER2/NEU ANTIBODY - The present invention describes an isolated antibody or a fragment, variant or derivative thereof, capable of specifically binding to Her2/neu comprising a heavy chain variable domain wherein said heavy chain variable domain comprises an amino acid sequence as set out in at least one of SEQ ID NOs: 1, 2 or 3 or a sequence having at least 75% identity (homology) thereto or a functional fragment thereof as well as nucleic acid sequences encoding the same and methods for their production. The invention also relates to a method for the treatment of Her2/neu expressing cancer in a patient comprising administering to the patient in need of such treatment a therapeutically effective amount of any of those antibody, polypeptide or nucleic acid molecules described herein. | 02-25-2010 |
20100047231 | Immuno-Stimulant Combination for Prophylaxis and Treatment of Hepatitis C - The present invention relates to an immuno-stimulant combination for prophylaxis and treatment of hepatitis C, characterised in that it comprises: a TLR3 agonist, a CD40 agonist and the NS3 protein of the hepatitis C virus. Moreover, the invention relates to the pharmaceutical compositions comprising said immuno-stimulant combination, to the use thereof, and to a kit composed of said pharmaceutical compositions. Finally, the present invention relates to a method for producing an immune response to the hepatitis C virus and to a vaccine against said virus. | 02-25-2010 |
20100047232 | MODULATORS OF NEURONAL REGENERATION - The present invention provides methods and compositions related to CNS function and diseases. | 02-25-2010 |
20100047233 | TREATMENT OF POST-MENOPAUSAL AND POST-HYSTERECTOMY MEDIATED COGNITIVE DISORDERS - A method of treating or preventing post-menopausal or post-hysterectomy related cognitive decline in a subject includes administering to the subject a therapeutically effective amount of at least one physiologically acceptable non-estrogenic agent that reduces or eliminates gonadotropin and/or gonadotropin receptor levels in the subject. | 02-25-2010 |
20100055088 | CXCR4 Antagonists for Wound Healing and Re-Epithelialization - The present invention provides novel uses for CXCR4 antagonists, including specifically peptides of the T-140 family, in the treatment of skin burns and other injuries. The invention further provides methods for increasing epithelialisation in a subject in need thereof, and for preventing or inhibiting fibrosis and excessive scar formation, using peptide inhibitors of the T-140 family as well as other CXCR4 antagonists. | 03-04-2010 |
20100055089 | Methods for Inhibition of Lymphangiogenesis and Tumor Metastasis - The present invention is directed to compositions and methods for inhibiting the development of new lymphatic vessels, and for inhibiting tumor cell dissemination through the lymphatics. In preferred embodiments, the present invention utilizes agents that inhibit the specific binding of integrin alpha4beta1 (α4β1, VLA-4) to one or more of its ligands. The invention further relates to methods for screening test compounds for their ability to inhibit undesirable lymphangiogenesis and/or tumor metastasis. | 03-04-2010 |
20100055090 | 2-AMINOTHIAZOLE-4-CARBOXYLIC AMIDES AS PROTEIN KINASE INHIBITORS - The present invention relates to novel Anilinopiperazine Derivatives of formula (I), compositions comprising the Anilinopiperazine Derivatives, and methods for using the Anilinopiperazine Derivatives for treating or preventing a proliferative disorder, an anti-proliferative disorder, inflammation, arthritis, a central nervous system disorder, a cardiovascular disease, alopecia, a neuronal disease, an ischemic injury, a viral disease, a fungal infection, or a disorder related to the activity of a protein kinase. | 03-04-2010 |
20100055091 | Novel GL-50 Molecules and Uses Therefor - The invention provides isolated nucleic acids molecules, designated GL50 nucleic acid molecules, which encode novel GL50 polypeptides. The invention also provides antisense nucleic acid molecules, recombinant expression vectors containing GL50 nucleic acid molecules, host cells into which the expression vectors have been introduced, and nonhuman transgenic animals in which a GL50 gene has been introduced or disrupted. The invention still further provides isolated GL50 polypeptides, fusion proteins, antigenic peptides and anti-GL50 antibodies. Diagnostic, screening, and therapeutic methods utilizing compositions of the invention are also provided. | 03-04-2010 |
20100061973 | Graded Expression of Snail as Marker of Cancer Development and DNA Damage-Based Diseases - The invention relates to the graded expression level of SNAIL gene or its expression products, as a marker of the capacity of epithelial and mesenchymal tumours and/or cancers for disseminating to other tissues or organs. The invention further relates to a transgenic non-human mammal comprising in its genome a transgene that comprises a nucleic acid sequence encoding the SNAIL protein, and the use of SNAIL as a marker of epithelial and mesenchymal tumours and/or cancers as well as in DNA damage-based diseases In addition, the invention relates to the use of SNAIL as a therapeutic and diagnostic target for said pathologies. | 03-11-2010 |
20100061974 | TRANSCOBALAMIN RECEPTOR POLYPEPTIDES, NUCLEIC ACIDS, AND MODULATORS THEREOF, AND RELATED METHODS OF USE IN MODULATING CELL GROWTH AND TREATING CANCER AND COBALAMIN DEFICIENCY - The present invention provides the amino acid and polynucleotide sequences of the transcobalamin receptor, as well as modulators of the transcobalamin receptor. Accordingly, the present invention provides compositions and methods for the treatment and prevention of diseases and disorders associated with cobalamin deficiency, including compositions and methods that promote cobalamin uptake. In addition, the present invention provides compositions and methods for the detection, treatment, and prevention of diseases associated with deregulated cell growth, including, e.g., cancer and autoimmune disorders, including compositions and methods that inhibit cobalamin uptake. | 03-11-2010 |
20100061975 | Uses for 4,17B-dihydroxyandrost-4-ene-3-one - The present invention relates to novel uses of 4,17β-dihydroxyandrost-4-ene-3-one (hereinafter 4-hydroxytestosterone), to a process for their preparation, to pharmaceutical compositions containing them, and to the use of said compounds for the prophylaxis and/or treatment of breast cancer in mammals irrespective of the estrogen-receptor status of the tumor. | 03-11-2010 |
20100061976 | Method for treating or preventing osteoporosis by reducing follicle stimulating hormone to cyclic physiological levels in a mammalian subject - A method is described for treating or preventing a bone loss disease or a bone loss disorder in a mammalian subject or reducing the incidence of a bone loss disease or a bone loss disorder or alleviating the symptoms thereof. The method includes providing to the mammalian subject at least one treatment regimen including at least one follicle-stimulating hormone modulator configured to and in an amount sufficient to reduce bioactivity or bioavailability of follicle-stimulating hormone in the mammalian subject. | 03-11-2010 |
20100061977 | METHODS AND COMPOSITIONS FOR TREATING AND DIAGNOSING DISEASES - Methods and compositions for diagnosing and treating diseases, particularly cancer, associated with differential expression of cancer-associated targets (CAT) in disease cells compared to healthy cells are provided. Also provided are antagonists and agonists of CAT, and methods for screening agents that modulate CAT level or activity in vivo or in vitro. | 03-11-2010 |
20100061978 | METHODS FOR DETECTING AND TREATING CANCER - Methods and kits for detecting cancer and monitoring cancer progression are described. The method involves analyzing a sample containing nucleic acids or proteins from a patient for decreased expression of endoglycan and/or increased expression of podocalyxin. | 03-11-2010 |
20100061979 | MODIFIED SOLUBLE FGF RECEPTOR FC FUSIONS WSITH IMPROVED BIOLOGICAL ACTIVITY - The invention relates to modified soluble FGF receptor Fc fusions comprising a fusion of a soluble fragment or domain of the FGF receptor part (targeting or binding moiety) with an Fc region of an immunoglobulin part (effector function moiety), having improved biological activity including ADCC/CDC activities, compositions containing them, and method of producing such modified soluble FGF receptor Fc fusion molecules. | 03-11-2010 |
20100061980 | ASSAYS TO PREDICT AND MONITOR ANTIBODY MEDIATED REJECTION OF TRANSPLANTED ALLOGRAFTS - The present invention is directed to assays that may be used to measure B cell reactivity to allo or donor antigens in patients, gauge the efficacy of desensitization treatment of these individuals, predict antibody mediated rejection, and monitor patients post transplant for antibody mediated rejection. | 03-11-2010 |
20100061981 | p75NTR MEDIATES EPHRIN-A REVERSE SIGNALING - The disclosure comprises methods and compositions for stimulating axon outgrowth and inhibiting metastatic diseases and disorders. | 03-11-2010 |
20100061982 | 3-SUBSTITUTED-1H-INDOLE, 3-SUBSTITUTED-1H-PYRROLO[2,3-B]PYRIDINE AND 3-SUBSTITUTED-1H-PYRROLO[3,2-B]PYRIDINE COMPOUNDS, THEIR USE AS MTOR KINASE AND PI3 KINASE INHIBITORS, AND THEIR SYNTHESES - The invention relates to 3-substituted-1H-indole, 3-substituted-1H-pyrrolo[2,3-b]pyridine, and 3-substituted-1H-pyrrolo[3,2-b]pyridine compounds of the Formula 1: | 03-11-2010 |
20100068197 | PHARMACEUTICAL COMPOUNDS AS INHIBITORS OF CELL PROLIFERATION AND THE USE THEREOF - Disclosed are compounds of Formula I effective as cytotoxic agents. The compounds of this invention are useful in the treatment of a variety of clinical conditions in which uncontrolled growth and spread of abnormal cells occurs. | 03-18-2010 |
20100068198 | TARGETING OF ALPHA-1 OR ALPHA-3 SUBUNIT OF NA+, K+-ATPASE IN THE TREATMENT OF PROLIFERATIVE DISEASES - Targeting of select subunits of the Na | 03-18-2010 |
20100068199 | PCSK9 ANTAGONISTS - The present invention provides antagonizing antibodies, antigen-binding portions thereof, and aptamers that bind to proprotein convertase subtilisin kexin type 9 (PCSK9). Also provided are antibodies directed to peptides, in which the antibodies bind to PCSK9. The invention further provides a method of obtaining such antibodies and antibody-encoding nucleic acid. The invention further relates to therapeutic methods for use of these antibodies and antigen-binding portions thereof to reduce LDL-cholesterol levels and/or for the treatment and/or prevention of cardiovascular disease, including treatment of hypercholesterolemia. | 03-18-2010 |
20100068200 | Methods and Compositions for Inhibiting Atherosclerosis and Vascular Inflammation - Disclosed herein are compositions and methods for reducing inflammation associated with atherosclerosis and/or vascular inflammatory disease. The methods include administering to a subject in need of treatment for atherosclerosis and/or vascular inflammation a pharmaceutically effective amount of an inhibitor of the receptor activity of the S1P2 receptor. Also included are compositions including an S1P2 receptor antagonist and a pharmaceutically acceptable excipient. | 03-18-2010 |
20100068201 | COMPOSITIONS AND METHODS FOR THE SYSTEMIC TREATMENT OF ARTHRITIS - The present invention includes compositions and methods for treating arthritic joints found in patients with autoinflammation, e.g., systemic onset juvenile idiopathic arthritis, by administering at the site of inflammation a therapeutically effective amount of at least one agent that reduces or blocks the bioavailability of interleukin-1β. | 03-18-2010 |
20100068202 | METHOD OF TREATING HEMOLYTIC DISEASE - Paroxysmal nocturnal hemoglobinuria or other hemolytic diseases are treated using a compound which binds to or otherwise blocks the generation and/or the activity of one or more complement components, such as, for example, a complement-inhibiting antibody. | 03-18-2010 |
20100074884 | INHIBITION OF NEURONAL DAMAGE - Materials and Methods for inhibiting neuronal damage are provided herein. In particular, materials and methods for inhibiting neuronal damage associated with pathological action of extracellular ATP are provided herein. | 03-25-2010 |
20100074885 | Combinations and methods for subcutaneous administration of immune globulin and hyaluronidase - Provided are combinations, compositions and kits containing a immune globulin (IG) composition and a soluble hyaluronidase composition formulated for subcutaneous administration. Such products can be used in methods of treating IG-treatable diseases or conditions. Also provided are methods for subcutaneous administration of immune globulin whereby the dosing regimen is substantially the same as for intravenous administration of the same dosage for treatment of the same IG-treatable disease or condition. | 03-25-2010 |
20100074886 | CCR2 ANTAGONISTS FOR TREATMENT OF FIBROSIS - Anti-MCP-1/CCR2 antagonist therapy is provided for the control or reversal of fibrosis related diseases, including, e.g., but not limited to MCP-1/CCR2 antagonist therapy for the modulation of profibrotic markers associated with fibrotic processes including collagen matrix deposition and alveolar collapse. | 03-25-2010 |
20100074887 | Methods for Treating and Diagnosing Fibrotic and Fibroproliferative Diseases - The present invention provides compositions and methods for diagnosing and treating fibrotic lung disease. | 03-25-2010 |
20100074888 | ANIMAL HAVING MODIFICATION IN MGAT2 GENE - It is an object to provide a gene-modified non-human animal having inactivated MGAT2 gene and a gene-modified non-human animal cell, which are useful for the search of the function of MGAT2 in vivo. It is another object to provide a method for screening of a compound capable of inhibiting the activity of MGAT2 and a compound capable of inhibiting the activity of MGAT2. It is further another object to provide a method for detecting a disease induced by abnormal lipid metabolism based on the expression level or activity of MGAT2. A method for screening of a compound by using a gene-modified non-human mammal having the artificially inhibited expression of MGAT2 gene and a cell thereof enable to prevent or treat a disease induced by abnormal lipid metabolism. Also a screening of a compound capable of inhibiting or enhancing the function of MGAT2 enables to prevent or treat a disease induced by abnormal lipid metabolism. | 03-25-2010 |
20100074889 | 4'-ALLENE-SUBSTITUTED NUCLEOSIDE DERIVATIVES - The present invention discloses compounds of formula (I), or its β-L enantiomer, or a pharmaceutically acceptable salt, ester, stereoisomer, tautomer, solvate, prodrug, or combination thereof: | 03-25-2010 |
20100074890 | METHODS FOR IDENTIFYING HCV PROTEASE INHIBITORS - The present invention provides methods for identifying compounds useful as HCV protease inhibitors. | 03-25-2010 |
20100074891 | Sclerostin and the inhibition of Wnt signaling and bone formation - The loss of the SOST gene product sclerostin leads to sclerosteosis characterized by high bone mass (HBM). In this report, we found that sclerostin could antagonize canonical Wnt signaling in human embryonic kidney A293 cells and mouse osteoblastic MC3T3 cells. This sclerostin-mediated antagonism could be reversed by over-expression of Wnt coreceptor LRP5. In addition, we found that sclerostin bound to LRP5 as well as LRP6 and identified the first two YWTD-EGF repeat domains of LRP5 as being responsible for the binding. Although these two repeat domains are required for transducing canonical Wnt signals, canonical Wnt did not appear to compete with sclerostin for binding to LRP5. Examination of the expression of sclerostin and Wnt7b, an autocrine canonical Wnt, during primary calvarial osteoblast differentiation revealed that sclerostin is expressed at the late stages of osteoblast differentiation coinciding with the expression of osteogenic marker osteocalcin and trailing after the expression of Wnt7b. Given the plethora of evidence indicating that canonical Wnt signaling stimulates osteogenesis, we believe that the HBM phenotype associated with the loss of sclerostin may at least in part be attributed to an increase in canonical Wnt signaling resulting from the reduction in sclerostin-mediated Wnt antagonism. | 03-25-2010 |
20100080792 | Method for Identifying a MHC Class II-Dependent Tumor-Associated T Helper Cell Antigen - The present invention is a method for identifying MHC class II-dependent disease-associated antigens. The instant method involves expressing a library of disease-derived proteins in lytic bacteriophage for subsequent presentation by antigen presenting cells to T helper cells. Disease-associated antigens are provided as are the use of such antigens in vaccines for inducing an immune response and preventing or treating disease. Moreover, the present invention provides antibodies, which specifically bind to MHC class II-dependent disease-associated antigens or epitope peptides thereof, and their diagnostic and therapeutic use. | 04-01-2010 |
20100080793 | DcR3 polypeptide, A TNFR homolog - A TNFR homolog, identified as DcR | 04-01-2010 |
20100080794 | MUTANT POLYPEPTIDE HAVING EFFECTOR FUNCTION - Mutant polypeptides of the present invention contain an Fc region in which a cysteine residue is substituted for the second amino acid from the glycosylation site to the N terminal side in the Fc region. The Fc region is preferably a human IgG Fc region. The mutant polypeptides of the present invention may also contain an N-linked sugar chain at the glycosylation site in Fc region. Furthermore, a polypeptide domain other than the Fc region of the mutant polypeptides of the present invention may be a polypeptide molecule that recognizes a human cell surface molecule. | 04-01-2010 |
20100080795 | BIODEGRADABLE THERMOGELLING POLYMER - There is provided a polymer comprising blocks of at least one polyethylene glycol) block, at least one poly(propylene glycol) block and at least one poly(hydroxybutyrate) block. Also provided is a method of making the polymer and a method of using the polymer. | 04-01-2010 |
20100080796 | Synthesis of directed sequence polymer compositions and antibodies thereof for the treatment of protein conformational disorders - The instant invention comprises a process for the solid phase synthesis of directed epitope peptide mixtures useful in the treatment and diagnosis of protein conformational disorders, such process defined by a set of rules regarding the identity and the frequency of occurrence of amino acids that substitute a base or native amino acid of a known epitope. The resulting composition is a mixture of related peptides for therapeutic use. The invention also pertains to the process of generating antibodies using the directed epitope peptide mixtures as the antigens, and antibodies generated by such process, useful in the treatment and diagnostics of the said protein conformational disorder. | 04-01-2010 |
20100080797 | THERAPY PROCEDURE FOR DRUG DELIVERY FOR TRIGEMINAL PAIN - The present invention relates to methods for the treatment or prevention of trigeminal nerve-associated pain, in particular chronic, acute and procedural-related pain. The methods comprise administration of analgesic agents to the trigeminal nerve system which results in analgesia to the facial or head region. | 04-01-2010 |
20100080798 | KIM-1 ANTAGONISTS AND USE TO MODULATE IMMUNE SYSTEM - The use of KIM-1 antagonists to inhibit signaling between a T cell and a second cell, e.g., an antigen-presenting cell, is disclosed. Such inhibition is useful for treatment of diseases including various autoimmune diseases and graft-versus-host disease. Also disclosed is the use of a KIM-1 antagonist to inhibit secretion of IFN-γ by lymphocytes or other immune cells in a mammal. Inhibition of IFN-γ is useful for treatment of inflammatory diseases or disorders, e.g., inflammatory bowel disease. | 04-01-2010 |
20100080799 | WSTF REGULATES THE DNA DAMAGE RESPONSE OF H2A.X VIA NOVEL TYROSINE KINASE ACTIVITY - The present invention relates to methods of detecting and regulating cellular DNA damage as well as methods of screening compounds suitable for modulating cellular DNA damage. The methods of the present invention utilize antibodies that selectively bind to a phosphorylated tyrosine residue in a SQEY tyrosine phosphorylation motif sequence or a phosphorylated serine residue in a KENSSQ phosphorylation motif sequence, where the phosphorylated serine residue is closest to the glutamine residue. Also encompassed by the present invention are methods of treating a subject having cancer. These methods involve the administration of an agent that modulates the phosphorylation of the tyrosine residue in a SQEY motif. Suitable agents for modulating the phosphorylation of the tyrosine residue of the SQEY motif are also disclosed. | 04-01-2010 |
20100086537 | POLYNUCLEOTIDES AND POLYPEPTIDE SEQUENCES INVOLVED IN CANCER - The present invention relates to polynucleotide and polypeptide sequences which are differentially expressed in cancer cells compared to normal cells. The present invention more particularly relates to the use of these sequences in the diagnosis, prognosis or treatment of cancer and in the detection of cancer cells. | 04-08-2010 |
20100086538 | Antibody Molecules Which Bind to Human IL-17 - The invention relates to antibody molecules having specificity for antigenic determinants of IL-17, therapeutic uses of the antibody molecules and methods for producing said antibody molecules. | 04-08-2010 |
20100086539 | Method and preparations for the diagnosis and therapy of multiple sclerosis and immune demyelinating polyneuropathy - The subject of the present invention is a method of diagnosing or treatment multiple sclerosis and immune demyelinating polyneuropathy as well as preparations used in these methods. The present invention is applicable in medicine. | 04-08-2010 |
20100086540 | CO-CRYSTAL OF ANTIBODY 11F8FAB FRAGMENT AND EGFR EXTRACELLULAR DOMAIN AND USES THEREOF - The present invention relates to co-crystals of antibody 11F8 Fab fragments and the complete extracellular domain of EGFR or isolated domain III of EGFR, and structural coordinates obtained from such crystals. Such coordinates are useful for identifying mimetics that bind to the extracellular domain of EGFR. Such mimetics may, for example, inhibit binding of ligands to EGFR, inhibit activation of EGFR, and/or reduce proliferation of tumor cells. | 04-08-2010 |
20100086541 | REGULATION OF AUTOPHAGY PATHWAY PHOSPHORYLATION AND USES THEREOF - The invention relates to polypeptides and proteins known to function in the autophagy pathway that have novel phosphorylation sites. The invention also relates to antibodies specific to these polypeptides and proteins that are phosphorylated or not phosphorylated at novel phosphorylated sites. The invention also relates to methods of producing these antibodies and use of these antibodies in the treatment of diseases related to autophagocytosis. | 04-08-2010 |
20100086542 | POTENTIATION OF ERYTHROPOIETIN (EPO) ACTION BY MEMBRANE STEROID RECEPTOR AGONISTS - The present invention relates to the use of membrane steroid receptor agonists as potentiators of the action of erythropoietin (EPO). The present invention also relates to the combined use of membrane steroid receptor agonists and erythropoietin to control apoptosis, proliferation, differentiation, migration and regeneration of cells, in different organs and tissues. Compositions comprising (i) a membrane steroid receptor agonist and (ii) erythropoietin are also provided, as are kits comprising (i) a membrane steroid receptor agonist and (ii) erythropoietin. | 04-08-2010 |
20100086543 | COMPOSITIONS AND METHODS FOR TREATING CONDITIONS ASSOCIATED WITH CERAMIDE BIOSYNTHESIS - Provided are a pharmaceutical composition and a method for reducing, preventing, or delaying the development of a biological condition associated with administration of an opioid drug, in particular, tolerance to and/or physical dependence on an opioid drug. The pharmaceutical composition includes an opioid drug, a ceramide biosynthesis inhibitor and a pharmaceutically acceptable carrier. The method of treatment involves administration of an opioid drug and a ceramide biosynthesis inhibitor. Also provided are a method of screening for an agent that reduces, prevents or delays the development of tolerance to and/or physical dependence on an opioid drug as well as compositions comprising a dsRNA for inhibiting ceramide biosynthesis in a cell and a vector for expressing a shRNA for inhibiting ceramide biosynthesis in a cell. | 04-08-2010 |
20100092455 | NOVEL ANTI-PROLIFERATION ANTIBODIES - The present invention relates to novel isolated antibodies, or the derived compounds or functional fragments of same, capable of inhibiting the proliferation of tumor cells in vitro and/or in vivo, said antibodies having been obtained by functional screening. | 04-15-2010 |
20100092456 | METHODS OF TREATMENT - Methods for modulating apoptosis and neurite outgrowth in cells by modulating levels of PtdIns(4,5)P | 04-15-2010 |
20100092457 | Diagnosis and Treatment of Cancer Using Anti-Desmoglein-3 Antibodies - Methods that involve detection of a DSG3 protein for diagnosing cancer are disclosed. In lung cancer, the expression of DSG3 was found to be enhanced at very high frequency at the gene level and protein level. Methods of the present invention can be carried out using an antibody that recognizes a DSG3 protein. Pharmaceutical compositions, cell growth inhibitors, and anticancer agents containing a DSG3-binding antibody as an active ingredient are also disclosed. Methods of inducing cell damage in DSG3-expressing cells and methods of suppressing proliferation of DSG3-expressing cells by contacting the DSG3-expressing cells with DSG3-binding antibodies are also disclosed. | 04-15-2010 |
20100092458 | REGULATION OF APG8 PHOSPHORYLATION AND USES THEREOF - The invention relates to proteins and peptides of the alpha isoform of light chain 3 (APG8) and antibodies to the APG8 protein, particularly antibodies that specifically bind to the alpha isoform of APG8 when either phosphorylated or not phosphorylated at serine-12 and antibodies that bind to the gamma isoform of APG8 when either phosphorylated or not phosphorylated at serine-9. The invention also relates to methods of producing these antibodies and use of these antibodies in the treatment of diseases related to autophagocytosis. | 04-15-2010 |
20100092459 | Protein Complex and Uses - The present invention relates to a complex comprising two or more of the proteins S6K2, PKCε and B-Raf. The invention also relates to antibodies that specifically bind to the complex, inhibitors of the complex and uses of the antibodies, inhibitors and complex in diagnosing and preventing chemoresistance in a patient. | 04-15-2010 |
20100092460 | AMINO ACID SEQUENCES DIRECTED AGAINST CHEMOKINES AND POLYPEPTIDES COMPRISING THE SAME FOR THE TREATMENT OF CHEMOKINE-RELATED DISEASES AND DISORDERS - The present invention relates to amino acid sequences that are directed against chemokines, as well as to compounds or constructs, and in particular proteins and polypeptides, that comprise or essentially consist of one or more such amino acid sequences. The invention also relates to nucleic acids encoding such amino acid sequences and polypeptides; to methods for preparing such amino acid sequences and polypeptides; to host cells expressing or capable of expressing such amino acid sequences or polypeptides; to compositions, and in particular to pharmaceutical compositions, that comprise such amino acid sequences, polypeptides, nucleic acids and/or host cells; and to uses of such amino acid sequences or polypeptides, nucleic acids, host cells and/or compositions, in particular for prophylactic, therapeutic or diagnostic purposes. | 04-15-2010 |
20100092461 | Remedy For Chemotherapy-Resistant Cancer Containing HLA Class I-Recognizing Antibody as the Active Ingredient and Use of the Same - The present invention describes therapeutic agents for chemotherapeutic agent-resistant cancers that include an HLA class I-recognizing antibody as an active ingredient. A further objective of the present invention is to provide methods for treating chemotherapeutic agent-resistant cancers that include the step of administering an HLA class I-recognizing antibody to a subject. It is herein demonstrated that cytotoxic activity due to C3B3 diabody is induced at a lower concentration in chemotherapeutic agent-resistant hematological tumor cell lines having high MDR1 and HLA class IA protein expression, than in their parent cell lines. It was also found that when the chemotherapeutic agent-resistant hematological tumor cell line is pretreated with a C3B3 diabody, cell injury associated with sole use of chemotherapeutic agent is enhanced and the amount of pharmaceutical agents taken up into cells are increased. More specifically, it was discovered that the C3B3 diabody exhibits anti-tumor activity on MDR1-expressing tumor cells having high HLA class I expression, and thereby is effective in overcoming drug resistance. | 04-15-2010 |
20100092462 | Methods for Suppressing Toll-Like Receptor Activity - Agents interfering with translocation of Toll-like receptor 3 (TLR3), methods of making and using the foregoing are disclosed. | 04-15-2010 |
20100092463 | Method for treating or preventing osteoporosis by reducing follicle stimulating hormone to cyclic physiological levels in a mammalian subject - A method is described for treating or preventing a bone loss disease or a bone loss disorder in a mammalian subject or reducing the incidence of a bone loss disease or a bone loss disorder or alleviating the symptoms thereof. The method includes providing to the mammalian subject at least one treatment regimen including at least one follicle-stimulating hormone modulator configured to and in an amount sufficient to reduce bioactivity or bioavailability of follicle-stimulating hormone in the mammalian subject. | 04-15-2010 |
20100098683 | MUC1 and Galectin-3 - The invention provides methods of identifying and making compounds that inhibit the interaction between MUC1 and galectin-3. Also embraced by the invention are in vivo and in vitro methods of inhibiting such an interaction and of inhibiting the expression of galectin-3 by a cell. | 04-22-2010 |
20100098684 | BIOMARKERS AND METHODS FOR DETECTING AND TREATING SPINAL AND JOINT PAIN - Biomarkers, including isolated fibronectin-aggrecan complexes that correlate with spinal or joint pain and inflammation, and methods for their detection are provided. Also provided are methods for identifying treatment sites in the spine or joint for treatment of pain and inflammation by detecting the presence of, or increased levels of, fibronectin-aggrecan complexes. Methods for treating spinal or joint pain and inflammation are also provided. | 04-22-2010 |
20100098685 | Use of Inhibitors of Toll-Like Receptors in the Prevention and Treatment of Hypercholesterolemia and Hyperlipidemia and Diseases Related Thereto - The invention provides the use of TLR inhibitors or a pharmaceutically acceptable derivative thereof, optionally in combination with one or more lipid lowering composition, cholesterol lowering composition, diuretics, non-steroidal anti-inflammatory compounds (NSAIDs), antibodies, antisense oligonucleotides, TLR agonists, TLR antagonists, peptides, proteins or gene therapy vectors or combinations thereof for the prevention or treatment of hypercholesterolemia and/or hyperlipidemia and/or diseases associated therewith. | 04-22-2010 |
20100098686 | Method for reducing levels of C-reactive protein - A compound comprising at least a structural entity which binds C-reactive protein (CRP) or parts of it or CRP in its monomeric, pentameric or multimeric form, preferably human CRP and which
| 04-22-2010 |
20100098687 | COMPOSITIONS AND METHODS FOR TREATING THYMIC STROMAL LYMPHOPOIETIN (TSLP)-MEDIATED CONDITIONS - Provided are methods for treating a TSLP-mediated or TSLPR-mediated disease or condition, comprising administration of an electrokinetically altered aqueous fluid comprising an ionic aqueous solution of charge-stabilized oxygen-containing nanostructures substantially having an average diameter of less than about 100 nanometers and stably configured in the ionic aqueous fluid in an amount sufficient for treating a TSLP-mediated or TSLPR-mediated disease or condition. The charge-stabilized oxygen-containing nanostructures are preferably stably configured in the fluid in an amount sufficient to provide for modulation of cellular membrane potential and/or conductivity. Certain aspects comprising modulation or down-regulation of TSLP expression and/or activity have utility for treating TSLP-mediated or TSLPR-mediated diseases or conditions as disclosed herein (e.g., disorders of the immune system, allergic inflammation, allergic airway inflammation, DC-mediated inflammatory Th2 responses, atopic dermatitis, atopic eczema, asthma, obstructive airways disease, chronic obstructive pulmonary disease, and food allergies, inflammatory arthritis, rheumatoid arthritis, psoriasis, IgE-mediated disorders, and rhino-conjunctivitis). | 04-22-2010 |
20100104553 | ANTIBODIES AND METHODS FOR MAKING AND USING THEM - The invention provides antibodies, including chimeric human antibodies, recombinant antibodies, synthetic antibodies, and the nucleic acids encoding them, and methods for making and using these immunoglobulins. The invention provides recombinant and synthetic polypeptide and nucleic acid embodiments of these polypeptides and/or antibodies. The invention also provides polypeptides comprising, or consisting of, consensus human framework regions, or “Independently Consensused Frameworks (ICFs)”, nucleic acids encoding them, and libraries and kits comprising these ICFs and/or antibodies of the invention, individually and in combinatorial libraries and combinations. | 04-29-2010 |
20100104554 | PEPTIDE AND USES THEREOF - A method of inhibiting activity of a cathepsin L-like protease in cells or tissue and the use of the method in the treatment of disease such as cancer and inflammatory diseases is described. The method comprises administration of a cathepsin propeptide or a nucleic acid encoding a cathepsin propeptide. In particular embodiments, the propeptide is a Cathepsin S propeptide. Further, the use of propeptides having an Fc portion is described. | 04-29-2010 |
20100104555 | HCV neutralizing epitopes - The invention relates to modified hepatitis C virus E2 polypeptides that are effective in eliciting the production of cross-neutralizing antibodies against hepatitis C virus. The invention provides modified hepatitis C virus E2 polypeptides, preparations and pharmaceutical compositions containing them, as well as methods for using these modified E2 polypeptides. | 04-29-2010 |
20100104556 | EPITOPE-TAG FOR SURFACE-EXPRESSED PROTEINS AND USES THEREOF - The present invention relates to a method for selecting a host cell population expressing a functional fusion protein comprising at least one epitope-providing amino acid sequence (epitope-tag) and the amino acid sequence of a protein that is expressed on the surface of said host cell. Preferably, the amino acid sequence comprises an alpha or beta chain of a T-cell receptor. The present invention further relates to uses of said functional T-cell receptor (TCR) alpha or beta chain fusion protein in medicine, in particular in adoptive transfer. | 04-29-2010 |
20100104557 | Optimized Antibodies that Target HM1.24 - The present disclosure describes antibodies that target HM1.24. In various aspects, the antibodies have specific CDR, variable, or full length sequences, have modifications with the parent antibody, or include at least one one modification relative to a parent antibody that alters affinity to an FcγR or alters effector function as compared to the parent antibody. Nucleic acids encoding the antibodies and methods of using the antibodies are also disclosed. | 04-29-2010 |
20100104558 | Use of an EGFR Antagonist for the Treatment of Glomerolonephritis - The present invention relates to uses, methods and compositions for treating immune-mediated glomerulonephritis, such as crescentic glomerulonephritis. More specifically, the invention relates to the use of an EFGR antagonist or of an inhibitor of EGFR or HB-EGF expression for the treatment of said diseases. | 04-29-2010 |
20100104559 | US CIP-COMPOSITIONS AND METHODS FOR MODULATING RESPONSES MEDIATED OR ASSOCIATED WITH BTLA ACTIVITY - Herpesvirus entry mediator (HVEM) is a member of the tumor necrosis factor receptor superfamily (TNFRSF) and acts as a molecular switch that modulates T cell activation by propagating positive signals from the TNF related ligand, LIGHT (p30, TNFSF14), or inhibitory signals through the immunoglobulin superfamily member, B and T lymphocyte attenuator (BTLA). A novel binding site for BTLA is disclosed, located in cysteine-rich domain-1 of HVEM. BTLA binding site on HVEM overlaps with the binding site for the Herpes Simplex virus-1 envelope glycoprotein D (gD), but is distinct from where LIGHT binds, yet gD inhibits the binding of both ligands. A BTLA activating protein present in human cytomegalovirus is identified as UL144. UL144 binds BTLA, but not LIGHT, and inhibits T cell proliferation. | 04-29-2010 |
20100104560 | BOTULINUM NEUROTOXIN E RECEPTORS AND USES THEREOF - An isolated polypeptide comprising an amino acid sequence selected from amino acids 506-582 of SV2A, wherein position 573 is N and is glycosylated, or amino acids 449-525 of SV2B, wherein position 516 is N and is glycosylated. The present invention also provides an antibody that binds specifically to the polypeptide, an isolated nucleic acid comprising a polynucleotide that encodes the polypeptide; a method for reducing BoNT/E toxicity in an animal; a method for identifying an agent that blocks or inhibits binding between BoNT/E and an SV2A or SV2B protein; a method for monitoring synaptic vesicle endo- or exocytosis, a method for specifically delivering a chemical entity to a cell which has a specific receptor to a BoNT toxin. Also provided are a chimeric toxin for targeting a proteolytic domain of a toxin to a cell, the chimeric toxin comprising a catalytic or proteolytic domain of the BoNT toxin, and a ligand or a fragment thereof for a non-BoNT receptor on the cell; a method for targeting a proteolytic domain of a BoNT toxin to a cell, an isolated non-neuronal cell comprising a BoNT toxin receptor; and a method for screening for an inhibitor of a BoNT toxin. | 04-29-2010 |
20100104561 | TYROSINE-MODIFIED RECOMBINANT rAAV VECTOR COMPOSITIONS AND METHODS FOR USE - Disclosed are tyrosine-modified rAAV vectors, as well as infectious virions, compositions, and pharmaceutical formulations that comprise them. Also disclosed are methods of preparing and methods for using the disclosed tyrosine-phosphorylated capsid protein mutant rAAV vectors in a variety of diagnostic and therapeutic applications including in vivo and ex vivo gene therapy, and large-scale production of rAAV vectors. | 04-29-2010 |
20100111927 | Compositions Comprising Actinidia and Methods of Use Thereof - Disclosed are novel preparations of | 05-06-2010 |
20100111928 | Methods and kits for diagnosis tumorgenicity - Methods and kits for diagnosing tumorigenicity by measuring the concentration of GP88 in blood, plasma, serum, saliva, urine and other biological fluids. The methods and kits detect GP88 in biological fluids at a concentration as low as about 0.1 to 10 nanograms per milliliter and are useful for determining whether a patient has a tumorigenic condition, whether the patient is likely to be responsive to anti-tumorigenic therapies, and whether the treated patient is responding to anti-tumorigenic therapy by measuring the concentration of GP88 in the patient's serum or other biological fluid. | 05-06-2010 |
20100111929 | METHOD OF TREATING PERIPHERAL NERVE DISORDERS - The invention relates to the use of agents that bind the complement protein C5 in the treatment of diseases associated with inappropriate complement activation, and in particular in the treatment of peripheral nerve disorders. | 05-06-2010 |
20100111930 | Methods and Compositions for Detecting Receptor Ligand Mimetics - A method to determine the utility of small molecules as functional replacements (mimetics) for protein receptor ligands is described. The method uses cellular biological assays on a systematic array of compounds, comprising known protein receptor ligands and other biologically active molecules to determine if a proposed small molecule is a functional equivalent of a receptor ligand, having therapeutic utility as a pharmaceutically relevant and useful agent either alone or in combination with other molecules. | 05-06-2010 |
20100111931 | Agents, Which Inhibit Apoptosis in Cells that are Involved in Wound Healing - The invention relates to the use of substances as a fundamental constituent in wound healing agents. The invention is characterized in that said substances bond to either IAP and/or integrin α | 05-06-2010 |
20100111932 | ANTIBODIES AGAINST RAMP3 - The present invention provides an isolated antibody capable of binding a receptor activity modifying protein (RAMP) of CRLR receptor which antibody is of IgG, IgA or IgM isotype. | 05-06-2010 |
20100111933 | ACID SOLUBLE PROTEINS FROM MICELLAR CASEIN - The present invention relates to a milk fraction obtainable by acidification of micellar casein and separation from precipitated casein named acid soluble protein from micellar casein. It was found that the milk fraction and especially certain sub-fractions thereof are bioactive and promote GLP-1 release in vitro. Based on these results, acid soluble protein from micellar casein may be useful in the treatment and the prevention of diabetes type II, obesity and may further be added to formulas directed at other purposes addressing the gastro-intestinal tract. | 05-06-2010 |
20100111934 | Determining Immunoglobulins In Non-Blood Body Fluids Of Neonatal Ungulates - Provided is a method for determining immunoglobulins in a neonatal ungulate. The method entails obtaining a sample of oral secretions from the neonatal ungulate and measuring an amount of immunoglobulins in the sample of oral secretions. The method is faster and more convenient than previously available methods for determining immunglobulins in neonatal ungulates, such as neonatal horses and cattle. | 05-06-2010 |
20100111935 | Modulation of Toll-Like Receptor 2 Expression By Antisense Oligonucleotides - Antisense oligonucleotide compounds, compositions and methods are provided for down regulating the expression of TLR2. The compositions comprise antisense oligonucleotides targeted to nucleic acids encoding TLR2. The compositions may also comprise antisense oligonucleotides targeted to nucleic acids encoding TLR2 in combination with other therapeutic and/or prophylactic compounds and/or compositions. Methods of using these compounds and compositions for down-regulating TLR2 expression and for prevention or treatment of diseases wherein modulation of TLR2 expression would be beneficial are provided. | 05-06-2010 |
20100111936 | Modulation of Toll-Like Receptor 4 Expression by Antisense Oligonucleotides - Antisense oligonucleotide compounds, compositions and methods are provided for down regulating the expression of TLR4. The compositions comprise antisense oligonucleotides targeted to nucleic acids encoding TLR4. The compositions may also comprise antisense oligonucleotides targeted to nucleic acids encoding TLR4 in combination with other therapeutic and/or prophylactic compounds and/or compositions. Methods of using these compounds and compositions for down-regulating TLR4 expression and for prevention or treatment of diseases wherein modulation of TLR4 expression would be beneficial are provided. | 05-06-2010 |
20100111937 | Modulation of Toll-Like Receptor 5 Expression by Antisense Oligonucleotides - Antisense oligonucleotide compounds, compositions and methods are provided for down regulating the expression of TLR5. The compositions comprise antisense oligonucleotides targeted to nucleic acids encoding TLR5. The compositions may also comprise antisense oligonucleotides targeted to nucleic acids encoding TLR5 in combination with other therapeutic and/or prophylactic compounds and/or compositions. Methods of using these compounds and compositions for down-regulating TLR5 expression and for prevention or treatment of diseases wherein modulation of TLR5 expression would be beneficial are provided. | 05-06-2010 |
20100119503 | 3-AMINOCYCLOPENTANECARBOXAMIDES AS MODULATORS OF CHEMOKINE RECEPTORS - The present invention is directed to compounds of Formula I: | 05-13-2010 |
20100119504 | Marker Sequences for Labour - The invention relates to markers which find use in the diagnosis of labour or pre-term labour, to assays comprising such markers, to methods of identifying therapeutic agents which can prolong pregnancy, using these markers and to methods of treatment of pre-term labour, methods of prolonging gestation, or methods of suppressing labour contractility based on the markers. | 05-13-2010 |
20100119505 | Estrogen Related Receptor, ERRalpha, A Regulator of Bone Formation - Methods and pharmaceutical compositions are provided for modulating bone formation in a mammal. Methods are also provided for screening compounds for their efficacy as modulators of bone formation. | 05-13-2010 |
20100129344 | MEDICAL USES AND THERAPIES BASED UPON THE ACTION OF AZUROCIDIN ON IGFBP-1 - The present invention concerns the use of azurocidin in the manufacture of a medicament for treating conditions associated with hepatic insulin resistance. Further provided is the use of a modulator of the interaction between azurocidin and IGFBP-1 in the manufacture of a medicament for use in the treatment of a condition which is associated with IGFBP-1 and/or IGF level and/or activity. Methods of treatment, an octopeptide modulator of amino acid sequence WDAISTYD, pharmaceutical compositions comprising the modulators of azurocidin and IGFBP-1 and uses thereof in the treatment of conditions associated with IGFBP-1 and/or IGF level and/or activity are also provided. | 05-27-2010 |
20100129345 | SCREENING METHOD FOR PROKINETIC AGENT - The present invention provides a screening tool and screening method for obtaining a substance useful as a prophylactic and/or therapeutic drug for diseases associated 5 with 5-HT production/secretion abnormalities, including digestive organ diseases, and a prophylactic and/or therapeutic drug for diseases associated with 5-HT production/secretion abnormalities, including digestive organ diseases. Examples of digestive organ diseases in the present invention include constipation type irritable bowel syndrome, functional dyspepsia, constipation, diarrhea type irritable bowel syndrome, diarrhea and vomiting. | 05-27-2010 |
20100129346 | Anti-C5aR Antibodies With Improved Properties - The present invention relates to improved antibodies which bind to C5aR and which are useful in diagnosis and therapeutic methods. | 05-27-2010 |
20100129347 | HERPES VIRUS INFECTION INHIBITOR, METHOD FOR INHIBITING INFECTION WITH HERPES VIRUS, AND USE THEREOF - Disclosed are: an inhibitor of herpesvirus infection; a method for the inhibition of herpesvirus infection; and a typical utilization method thereof. The inhibitor of herpesvirus infection comprises an active ingredient which can bind to glycoprotein B or a receptor for glycoprotein B and can inhibit the interaction between glycoprotein B and a receptor for glycoprotein B. | 05-27-2010 |
20100129348 | METHOD FOR DECREASING DEPRESSION BY INHIBITING THE ACTIVITY OF ALPHA 1B SUBUNIT OF N-TYPE CALCIUM CHANNEL - The present invention relates to the method for decreasing depression, more particularly to the method for decreasing depression by inhibiting the activity of alpha 1B subunit of N-type calcium channel. According to the present invention, inhibiting material of alpha 1B subunit of N-type calcium channel can effectively be used for the depression remedy. Also, anti-depression reagent can be screened using alpha 1B subunit of N-type calcium channel. | 05-27-2010 |
20100129349 | Methods of inhibiting staphylobactin-mediated iron uptake in S. aureus - Methods of inhibiting | 05-27-2010 |
20100129350 | Triazine Derivatives, Compositions Containing Such Derivatives, and Methods of Treatment of Cancer and Autoimmune Diseases Using Such Derivatives - We describe compounds of the following general formula (I): wherein X is fluorine or chlorine; Y is oxygen, sulfur, or an amino group; R is an amino, hydroxyl, sulfonamide, or carboxamide group or an N-monomethyl or N-dimethyl analog thereof; m is an integer from 2 to 6, and n is an integer from 0 to 2. The compounds may be used for treating certain cancers and autoimmune diseases. | 05-27-2010 |
20100129351 | Compositions and Methods for Altering Pancreas or Liver Function - Methods for altering pancreatic and liver cell function are provided, wherein the compositions and methods are based on use of netrin-4 or on altering the activity of netrin-4. | 05-27-2010 |
20100129352 | NOVEL PHARMACEUTICAL COMPOSITION - Disclosed are novel pharmaceutical compositions containing 3′-[(2Z)-[1-(3,4-dimethylphenyl)-1,5-dihydro-3-methyl-5-oxo-4H-pyrazol-4-ylidene]hydrazino]-2′-hydroxy-[1,1′-biphenyl]-3-carboxylic acid bis-(monoethanolamine) (eltrombopag olamine) and processes for preparing the same. | 05-27-2010 |
20100135985 | Genes involved in the regulation of angiogenesis, pharmaceutical preparations containing them an uses thereof - The invention pertains to the area of pharmaceutical compositions that are useful for treating pathologies resulting from a deregulation of the angiogenesis mechanism. The invention particularly concerns new genes whose function had not been identified before now as well as genes that are known but whose involvement in the angiogenesis mechanism has been shown for the first time. | 06-03-2010 |
20100135986 | COMPOSITIONS FOR ANTI-FIBRINOLYTIC TREATMENT - The present invention concerns the use of a neutralising antibody for matrix metalloproteinase-10 (MMP-10) in the preparation of a medicine useful for anti-fibrinolytic treatment, and for haemorrhages and haemorrhagic complications of various etiologies. | 06-03-2010 |
20100135987 | ISOLATION AND PURIFICATION OF ANTIBODIES USING PROTEIN A AFFINITY CHROMATOGRAPHY - Disclosed herein are methods for the isolation and purification of antibodies wherein the use of an affinity chromatographic step results in an antibody composition sufficiently pure for pharmaceutical uses. The methods described herein comprise pH viral reduction/inactivation, ultrafiltration/diafiltration, affinity chromatography, preferably Protein A affinity, ion exchange chromatography, and hydrophobic chromatography. Further, the present invention is directed toward pharmaceutical compositions comprising one or more antibodies of the present invention. | 06-03-2010 |
20100135988 | Methods for identifying agents for preventing or treating proliferative diseases, and for inhibiting extracellular matrix or alpha1 type IV collagen - A method of detecting proliferative diseases causing sclerosis, comprising measuring the expression of at least one substance selected from the group consisting of STAT3, phosphorylated STAT3, Smad1, phosphorylated Smad1, activin receptor-like kinase 1, activin receptor-like kinase 3 and bone morphogenetic proteins in a biological sample. A kit therefor. A prophylactic and/or therapeutic agent for proliferative diseases causing sclerosis, comprising as an active ingredient a substance having an inhibitory effect on the expression of at least one substance selected from the group consisting of STAT3, phosphorylated STAT3, Smad1 and phosphorylated Smad1. A method of identifying substances effective in preventing and/or treating proliferative diseases causing sclerosis, comprising judging whether or not a test substance inhibits the expression of at least one substance selected from the group consisting of STAT3, phosphorylated STAT3, Smad1 and phosphorylated Smad1. A kit therefor. | 06-03-2010 |
20100135989 | ANTI-HIV AGENTS - Anti-HIV agents are disclosed. The agents comprise as the active component one of ligand molecules that bind to CD87. Examples of such ligand molecules included the high molecular weight urokinase-type plasminogen activator, its amino-terminal fragment, their analogues and anti-CD87 antibodies. | 06-03-2010 |
20100135990 | Modulation of NR2F6 and methods and uses thereof - The disclosure provides methods of modulating NR2F6 in a cell or animal in need thereof by administering an effective amount of a NR2F6 modulator. | 06-03-2010 |
20100143328 | IMMUNOSTIMULATORY PROPERTIES OF OLIGONUCLEOTIDE-BASED COMPOUNDS COMPRISING MODIFIED IMMUNOSTIMULATORY DINUCLEOTIDES - The invention relates to the therapeutic use of oligonucleotides as immunostimulatory agents in immunotherapy applications. More particularly, the invention provides immunostimulatory oligonucleotides for use in methods for generating an immune response or for treating a patient in need of immunostimulation. The immunostimulatory oligonucleotides of the invention preferably comprise novel purines. The immunostimulatory oligonucleotides according to the invention further comprise at least two oligonucleotides linked at their 3′ ends, internucleoside linkages or functionalized nucleobase or sugar to a non-nucleotidic linker, at least one of the oligonucleotides being an immunostimulatory oligonucleotide and having an accessible 5′ end. | 06-10-2010 |
20100143329 | REIMMUNIZATION AND ANTIBODY DESIGN - The present invention relates to methods for harvesting of antibodies from an antibody library. The antibodies are harvested by utilising a certain epitope that is analogous to the epitope of the antigen used for immunization but that may differ in global physical and biochemical properties allowing the production of antibodies against antigens that normally can not be utilised as immunizing agents. The present invention furthermore relate to fields of use for harvested antigens in industry, agriculture and healthcare. | 06-10-2010 |
20100143330 | METHODS OF TREATING DISORDERS ASSOCIATED WITH FAT STORAGE - The invention relates, in general, to markers of obesity and lipodystrophy. In particular, the expression level of the SLUG gene or its expression products can be used as such a marker. Furthermore, the invention additionally relates to the use of SLUG as a therapeutic and diagnostic target for these pathologies. The invention further relates to a method of treating a disorder associated with increased or decreased fat storage in a mammal comprising modulating the activity or level of the SLUG protein or the SLUG gene in the mammal. | 06-10-2010 |
20100143331 | METHOD FOR MIXING POWDERS - The invention relates to a method for preparing powder mixtures, one component consisting of spray-dried powder. The invention also relates to a method for coating spray-dried particles with nanoscale particles, a method for mixing spray-dried powder with microscale particles and a method for covering carrier substances with spray-dried particles. | 06-10-2010 |
20100143332 | COMBINATION THERAPY FOR PROLIFERATIVE DISORDERS - The present invention provides compositions and methods of treating proliferative disorders using combination therapy with a first agent that specifically inhibits DNA polymerase alpha and a second agent that inhibits protein kinases, such as Chk1. | 06-10-2010 |
20100143333 | METHOD OF TREATING DIABETES - The present invention relates to a method for treating a subject having or at risk of a diabetes-related disorder. In a preferred embodiment, the method involves increasing the level or activity of Hypoxia Induced Factor 1 (HIF-1 α) in pancreatic-β-cells or insulin-sensitive tissues in the subject by administering to the subject an inhibitor of a protein that decreases the level or activity of HIF-1α. The present invention also relates to a method of transplanting pancreatic islet cells in a subject. | 06-10-2010 |
20100143334 | T-140 PEPTIDE ANALOGS HAVING CXCR4 SUPER-AGONIST ACTIVITY FOR IMMUNOMODULATION - The present invention is directed to novel therapeutic uses of T-140 analog peptides and compositions comprising same. Specifically, the invention provides compositions and methods useful for immunomodulation. | 06-10-2010 |
20100143335 | TREATING ATHEROSCLEROSIS - The present application features methods and compositions for treating patients suffering from atherosclerosis or at risk for developing atherosclerosis. The treatment includes administering to the patient a pharmaceutical composition that includes an agent capable of blocking the interaction between uPA and its receptor uPAR, e.g., an ATF or a fragment thereof, an anti-uPA antibody, a uPAR or a fragment thereof, or an antibody that specifically binds to uPAR. | 06-10-2010 |
20100143336 | TOLL-LIKE RECEPTOR BINDING EPITOPE AND COMPOSITIONS FOR BINDING THERETO - The present invention relates to the identification of an epitope defined by residues of Toll-like Receptor (2). Targeting a binding compound, such as an antibody to the epitope results in antagonism of Toll-like Receptor (2). Further provided by the invention is the use of polypeptide comprising amino acid residues which form the epitope for use in screening for binding compounds which bind thereto, as well as to polypeptide compound which comprise the amino acid sequences of the epitope for use as vaccine compositions, when the generation of antagonistic antibodies which have binding specificity to Toll-like Receptor (2) are required, for example in the treatment of Toll-like Receptor (2) mediated disease conditions. | 06-10-2010 |
20100143337 | COMPOSITIONS AND METHODS FOR CHARACTERIZING AND REGULATING OLFACTORY SENSATION - The present invention relates to the characterization of odorant receptors. In particular, the present invention relates to the OR7D4 proteins and nucleic acids encoding OR7D4 proteins and cell systems for screening for modulators of OR7D4 receptors. The present invention further provides assays for the detection of OR7D4 polymorphisms and mutations associated with altered olfactory sensation states, as well as methods of screening for therapeutic agents, ligands, and modulators of OR7D4 receptors. | 06-10-2010 |
20100143338 | TREATMENT OF T-CELL MEDIATED DISEASES - The invention provides a method of treating T-cell mediated diseases and a method of inhibiting the activation of T-cells using certain diketopiperazines. The invention also provides methods of synthesizing diketopiperazines and pharmaceutical compositions comprising certain diketopiperazines. The invention further provides methods of making improved pharmaceutical compositions of proteins and peptides by either increasing or decreasing the content of diketopiperazines in the compositions and the resultant improved pharmaceutical compositions. | 06-10-2010 |
20100143339 | METHODS OF TREATING AND PREVENTING COLITIS INVOLVING IL-13 AND NK-T CELLS - Method of treating or preventing the inflammatory response of colitis in a subject comprising administering to the subject an effective amount of a substance that modulates IL-13 activity (FIG. | 06-10-2010 |
20100150901 | 26199, 33530, 33949, 47148, 50226, 58764, 62113, 32144, 32235, 23565, 13305, 14911, 86216, 25206, and 8843 molecules and uses therefor - The invention provides isolated nucleic acids molecules, designated 26199, 33530, 33949, 47148, 50226, 58764, 62113, 32144, 32235, 23565, 13305, 14911, 86216, 25206 and 8843 nucleic acid molecules. The invention also provides antisense nucleic acid molecules, recombinant expression vectors containing 26199, 33530, 33949, 47148, 50226, 58764, 62113, 32144, 32235, 23565, 13305, 14911, 86216, 25206 and 8843 nucleic acid molecules, host cells into which the expression vectors have been introduced, and nonhuman transgenic animals in which a 26199, 33530, 33949, 47148, 50226, 58764, 62113, 32144, 32235, 23565, 13305, 14911, 86216, 25206 or 8843 gene has been introduced or disrupted. The invention still further provides isolated 26199, 33530, 33949, 47148, 50226, 58764, 62113, 32144, 32235, 23565, 13305, 14911, 86216, 25206 or 8843 proteins, fusion proteins, antigenic peptides and anti-26199, 33530, 33949, 47148, 50226, 58764, 62113, 32144, 32235, 23565, 13305, 14911, 86216, 25206 or 8843 antibodies. Diagnostic and therapeutic methods utilizing compositions of the invention are also provided. | 06-17-2010 |
20100150902 | ANTI-CD151 ANTIBODIES AND THEIR USE IN THE TREATMENT OF CANCER - The present invention relates to new antibodies capable of binding specifically to the human CD151 protein, especially monoclonal antibodies of murine origin, which are chimeric and humanised, and also to the amino acid and nucleic sequences coding for those antibodies. The invention also includes use of those antibodies as medicaments for the prophylactic and/or therapeutic treatment of cancers and in diagnostic methods or kits for diseases associated with overexpression of the CD151 protein. Finally, the invention includes products and/or compositions comprising such antibodies in association with antibodies and/or anti-cancer agents or conjugated with toxins and/or radioelements and their use in the prevention and/or treatment of certain cancers. | 06-17-2010 |
20100150903 | Method for Treating Oncological Diseases - A method to treat solid tumors and other oncological diseases consists of parenterally injecting an agent which destroy's blood's extracellular DNA into the systemic blood circulation of a cancer patient to slow down malignant. The agent is embodied in the form of a DNAse enzyme and, more particularly, as a bovine pancreatic DNAse. Doses from 50,000-250,000,000 Kunz units/day are injected for 5-360 days. A binding agent or an agent that modifies the chemical composition of the blood extracellular DNA is additionally injected into the blood. This modifying agent is preferably an enzyme-ribonuclease. | 06-17-2010 |
20100158892 | PEST CONTROL - The present invention relates to novel rodent control agents comprising antibodies, or antigen-binding fragments thereof, that bind to proteins expressed in rodents and in particular antibodies or antigen-binding fragments that bind to proteins expressed in the gastrointestinal (GI) tract of rodents, as well as to methods of making such novel rodent control agents. The invention further extends to novel antibodies and antigen-binding fragments for use in rodent control as well as to methods of controlling rodents through the use of such antibodies, antigen binding fragments and novel rodent control agents. | 06-24-2010 |
20100158893 | SYSTEMS AND METHODS FOR OBTAINING IMMUNOGLOBULIN FROM BLOOD - The present disclosure relates generally to systems for obtaining a pharmaceutically acceptable immunoglobulin from blood of a donor comprising a first conduit configured to convey blood from the donor to a substrate, wherein said blood includes at least one first component and at least one second component, said first component of the blood including immunoglobulin, and wherein said substrate is adapted to bind immunoglobulin; and a second conduit configured to convey at least a portion of the second component of the blood from the first conduit to the donor. | 06-24-2010 |
20100158894 | PREVENTIVE OR REMEDY FOR ER-NEGATIVE AND HER2-NEGATIVE BREAST CANCER AND METHOD OF SCREENING THE SAME - The present invention provides (1) an agent for the prevention or treatment of an estrogen receptor-negative and HER2-negative breast cancer comprising an Akt inhibitor, (2) an agent for the prevention or treatment of an estrogen receptor-negative, progesterone receptor-negative and HER2-negative breast cancer comprising an Akt inhibitor, (3) a method of screening an agent for the prevention or treatment of a breast cancer which is negative for hormone receptors such as an estrogen receptor, a progesterone receptor, etc. and is negative for HER2, which comprises using an Akt inhibitory activity as an indicator; and so on. | 06-24-2010 |
20100158895 | METHODS AND COMPOSITIONS FOR REDUCTION OF SIDE EFFECTS OF THERAPEUTIC TREATMENTS - The invention provides compositions and methods utilizing a nicotinic receptor modulator, e.g., to reduce or eliminate a side effect associated with dopaminergic agent treatment. In some embodiments, the invention provides compositions and methods utilizing a combination of a dopaminergic agent and a nicotinic receptor modulator that reduces or eliminates a side effect associated with dopaminergic agent treatment. | 06-24-2010 |
20100158896 | ANTIBODY THAT SPECIFICALLY BINDS HYALURONAN SYNTHASE - Modulation of Hyaluronan (HA) synthesis and degradation is disclosed by compounds and compositions that are capable of reducing the level of hyaluronan synthase (HAS) or hyaluronidase (HYAL) or the function or activity of HAS or HYAL. The compounds and compositions can also inhibit the expression of genetic material encoding these enzymes. The compounds and compositions comprise nucleic acid molecules and interactive molecules such as antibodies, small molecule inhibitors and substrate analogs of HAS and HYAL. The compounds and compositions are useful in the prophylaxis and/or treatment of inflammatory disorders including hyperproliferative conditions, such as but not limited to, cancer and psoriasis. | 06-24-2010 |
20100158897 | PAI-1 MODULATORS FOR THE TREATMENT OF OCULAR DISORDERS - The invention concerns in one embodiment a method for treating glaucoma or elevated IOP in a patient comprising administering to the patient an effective amount of a composition comprising an agent that modulates PAI-1 activity. In a preferred embodiment, the agent that modulates PAI-1 expression and/or activity is cilostazol or an analog or metabolite of cilostazol. | 06-24-2010 |
20100166731 | Methods and Compositions for Treating Cancer - The present invention relates to methods and compositions for treating cancers by reducing the expression or activity of one or more of the genes encoding protein kinases ATR, MAST2, MAP3K6, TBK1, ADRBK2, CDKL2, LATS2, STK32B, STK11, DDR13 PSKH2, and NEK8, and/or the encoded kinases. The invention also relates to methods and compositions for determining the responsiveness of a cancer patient to anti-cancer drugs based on the status of one or more of such kinases. The invention further relates to methods and compositions for screening compounds that can be used to modulate the expression/activity of these kinases. | 07-01-2010 |
20100166732 | SMALL STREPTOCOCCUS PYOGENES ANTIGENS AND THEIR USE - The present invention relates to a peptide consisting of one antigen of | 07-01-2010 |
20100166733 | MCP-1 SPLICE VARIANTS AND METHODS OF USING SAME - Novel MCP-1 splice variant polypeptides and polynucleotides encoding same are provided. Also provided are pharmaceutical compositions comprising the splice variant polypeptides and polynucleotides, vectors and host cells comprising same. The compositions of the present invention are useful to treat various MCP-1 related disorders as well as for diagnosing, determining predisposition and/or prognosis of various disorders. | 07-01-2010 |
20100166734 | ORAL DELIVERY OF POLYPEPTIDES - The present invention relates to the oral delivery of therapeutic polypeptides comprising one or more single variable domain(s). | 07-01-2010 |
20100166735 | METHODS AND COMPOSITIONS FOR REDUCTION OF SIDE EFFECTS OF THERAPEUTIC TREATMENTS - The invention provides compositions and methods utilizing a nicotinic receptor modulator, e.g., to reduce or eliminate a side effect associated with dopaminergic agent treatment. In some embodiments, the invention provides compositions and methods utilizing a combination of a dopaminergic agent and a nicotinic receptor modulator that reduces or eliminates a side effect associated with dopaminergic agent treatment. | 07-01-2010 |
20100166736 | IMMUNOSTIMULATORY OLIGONUCLEOTIDE MULTIMERS - The invention provides an immunostimulatory nucleic acid. In certain embodiments according to this aspect of the invention, the sequence of the immunostimulatory oligonucleotide and/or immunomer is at least partially self-complementary. | 07-01-2010 |
20100166737 | P38Alpha as a Therapeutic Target in Bladder Carcinoma - The present invention concerns methods and compositions for treating bladder carcinoma by p38 inhibitors. | 07-01-2010 |
20100166738 | COMPOSITIONS AND METHODS FOR WT1 SPECIFIC IMMUNOTHERAPY - Compositions and methods for the therapy of malignant diseases, such as leukemia and cancer, are disclosed. The compositions comprise one or more of a WT1 polynucleotide, a WT1 polypeptide, an antigen-presenting cell presenting a WT1 polypeptide, an antibody that specifically binds to a WT1 polypeptide; or a T cell that specifically reacts with a WT1 polypeptide. Such compositions may be used, for example, for the prevention and treatment of metastatic diseases. | 07-01-2010 |
20100166739 | Methods and Compositions for Diagnosing Urological Disorders - It has been discovered that cytokines, chemokines, and growth factors in urine are biomarkers indicative of urological disorders including interstitial cystitis/painful bladder syndrome and overactive bladder syndrome. Preferred chemokine biomarkers are CCL2, CCL4 (MIP-1β), CCL11, CXCL1 (GRO-α), sCD40L, IL-12p70/p40, IL-5, sIL-2Rα, IL-6, IL-10, IL-8, and EGF. The concentration of one or more of these chemokines in an urine sample can be used to assist in the diagnosis of urological disorders. Methods for evaluating the effectiveness of treatments for urological disorders and for assessing the severity of urological disorders are also provided. | 07-01-2010 |
20100172893 | Use of Reversine and Analogs For Treatment of Cancer - Herein is provided methods and compositions for treating cancer. In one embodiment, a method is provided for treating a patient suffering from cancer, the method comprising administering to the patient an effective amount of reversine, reversine analog or reversine containing agent. In another embodiment, compositions comprising reversine are provided. Such compositions may further comprise additional active agents and other additives. The compositions and methods provided herein are useful, for example, in the area of medicine. | 07-08-2010 |
20100172894 | METHODS FOR PURIFICATION OF SINGLE DOMAIN ANTIGEN BINDING MOLECULES - Processes and methods of purifying or separating Single Domain Antigen Binding (SDAB) molecules that include one or more single binding domains (e.g., one or more nanobody molecules), substantially devoid of a complementary antibody domain and an immunoglobulin constant region, using Protein A-based affinity chromatography, are disclosed. | 07-08-2010 |
20100172895 | Human CGRP Receptor Binding Proteins - Antigen binding proteins that bind to human CGRP receptor (CGRP R) are provided. Nucleic acids encoding the antigen binding protein, vectors, and cells encoding the same are also provided. The antigen binding proteins can inhibit binding of CGRP R to CGRP, and are useful in a number of CGRP R related disorders, including the treatment and/or prevention of migraine headaches. | 07-08-2010 |
20100172896 | HMGB1 PROTEIN INHIBITORS AND/OR ANTAGONISTS FOR THE TREATMENT OF VASCULAR DISEASES - A method of inhibiting atherosclerosis by administering a molecule that binds a protein of the HMG box family. Also, a method of treating vascular diseases by administering an antagonist molecule to inhibit the interaction between a protein of the HMG box family and a receptor for the protein of the HMG box family. | 07-08-2010 |
20100172897 | Diagnosis and Prevention of Fetal Heart Disease - The present invention relates to a method for assessing the likelihood of the presence or formation of fetal heart disease (such as HLHS) in a fetus. In this methodology, the mother, either before or during pregnancy, is tested for the presence of anti-strep antibodies. If positive, the fetus is evaluated and monitored for the presence of fetal heart disease; the fetus can be treated, if appropriate. In addition, either prior to pregnancy or during the first trimester, the mother can be treated to prevent the formation of such antibodies or to neutralize their presence or effect fetal heart tissue. | 07-08-2010 |
20100172898 | MICROSTRUCTURE SYNTHESIS BY FLOW LITHOGRAPHY AND POLYMERIZATION - In a method for synthesizing polymeric microstructures, a monomer stream is flowed, at a selected flow rate, through a fluidic channel. At least one shaped pulse of illumination is projected to the monomer stream, defining in the monomer stream a shape of at least one microstructure corresponding to the illumination pulse shape while polymerizing that microstructure shape in the monomer stream by the illumination pulse. An article of manufacture includes a non-spheroidal polymeric microstructure that has a plurality of distinct material regions. | 07-08-2010 |
20100172899 | IgM Production by Transformed Cell and Method of Quantifying the Same - IgM can be obtained in the form of a pentamer by placing the genes encoding the H, L, and J chains on the same vector to transform appropriate host cells. The gene encoding the J chain may be introduced by co-transfection. When no J chain is expressed, the IgM is produced as a hexamer. The transformants obtained according to the present invention achieve a high yield of IgM. The present invention also provides methods which enable separation and quantification of polymeric IgM. | 07-08-2010 |
20100178289 | THERAPEUTIC USE OF IgG AS A NEUROPROTECTIVE AGENT - The present invention relates to compositions containing IgG and methods for the promotion of nerve regeneration or prevention or inhibition of neuronal degeneration by IgG to ameliorate the effects of injury, disorder or disease of the nervous system. | 07-15-2010 |
20100183583 | GALK1S AS MODIFIERS OF THE PTEN/AKT PATHWAY AND METHODS OF USE - Human GALK1 genes are identified as modulators of the PTEN/AKT pathway, and thus are therapeutic targets for disorders associated with defective PTEN/AKT function. Methods for identifying modulators of PTEN/AKT, comprising screening for agents that modulate the activity of GALK1 are provided. | 07-22-2010 |
20100183584 | CONFORMATION AND ACTIVITY OF GBETA5 COMPLEXES - The invention provides novel recombinant Gβ | 07-22-2010 |
20100183585 | METHODS AND COMPOSITIONS FOR TREATING TUMORS AND METASTASES THROUGH THE MODULATION OF LATEXIN - The present invention relates to methods for treating cancers and metastatic diseases by modulating latexin expression and/or latexin activity. | 07-22-2010 |
20100183586 | METHOD FOR DETECTION OR TREATMENT OF GRAFT VERSUS HOST DISEASE - Disclosed is a method of diagnosing graft-versus-host disease, comprising measuring the level of CCL8 protein in a sample obtained from a subject as an indicator for the diagnosis or course of graft-versus-host disease. Also a diagnostic reagent for graft-versus-host disease comprising an anti-CCL8 antibody is disclosed. The method of the present invention enables diagnosis of the onset of graft-versus-host disease and monitoring of the progress, in particular, differential diagnosis between graft-versus-host disease and an infectious disease. The present invention also provides a method for treating graft-versus-host disease utilizing the anti-CCL8 antibody. | 07-22-2010 |
20100183587 | Therapeutic Compositions for Treatment of Corneal Disorders - The invention provides methods and compositions for minimizing, preventing, or treating damage to corneal nerves by administering to a subject with such damage or at risk of exposure to such damage a composition which blocks an activity of an IL-1 cytokine and/or an IL-17 cytokine. | 07-22-2010 |
20100189711 | TUMOR IMMUNITY - Disclosed herein are materials and methods for treating cancer. In particular, compositions for stimulating tumor immunity through modulation of MFG-E8 are provided. | 07-29-2010 |
20100189712 | Preparation And Use Of Cell-Synthesized Threads - The present technology provides for a cell-synthesized biological thread, processes for making a cell-synthesized thread, and an apparatus for carrying out a process used to engineer the cell-synthesized thread. The thread is produced from living cells in culture and can be grown around the outer surface of a cylindrical bioreactor. The tissue comprising the thread has mechanical and biological properties achieved by altering the climactic conditions, stresses and strains on the tissue and chemical composition that prove beneficial in the medical industry. This process results in a biological thread that has high mechanical strength, decreased immunogenic effect and decreased thrombogenic effect when combined with other tissue. It also results in a product which can be used to create more complex constructs that otherwise could not have been generated. The threads can be used to make sutures, patches, and tubes, for example. | 07-29-2010 |
20100189713 | Use of Semaphorin 6A for Promoting Myelination and Oligodendrocyte Differentiation - The invention provides methods of treating diseases, disorsers or injuries involving demyelination and dysmyelination, including multiple sclerosis, by the administration of a Sema6A polypeptide. | 07-29-2010 |
20100196349 | REELER DOMAIN CONTAINING PROTEIN - This invention relates to protein INSP 171, herein identified as containing a Reeler domain, and to the use of this protein and the nucleic acid sequence from the encoding gene in the diagnosis, prevention and treatment of disease. | 08-05-2010 |
20100196350 | PHARMACEUTICAL COMPOSITION FOR TREATING CHOLANGIOCARCINOMA, A METHOD FOR INHIBITING GROWTH OR INVASION OF CHOLANGIOCARCINOMA AND A METHOD FOR TREATING CHOLANGIOCARCINOMA - Disclosed herein are a pharmaceutical composition for inhibiting the growth or metastasis of cholangiocarcinoiria, comprising a L1CAM activity inhibitor or expression suppressor and a treatment method using the composition. This is based on the finding that L1CAM is overexpressed on cholangiocarcinoma and plays an important role in the growth and metastasis of cholangiocarcinoma and the mortality of cholangiocarcinoma patients increases as the expression rate of L1CAM increases. Also, antibodies inhibitory of the activity of L1CAM, or siRNAs suppressing the expression of L1CAM, are found to reduce the growth and invasion of cholangiocarcinoma cells. Mouse monoclonal antibodies, recognizing the L1CAM protein on the cholangiocarcinoma cell surface and binding specifically to cholangiocarcinoma tissues, or siRNAs, antisense oligonucleotides or shRNAs, may be useful in the treatment of cholangiocarcinoma by inhibiting the growth, invasion and migration of cholangiocarcinoma cell. | 08-05-2010 |
20100196351 | SECRETED PATE-LIKE PROTEINS - Novel PATE-like polynucleotides and polypeptides, are provided. Also described are splice-variants resulting in smaller polypeptides including five cysteine residues and capable of forming PATE-like polypeptide multimerse. The described polynucleotides were found to have a surprising expression profile, predominantly in the reproduction system and nervous system. Further provided are pharmaceutical compositions and methods for treatment of various diseases, in particular nervous system disorders, more specifically Alzheimer's disease. | 08-05-2010 |
20100196352 | COMPOSITION FOR INCREASING STAMINA - Use of whey protein isolate in the preparation of a composition for increasing mean aerobic capacity, enhanced haemoglobin production, enhanced red blood cell production and increased mean corpuscular haemoglobin concentration in competitive species, such as equine species, involved in strenuous activity. The composition may further comprise a prebiotic such as a fructo-oligosaccharide for example inulin. | 08-05-2010 |
20100196353 | INTRADERMAL HPV PEPTIDE VACCINATION - The invention relates to the use of a peptide derived from HPV-E2, E6 and/or E7 protein for the manufacture of a medicament for the treatment or prevention of an HPV related disease, wherein the medicament is for intradermal administration. | 08-05-2010 |
20100196354 | GLUTAMATE RECEPTOR ANTAGONISTS AND METHODS OF USE - The present invention relates to methods and compositions for modulating platelet activity by inhibiting or activating glutamate receptors. The invention further relates to preventing or treating thrombotic diseases. | 08-05-2010 |
20100196355 | Immunophilin Ligands and Methods for Modulating Immunophilin and Calcium Channel Activity - Immunophilin ligands and their uses as modulators of calcium channel activity are disclosed. Screening, therapeutic and prophylactic methods for conditions associated with calcium channel dysfunction, e.g., neurodegenerative and cardiovascular disorders, are also disclosed. | 08-05-2010 |
20100196356 | Tumour Growth Inhibitory Compounds and Methods of their Use - Specific CpG oligonucleotide sequences, when given subcutaneously and in particular when administered on a mucous membrane, e.g. intranasally, intravaginally, or rectally, have a profound effect on various human cancer forms as confirmed in vivo, in animal studies, and in vitro, in human PBMCs collected from blood from healthy subjects and from patients suffering from CLL or FL. The compounds are also preferably used in combination with a cancer therapy chosen among radiation treatment, hormone treatment, surgical intervention, chemotherapy, immunological therapies, photodynamic therapy, laser therapy, hyperthermia, cryotherapy, angiogenesis inhibition, or a combination of any of these, and is most preferably an immunological treatment and comprises the administration of an antibody to the patient. | 08-05-2010 |
20100196357 | Microrna modulators and method for identifying and using the same - The present invention is a method for identifying agents which modulate microRNA activity. The invention involves contacting a cell harboring a microRNA and a microRNA binding sequence, which is operably linked to a nucleic acid molecule encoding a reporter protein, with a test agent and determining whether the test agent increases or decreases the expression of the reporter protein thereby identifying a microRNA modulator. Antagonists identified by this screening assay are provided, as are methods for using the same to inhibit microRNA activity and prevent or treat disease. | 08-05-2010 |
20100203035 | B7-H3 IN CANCER - Methods of determining the prognosis of a subject with cancer and determining risk of cancer progression by assessing expression of B7-H3. Methods of reducing B7-H3 levels and/or activity. | 08-12-2010 |
20100203036 | TARGETS FOR TUMOR GROWTH INHIBITION - The present invention relates to methods for treating cancers by manipulating a target gene expression by up-regulation, silencing and/or down-regulation of the gene, such as EGFR-RP, TRA1, MFGE8, TNFSF13 and ZFP236, respectively. The methods are useful in treating cancers and/or inhibiting tumor growth by enhancing expression of a gene that is validated as a target such as ICT1030, for protein, peptide drug and gene therapy modalities; or by RNA interference to silence and/or down-regulate targets such as ICT1024, ICT1025 and ICT1031 and ICB1003 that are validated for antibody, small molecule and other inhibitor drug modalities. | 08-12-2010 |
20100203037 | METHODS OF USING GPR119 TO IDENTIFY COMPOUNDS USEFUL FOR INCREASING BONE MASS IN AN INDIVIDUAL - The present invention relates to methods of using GPR119 receptor to identify compounds useful for increasing bone mass in an individual. Agonists of GPR119 receptor are useful as therapeutic agents for treating or preventing a condition characterized by low bone mass, such as osteoporosis, and for increasing bone mass in an individual. Agonists of GPR119 receptor promote bone formation in an individual. | 08-12-2010 |
20100203038 | METHODS OF USING GPR119 TO IDENTIFY COMPOUNDS USEFUL FOR INCREASING BONE MASS IN AN INDIVIDUAL - The present invention relates to methods of using GPR119 receptor to identify compounds useful for increasing bone mass in an individual. Agonists of GPR119 receptor are useful as therapeutic agents for treating or preventing a condition characterized by low bone mass, such as osteoporosis, and for increasing bone mass in an individual. Agonists of GPR119 receptor promote bone formation in an individual. | 08-12-2010 |
20100203039 | 3-AMINOCYCLOPENTANECARBOXAMIDES AS MODULATORS OF CHEMOKINE RECEPTORS - The present invention is directed to compounds of Formula I: | 08-12-2010 |
20100209414 | Methods and Compositions Related to Cyclic Peptide Synthesis - Disclosed are compositions and methods for prenylation of polymers such as peptides. | 08-19-2010 |
20100209415 | CHEMOTHERAPEUTIC METHODS AND COMPOSITIONS - Disclosed herein are methods and compositions for enhancing the cell-killing activity of anti-neoplastic agents by inhibiting the activity of a lysyl oxidase-type enzyme. Also disclosed are methods for screening for chemotherapeutic agents, and for molecules that enhance the activity of chemotherapeutic agents, using cells grown on an extracellular matrix. | 08-19-2010 |
20100209416 | IMMUNOASSAYS FOR LAMOTRIGINE - Generally, the present invention relates to lamotrigine analogs that have substituents at the triazine | 08-19-2010 |
20100215637 | Agent for the Treatment of Hormone-Dependent Disorders and Uses Thereof - The present invention relates to novel agents that are useful for treating hormone-dependent disorders. In particular, the present invention relates to A method of modulating a nuclear receptor in vivo comprising the step of administering to a subject in need thereof A nuclear receptor modulating agent comprising a compound or composition capable of altering the endogenous levels of HLS-5 or its activity. | 08-26-2010 |
20100215638 | METHOD FOR TREATMENT OF PROSTATE CANCER AND SCREENING OF PATIENTS BENEFITING FROM SAID METHOD - The invention relates to a method for treating ERG-positive prostate cancer patients with an agent counteracting one or more ERG-associated genes and/or manipulating of one or more ERG-related pathways, optionally in combination with an androgen deprivation therapy. Furthermore, the invention concerns methods for screening prostate cancer patients which may benefit from said treatment, assessing the efficacy of a therapy for treating prostate cancer in a patient, assessing progression of prostate cancer in a patient, selecting an agent to be tested for usefulness in the treatment of prostate cancer, and for assessing prostate carcinogenic potential of an agent. | 08-26-2010 |
20100215639 | Chlamydia Pneumoniae Associated Chronic Intraocular Disorders and Treatment Thereof - Infection by | 08-26-2010 |
20100215640 | METHOD FOR INHIBITING CELLULAR ACTIVATION BY INSULIN-LIKE GROWTH FACTOR-1 - A method of inhibiting cellular activation by Insulin-like Growth Factor-1 (IGF-1) in a subject in need thereof (e.g., a subject afflicted with cancer, atherosclerosis, diabetic retinopathy or other disease) comprises administering an antagonist that inhibits the binding of IAP to SHPS-1 to the subject in an amount effective to inhibit cellular activation by IGF-1. Compounds and compositions for carrying out such methods are also described. | 08-26-2010 |
20100215641 | SCREENING METHOD FOR COMPOUNDS THAT REDUCE ER STRESS - The present invention relates to a cell comprising an Endoplasmic Reticulum (ER) stress element operably linked to a reporter element and an exogenous gene encoding a protein that induces ER stress. Methods of screening using the modified cell, constructs used in the modified cell, the candidate agents identified by the screen and uses thereof are also part of the invention. | 08-26-2010 |
20100215642 | SYNTHETIC RNA-BASED AGONISTS OF TLR7 - The invention relates to the therapeutic use of novel stabilized oligoribonucleotides as immune modulatory agents for immune therapy applications. Specifically, the invention provides novel RNA-based oligoribonucleotides with improved nuclease and RNase stability and that selectively induce immune modulatory activity through TLR7. | 08-26-2010 |
20100215643 | ANTI-INFECTIVE FUNCTIONALIZED SURFACES AND METHODS OF MAKING SAME - Devices are provided which are functionalized to include surface regions having anti-infective agents. Methods are provided for functionalizing various material surfaces to include active surface regions for binding anti-infective agents. Methods are provided by which anti-infective moieties or agents are bonded to functionalized surfaces. | 08-26-2010 |
20100215644 | ANALYSIS OF NODES IN CELLULAR PATHWAYS - An embodiment of the present invention is a method for measuring activity of cell pathways, such as the cell cycle pathway and correlating the resulting profile to phenotypes. The resulting correlations are useful in diagnosis, prognosis, selection and development of drug treatment regimens, and drug screening applications. | 08-26-2010 |
20100215645 | GENETIC POLYMORPHISMS ASSOCIATED WITH RHEUMATOID ARTHRITIS, METHODS OF DETECTION AND USES THEREOF - The present invention is based on the discovery of genetic polymorphisms that are associated with rheumatoid arthritis. In particular, the present invention relates to nucleic acid molecules containing the polymorphisms, variant proteins encoded by such nucleic acid molecules, reagents for detecting the polymorphic nucleic acid molecules and proteins, and methods of using the nucleic acid and proteins as well as methods of using reagents for their detection. | 08-26-2010 |
20100215646 | IMMUNOSTIMULATORY ACTIVITY OF PALINDROMIC IMMUNE MODULATORY OLIGONUCLEOTIDES (IMO) CONTAINING DIFFERENT LENGTHS OF PALINDROMIC SEGMENTS - The invention provides a palindromic immune modulatory nucleic acid. The invention also provides methods for generating, enhancing and modifying the immune response caused by palindromic immune modulatory compounds used for immunotherapy applications | 08-26-2010 |
20100221240 | Chemically Modified Peptide Analogs - The present invention relates to improved agents and methods for treating diabetes and Alzheimer's disease by use of IAPP peptide derivatives. | 09-02-2010 |
20100221241 | CONSTRAINED HIV ENVELOPE-BASED IMMUNOGEN THAT SIMULTANEOUSLY PRESENTS RECEPTOR AND CORECEPTOR BINDING SITES - The present invention relates to a soluble binding complex comprising a soluble gp120 trimer, in which only two gp120 protomers have CD4 binding sites occupied by interconnecting CD4 mimetic moieties, thereby allowing for the exposure of CD4-induced epitopes on the mimetic-bound protomers and an unoccupied CD4 binding site on the third gp120 protomer. | 09-02-2010 |
20100221242 | ANTI-VIRAL GRIFFITHSIN COMPOUNDS, COMPOSITIONS AND METHODS OF USE - A method of inhibiting a viral infection of a host comprising administering to the host an anti-viral griffithsin polypeptide comprising SEQ ID NO: 3 or a fragment thereof comprising at least eight contiguous amino acids, a nucleic acid encoding the anti-viral polypeptide, or an antibody to the anti-viral polypeptide. A method of inhibiting a virus in a sample comprising contacting the sample with an anti-viral griffithsin polypeptide or antibody thereto also is provided. | 09-02-2010 |
20100226911 | Treating or preventing extracellular matrix build-up - A method of treatment for treating, preventing, inhibiting or reducing extracellular matrix build-up in a body tissue or a bodily fluid transport vessel, in a subject, includes administering to a subject in need of such treatment an effective amount of a composition including a peptide agent including amino acid sequence LKKTET, a conservative variant thereof, or a peptide agent that stimulates production of an LKKTET peptide, or a conservative variant thereof, in the tissue. | 09-09-2010 |
20100226912 | RECOMBINANT PROTEIN PRODUCTION IN AVIAN EBx.RTM. CELLS - The invention generally relates to the field of recombinant protein production. More particularly, the invention relates to the use of avian embryonic derived stem cell lines, named EBx®, for the production of proteins and more specifically glycoproteins such as antibodies. The invention is useful for the production of monoclonal IgG1 antibody subtype having high cell-mediated cytotoxic activity. The invention relates to the use of such antibodies as a drug to treat cancers and inflammatory diseases. | 09-09-2010 |
20100226913 | Therapeutic Compositions Comprising Monoterpenes - This invention provides a compositions for transport of a therapeutic agent. The compositions contain a therapeutic agent and a monoterpene or an analog thereof. In one aspect, the monoterpene is perillyl alcohol (POH) or an analog thereof. In one aspect, the therapeutic agent is provided in an amount effective to treat the disease or subject of choice. | 09-09-2010 |
20100233152 | Use of HMGB proteins and nucleic acids that code therefor - The invention relates to the use of HMGB and/or a nucleic acid that codes therefor and/or an interaction partner of HMGB that is in particular natural and/or a nucleic acid that codes therefor as a target molecule for the development and/or production of a medicament for the treatment and/or prevention of diseases of the endometrium and/or for the development and/or production of a diagnostic agent for diagnosing diseases of the endometrium. | 09-16-2010 |
20100233153 | NOVEL GENE DISRUPTIONS, COMPOSITIONS AND THE METHODS RELATING THERETO - The present invention relates to transgenic animals, as well as compositions and methods relating to the characterization of gene function. Specifically, the present invention provides transgenic mice comprising disruptions in PRO1105, PRO1279 or PRO1783 genes. Such in vivo studies and characterizations may provide valuable identification and discovery of therapeutics and/or treatments useful in the prevention, amelioration or correction of diseases or dysfunctions associated with gene disruptions such as neurological disorders; cardiovascular, endothelial or angiogenic disorders; eye abnormalities; immunological disorders; oncological disorders; bone metabolic abnormalities or disorders; lipid metabolic disorders; or developmental abnormalities. | 09-16-2010 |
20100233154 | TARGETED BINDING AGENTS DIRECTED TO HEPARANASE AND USES THEREOF 463 - The invention relates to targeted binding agents that specifically bind to heparanase and inhibit the biological activity of heparanase and uses of such agents. More specifically the invention relates to fully human monoclonal antibodies directed to that specifically bind to heparanase and uses of these antibodies. Aspects of the invention also relate to hybridomas or other cell lines expressing such antibodies. The disclosed targeted binding agents and antibodies are useful as diagnostics and for the treatment of diseases associated with the activity and/or overexpression of heparanase. | 09-16-2010 |
20100233155 | HUMANIZED ANTI-CCR2 ANTIBODIES AND METHODS OF USE THEREFOR - The present invention relates to a humanized antibody or functional fragment thereof which binds to a mammalian (e.g., human) CC-chemokine receptor 2 (CCR2) or a portion of the receptor and blocks binding of a ligand to the receptor. The invention further relates to a method of inhibiting the interaction of a cell bearing mammalian CCR2 with a ligand thereof, and to use of the antibodies and fragments in therapeutic, prophylactic and diagnostic methods. | 09-16-2010 |
20100233156 | Treating Central Nervous System Injury with Beta and Gamma Secretase Inhibitors - Provided herein are methods of treating an acute central nervous system injury in a subject. The methods comprise administering to the subject a γ or β secretase inhibitor, an Aβ antibody, or an immunogenic fragment of Aβ. | 09-16-2010 |
20100233157 | HUMAN ANTIBODIES AGAINST HUMAN FAS AND THEIR USE - Binding members directed to human Fas (Fas), in particular antibody molecules against human Fas, employing the antibody VH and/or VL domain of the antibody molecule termed F45D9, which may be in IgG1 or IgG4 format. Methods of use in patients, diseases or disorders involving apoptosis, such as Graft-Versus-Host Disease, HIV-infection, Stevens-Johnson syndrome or Toxic epidermal necrolysis, Islet transplantation as treatment for insulin-dependent diabetes, diseases based on ischemia or ischemic reperfusion injury, heart disease, renal disease, neurological disorders and injuries and lymphocyte depletion in cancer patients associated to cytotoxic antineoplastic therapy. | 09-16-2010 |
20100239562 | Kv CHANNELS IN NEURODEGENERATION AND NEUROPROTECTION - A family of potassium channels (Kv) are expressed in neurons when they are damaged. Blockers of these channels protect neurons from several different types of insults, whether due to disease or trauma. Furthermore, blockers of these channels promote neurite outgrowth in neural progenitor cells. These findings permit methods of treating as well as methods for identifying and developing drugs for neurological diseases where injury to neurons may occur. | 09-23-2010 |
20100239563 | PHARMACEUTICAL COMPOSITION FOR THE PROPHYLAXIS AND/OR TREATMENT OF VIRAL DISEASES - The invention relates to the use of at least one active substance for producing a pharmaceutical composition for the prophylaxis and/or treatment of at least one viral disease. It is characterized by active substance(s) which inhibit(s) either at least two kinases or at least one SEK kinase of a cellular signal transmission path such that virus multiplication is inhibited. | 09-23-2010 |
20100239564 | NOVEL HUMAN GROWTH FACTORS - The present invention relates to huXAG-1, huXAG-2 and huXAG-3 proteins which are novel human growth factors. In particular, isolated nucleic acid molecules are provided encoding the huXAG-1, huXAG-2 and huXAG-3 proteins. huXAG-1, huXAG-2 and huXAG-3 polypeptides are also provided as are vectors, host cells and recombinant methods for producing the same. The invention further relates to screening methods for identifying agonists and antagonists of huXAG-1, huXAG-2 or huXAG-3 activity. Also provided are diagnostic and therapeutic uses of huXAG-1. huXAG-2 and huXAG-3. | 09-23-2010 |
20100239565 | METHODS OF TREATMENT OF SKIN ULCERS - Methods for treating and/or preventing skin ulcers are provided featuring administration of pharmaceutical compositions comprising inhibitors of activity or expression Of Lp-PLA | 09-23-2010 |
20100239566 | ENIGMA-MDM2 INTERACTION AND USES THEREOF - The present invention relates to Enigma (PDLIM7)-Mdm2 interaction and use thereof. More particularly, it may induce an effective apoptosis of cancer cells by inhibition of an Enigma expression or an Enigma activity which induces Mdm2 destabilization and p53 activity; it may assess the prognosis of anti-cancer therapy by determining that Enigma, which is induced by SRF, is overexpressed in cancer tissues with Mdm2; it may screen anti-cancer activity substances by to selecting a factor to inhibit specific binding between Enigma and Mdm2. Enigma-Mdm2 interaction and Enigma expression regulation may be utilized usefully for preventing cancers and developing therapeutic methods and anti-cancer agents. | 09-23-2010 |
20100239567 | Antibody Formulation - A formulation comprising a therapeutically effective amount of an antibody, optionally, not subjected to prior lyophilization, a buffer maintaining the pH in the range from about 4.5 to about 6.5, and an optional surfactant is described, along with uses for such a formulation. | 09-23-2010 |
20100239568 | DIAGNOSTICS AND TREATMENTS FOR TUMORS - Methods for the treatment of cancer with combination therapies that include anti-VEGF antibodies are provided. Methods for diagnosing resistant tumors are also provided. | 09-23-2010 |
20100239569 | Method Of Treating Disorders Of The Cardiovascular System And A Pharmaceutical Agent - The present application relates to a method of treating disorders of the cardiovascular system which includes administration of homeopathically potentized form of at least one antibody to an antigen, wherein the homeopathically potentized form is obtained by repeated consecutive dilution combined with external impact, and the antigen is a substance or a pharmaceutical agent capable of regulating cardiovascular disorders and pharmaceutical agents thereof. | 09-23-2010 |
20100247514 | GAMMA SECRETASE MODULATORS - In its many embodiments, the present invention provides a novel class of heterocyclic compounds as modulators of gamma secretase, methods of preparing such compounds, pharmaceutical compositions containing one or more such compounds, methods of preparing pharmaceutical formulations comprising one or more such compounds, and methods of treatment, prevention, inhibition, or amelioration of one or more diseases associated with the central nervous system using such compounds or pharmaceutical compositions. | 09-30-2010 |
20100247515 | POLYPEPTIDES, ANTIBODY VARIABLE DOMAINS AND ANTAGONISTS - The invention relates to anti-VEGF polypeptides and antibody single variable domains (dAbs) that are resistant to degradation by a protease, as well as antagonists comprising these. The polypeptides, dAbs and antagonists are useful for pulmonary administration, oral administration, delivery to the lung and delivery to the GI tract of a patient, as well as for treating cancer and inflammatory disease, such as arthritis. | 09-30-2010 |
20100247516 | COMPOSITIONS COMPRISING SEMAPHORINS FOR THE TREATMENT OF ANGIOGENESIS RELATED DISEASES AND METHODS OF SELECTION THEREOF - A method of selecting a semaphorin for treating cancer in a subject is disclosed. The method comprises determining an expression of a semaphorin receptor on tumor cells of a tumor sample of the subject wherein an amount of the semaphorin receptor is indicative of the semaphorin suitable for treating the cancer in the subject. Methods of treating angiogenesis, kits for treating cancer and pharmaceutical compositions comprising semaphorins are also disclosed. | 09-30-2010 |
20100247517 | USE OF MNK INHIBITORS FOR THE TREATMENT OF ALZHEIMER'S DISEASE - The present invention relates to the use of modulators of the kinase activity of Mnk1 and/or Mnk2 the diagnosis, alleviation, treatment and/or prevention of a tauopathy. Particularly, the present invention relates to the use of a modulator of Mnk1 and/or Mnk2 kinase for the diagnosis, alleviation, treatment and/or prevention of Alzheimer's disease. Preferably, the compounds are condensed pyrimidines. | 09-30-2010 |
20100247518 | MODIFIED PROTEINS, DESIGNER TOXINS, AND METHODS OF MAKING THEREOF - The present invention concerns methods of reducing the antigenicity of a proteinaceous compound while maintaining the compounds biological activity, as well as proteinaceous compositions with biological activity but reduced antigenicity. These methods and compositions have significant benefits to a subject in need of such compounds and compositions. Also included are modified toxin compounds that are truncated and/or possess reduce antigenicity. Such designer toxins have therapeutic, diagnostic, and preventative benefits, particularly as immunotoxins. Methods of treating cancer using these immunotoxins are provided. | 09-30-2010 |
20100247519 | HETEROCYCLIC ASPARTYL PROTEASE INHIBITORS - Disclosed are compounds of the formula I | 09-30-2010 |
20100254971 | Method for Diagnosing Prognosing Inflammatory Bowel Disease and Crohn's Disease - Disclosed are methods for diagnosing and prognosing Inflammatory Bowel disease or Crohn's disease (CD) by measuring levels of antibodies to glycans in a biological sample. | 10-07-2010 |
20100254972 | METHODS FOR SELECTING PROTEASE RESISTANT POLYPEPTIDES - The invention relates to a method for selecting, isolating and/or recovering a peptide or polypeptide from a library or a repertoire of peptides and polypeptides (e.g., a display system) that is resistant to degradation by a protease such as a protease found in the GI tract or pulmonary tissue of a human. Generally, the method comprises providing a library or repertoire of peptides or polypeptides, combining the library or repertoire with a protease under conditions suitable for protease activity, and selecting, isolating and/or recovering a peptide or polypeptide that is resistant to degradation by the protease and has a desired biological activity. The selected peptides and polypeptides have utility as therapeutics, eg for treating disease or conditions of GI tract or pulmonary tissue in humans. | 10-07-2010 |
20100254973 | Materials and Methods for Diagnosis of Asthma - The present invention pertains to materials and methods for diagnosing and/or determining the prognosis and likelihood of developing asthma. In one embodiment, methods of the invention comprise the use of single nucleotide polymorphic markers of asthma. Markers of the invention are present in the atria natriuretic peptide (NPPA) gene, and serve as a marker for genetic susceptibility of a person or animal in developing asthma. | 10-07-2010 |
20100254974 | Modulation of Immunostimulatory Properties of Oligonucleotide-Based Compounds by Optimal Presentation of 5' Ends - The invention relates to the therapeutic use of oligonucleotides as immunostimulatory agents in immunotherapy applications. More particularly, the invention provides immunomers for use in methods for generating an immune response or for treating a patient in need of immunostimulation. The immunomers of the invention comprise at least two oligonucleotides linked at their 3′ ends, internucleoside linkages or functionalized nucleobase or sugar to a non-nucleotidic linker, at least one of the oligonucleotides being an immunostimulatory oligonucleotide and having an accessible 5′ end. | 10-07-2010 |
20100254975 | ALPHA-4 BETA-7 HETERODIMER SPECIFIC - There are disclosed alpha4beta7 heterodimer-specific antigen binding proteins, nucleic acids encoding them, and methods of making and using them. | 10-07-2010 |
20100254976 | USE OF PROTEASE NEXIN 1 INHIBITORS TO REDUCE METASTASIS - The present invention relates to a method of inhibiting metastasis comprising the administration of an inhibitor of protease nexin-1 (PN-1), characterized in that said inhibitor is administered at a therapeutical dosage that does not completely inhibit the expression and/or activity of PN-1. | 10-07-2010 |
20100260742 | Medicament and a method for regulation of the vascular tone - The antibody based medicament contains ultra low doses of monoclonal, polyclonal, immune or natural antibodies to a protein or a peptide involved in the vascular tone regulation or mediating the effects of other regulators; these antibodies are used in activated (potentiated) form produced by multiple subsequent dilution and external impact, preferably in accordance with homeopathic technology. The method of treatment for diseases accompanied by disturbances of the vascular tone utilizes the use of ultra low doses of antibodies to a protein or a peptide involved in the vascular tone regulation or mediating the effects of other regulators; these antibodies are used in activated form produced by multiple subsequent dilution and external impact. | 10-14-2010 |
20100260743 | Solubilization and Targeted Delivery of Drugs With Self-Assembling Amphiphilic Polymers - There are provided amphiphilic biodegradable copolymers comprising a hydrophilic backbone with pendant aliphatic groups as the hydrophobic component. The polymers form nanoscale molecular aggregates in aqueous environments, which have hydrophobic interiors that are capable of solubilizing insoluble organic compounds such as drugs, vitamins, dyes, and imaging agents. The polymers optionally feature reactive functional groups that provide attachment points for antibodies, ligands, and other targeting moieties useful for the targeted delivery of drugs and imaging agents. | 10-14-2010 |
20100260744 | REGULATING IL-4 AND IL-13 LEVELS BY BLOCKING HIGH AFFINITY BINDING BY IL-3, IL-5 AND GM-CSF TO THEIR COMMON RECEPTOR - A method of reducing IL-4 and/or IL-13 levels in the lung of a mammal with elevated levels thereof, includes the step of administering to the mammal an effective amount of a βc receptor blocker capable of blocking the binding of all three of IL-3, IL-5 and GM-CSF to the βc common chain to thereby reduce the IL-4 and/or IL-13 levels. | 10-14-2010 |
20100260745 | METHODS OF USING AND CONSTRUCTING NANOSENSOR PLATFORMS - The present invention relates to the use of nanowires, nanotubes and nanosensor platforms. In one embodiment, the present invention provides a method of constructing a nanosensor platform. In another embodiment, the present invention provides a method of analyzing multiple biomarker signals on a nanosensor platform for the detection of a disease. | 10-14-2010 |
20100260746 | Novel Bank1 Splice Variant - The present invention relates to a new splice variant of BANK1, the use of SNPs in BANK1 for diagnostics and the use of antagonists to modulate BANK1 and/or the BANK1 pathway. | 10-14-2010 |
20100260747 | Use of Tetrahydrobiopterin as a Marker and a Therapeutic Agent for Fabry Disease - Blood and tissue markers of the metabolic status, risk of health complications in Fabry disease patients and as a biomarker to follow the efficacy of treatment in animal models and patients with Fabry disease comprising tetrahydrobiopterin (BH4), precursors and metabolites of BH4, and other related co-factors is disclosed herein. The present invention further describes the use of BH4 therapy as a treatment option for Fabry disease to prevent, slow or reverses vascular cardiac and renal manifestations of Fabry disease. | 10-14-2010 |
20100266574 | Oligoribonucleotides and Methods of Use Thereof for Treatment of Fibrotic Conditions and Other Diseases - The invention relates to a double-stranded compound, preferably an oligoribonucleotide, which down-regulates the expression of a gene of the TGase family at post-transcriptional level. The invention also relates to a pharmaceutical composition comprising the compound, or a vector capable of expressing the oligoribonucleotide, and a pharmaceutically acceptable carrier. The present invention also contemplates a method of treating a patient suffering from fibrotic disease such as kidney and liver fibrosis and ocular scarring comprising administering to the patient the pharmaceutical composition in a therapeutically effective amount so as to thereby treat the patient. The invention also relates to treatment of fibrotic and other diseases by use of antibodies to TGase polypeptides. | 10-21-2010 |
20100266575 | SOLUBLE FMS-LIKE TYROSINE KINASE-1 (sFLT-1) ANTIBODY AND RELATED COMPOSITION, KIT, METHODS OF USING, AND MATERIALS AND METHOD FOR MAKING - An isolated antibody that specifically binds to sFlt-1 or a fragment thereof having (i) a variable heavy domain region comprising the amino acid sequence of SEQ ID NO: 2, (ii) a variable light domain region comprising the amino acid sequence of SEQ ID NO: 4, or (iii) both (i) and (ii), a pharmaceutical composition and a kit comprising such an antibody, a method of making such an antibody, a method of determining the presence, amount or concentration of sFlt-1 or a fragment thereof in a test sample, a method of treating a patient in therapeutic or prophylactic need of an antagonist of sFlt-1, an isolated nucleic acid comprising a nucleotide sequence encoding the amino acid sequence of (i) SEQ ID NO: 2, (ii) SEQ ID NO: 4, or (iii) both (i) and (ii), optionally as part of a vector, and a host cell comprising and expressing such a nucleic acid. | 10-21-2010 |
20100266576 | USE OF A CAMELID SINGLE-DOMAIN ANTIBODY FOR DETECTING AN OLIGOMERIC FORM OF AN AMYLOID BETA PEPTIDE AND ITS APPLICATIONS - Use of camelid single-domain antibodies for detecting an oligomeric form of the amyloid β peptide 42 and their therapeutic and diagnostic applications. | 10-21-2010 |
20100266577 | Method of Cancer Treatment with Antagonists of FAS Inhibitors - In one embodiment, the present invention relates to a method of treating a cancer characterized by inhibition of Fas-mediated apoptosis, comprising administering to a patient suffering from the cancer a pharmaceutically-effective amount of a composition comprising a peptide that competitively antagonizes at least one protein-Fas binding selected from the group consisting of herpes virus 8 protein K1 binding to Fas, CD74 binding to Fas, and pi 00 binding to Fas. In a further embodiment, the peptide is selected from the group consisting of peptides having from about 15 to about 35 amino acid residues and comprising at least a portion of the immunoglobulin domain of K1, peptides having from about 15 to about 35 amino acid residues and comprising at least fifteen consecutive amino acid residues among positions 50-120 of CD74, LVTLLLAGQ ATT A YFL YQQQ, LYQQQGRLDKLTVTSQNLQL, QNLQLENLRMKLPKPPKPVS, and PKPVSKMRMATPLLMQALPM. In another embodiment, the present invention relates to a method of treating a disease characterized by unwanted apoptosis in a mammal, comprising transfecting a cell of the mammal with a nucleic acid molecule encoding CD74. The present invention also relates to the compositions referred to above and their use in manufacture of medicaments for treatment of the diseases described herein. | 10-21-2010 |
20100266578 | TREATMENT AND DIAGNOSTIC METHODS FOR HYPERSENSITIVE DISORDERS - The current standard of care for the treatment of allergic airway diseases include short and long acting beta-agonists, and inhaled or systemic corticosteroids, cromolyn and xanthines that all have the potential of detrimental side-effects. The present invention describes a new mechanistic protein-based therapeutic approach for the treatment of allergic airway disease and diseases associated with excessive Th2 pathology. The present invention relates to the surprising discovery that serum amyloid P (SAP) demonstrates a therapeutic affect in the treatment of hypersensitive disorders. | 10-21-2010 |
20100266579 | TREATMENT OF INFLAMMATORY DISEASES - We describe the involvement of JunD in the activation of macrophages and the association of JunD in inflammatory diseases and conditions. | 10-21-2010 |
20100266580 | TRANSLOCATION AND MUTANT TNK1 KINASE IN HUMAN LYMPHOMA - In accordance with the invention, a novel gene translocation in human Hodgkin's lymphoma (HL) that results in a fusion protein combining part of C17ORF61 with Thirty-eight-negative kinase 1 (Tnk1) kinase has now been identified. The TNK1-C17ORF61 fusion protein, which retains TNK1 tyrosine kinase activity, was confirmed to drive the proliferation and survival of Hodgkin's lymphoma (HL) cell line, L-540. The invention therefore provides, in part, isolated polynucleotides and vectors encoding the disclosed mutant TNK1 kinase polypeptides, probes for detecting it, isolated mutant polypeptides, recombinant polypeptides, and reagents for detecting the fusion and truncated polypeptides. The disclosed identification of this new fusion protein and truncated kinase enables new methods for determining the presence of these mutant TNK1 kinase polypeptides in a biological sample, methods for screening for compounds that inhibit the proteins, and methods for inhibiting the progression of a cancer characterized by the mutant polynucleotides or polypeptides, which are also provided by the invention. | 10-21-2010 |
20100272706 | ANTIVIRALS - This invention provides methods for inhibiting or treating infection by viruses, in particular pox viruses by modulating a kinase, in particular by inhibiting a host cell kinase, involved in mediating viral infection. Methods to identify, validate, and classify the cellular proteins required by viruses during infection of host cells in order to select agents which can inhibit viral infection are described herein. Using a systems biology approach the virus/host cell interaction is studied from initial attachment of the incoming virus to the cell surface, to entry, transcription, replication, biosynthesis, and assembly of progeny particles. The method employs a siRNA screening platform and uses gene silencing to map the ‘viral infectome’—a compilation of cellular proteins that the virus needs to establish infection and drive the infectious cycle. Charting the infectome provides information on the viral biology by the identification of host cell proteins involved in viral infection and allows the development of novel anti-viral drugs that prevent the viruses from establishing productive infection in cells. | 10-28-2010 |
20100272707 | ENZYMATIC LARGE-SCALE SYNTHESIS OF MUCIN GLYCONJUGATES, AND IMMUNOGENIC APPLICATIONS THEREOF - The present invention relates to mucin glycoconjugates, and to a process of producing mucin glycoconjugates. It relates to the biological, pharmaceutical and medical applications thereof. The invention notably provides mucin glycoconjugates which do not require a protein carrier, such as KHL, to induce an immune response (anti-Tn IgG). | 10-28-2010 |
20100272708 | METHOD FOR THE TREATMENT OF TYPE AND TYPE IV HYPERSENSITIVITY - The present application relates to methods for the treatment of eczema and uses of a dairy-derived composition. The treatment involves oral administration of 800 mg/day of a composition comprising TGF-β1, TGF-β2, IGF-1 and 60% (w/w) beta-lactoglobulin derived from whey. | 10-28-2010 |
20100272709 | CATHEPSIN L MEDIATED DISEASES AND ASSOCIATED METHODS AND PRODUCTS - This invention relates generally to the treatment of cathepsin or dynamin mediated diseases, such as proteinuria, cancer, and cognitive disease and related products. Diagnostic and other assays are also provided, as well as methods for podocyte cell gene transfer. | 10-28-2010 |
20100272710 | COMPOSITIONS AND METHODS FOR TREATING AND PREVENTING AGING-ASSOCIATED DISEASES - Provided herein are novel TXNIP-modulating compounds and methods of use thereof. The TXNIP-modulating compounds may be used to enhance cellular anti-stress defense and prevent stress-induced damage to DNA, proteins and lipids. Therefore, TXNIP-modulating compounds may be used to treat or prevent a wide variety of stress-induced diseases and thus aging. | 10-28-2010 |
20100272711 | COMPOSITIONS AND METHODS FOR THE TREATMENT AND PREVENTION OF CARDIOVASCULAR DISEASES - The present invention is directed to a pharmaceutical composition, and methods of use thereof, comprising at least one agent which target multiple adenosine receptors (AR) simultaneously in a stoichiometric relationship (i.e. each AR receptor is targeted to an equal extent). Aspects of the present invention relate to pharmaceutical compositions, and uses thereof, comprising at least one agent which co-activates an A | 10-28-2010 |
20100272712 | JNK3 AS A TARGET FOR THE TREATMENT OF ANGIOGENESIS-RELATED DISEASES - Provided herein are methods for treating a subject having or at risk for an angiogenesis-related disorder. The methods include administering to the subject a therapeutically effective amount of an agent that inhibits JNK3 expression, or a therapeutically effective amount of an agent that inhibits JNK3 activity. Disorders that can be treated by these methods include cancer, rheumatoid arthritis, vascular diseases, and other disorders resulting from excessive angiogenesis. The therapeutic agent may be a compound, small molecule, peptide, antibody, antisense nucleic acid, ribozyme, or the like. Methods of identifying a candidate agent that modulates JNK3 expression are also provided. | 10-28-2010 |
20100272713 | Genetic Markers Associated with Endometriosis and Use Thereof - The present invention relates to novel genetic markers associated with endometriosis and risk of developing endometriosis, and methods and materials for determining whether a human subject has endometriosis or is at risk of developing endometriosis and the use of such risk information in selectively administering a treatment that at least partially prevents or compensates for an endometriosis related symptom. | 10-28-2010 |
20100272714 | Anti-ADDL Antibodies and Uses Thereof - The present invention relates to antibodies that differentially recognize multi-dimensional conformations of Aβ-derived diffusible ligands, also known as ADDLs. The antibodies of the invention can distinguish between Alzheimer's Disease and control human brain extracts and are useful in methods of detecting ADDLs and diagnosing Alzheimer's Disease. The present antibodies also block binding of ADDLs to neurons, assembly of ADDLs, and tau phosphorylation and are there useful in methods for the preventing and treating diseases associated with soluble oligomers of amyloid β 1-42. | 10-28-2010 |
20100278807 | Novel antimicrobial agents - A novel class of antimicrobial polymeric agents which are designed to exert antimicrobial activity while being stable, non-toxic and avoiding development of resistance thereto and a process of preparing same are disclosed. Further disclosed are pharmaceutical compositions containing same and a method of treating medical conditions associated with pathological microorganisms, a medical device, an imaging probe and a food preservative utilizing same. Further disclosed are conjugates of an amino acid residue and a hydrophobic moiety residue and a process of preparing same. | 11-04-2010 |
20100278808 | POLYPEPTIDES WITH ENHANCED ANTI-INFLAMMATORY AND DECREASED CYTOTOXIC PROPERTIES AND RELATING METHODS - The invention provides a polypeptide containing at least one IgG Fc region region, said polypeptide having a higher anti-inflammatory activity and a lower cytotoxic activity as compared to an unpurified antibody and methods of production of such polypeptide. | 11-04-2010 |
20100278809 | Inhibitors of MRP4 for the Treatment of Vascular Disorders - The invention relates to inhibitors of MRP4 for the treatment and/or the prevention of vascular disorders such as atherosclerosis, post-angioplasty restenosis, pulmonary arterial hypertension or vein-graft disease. | 11-04-2010 |
20100278810 | Methods of Modulating Angiogenesis - The present invention provides methods of modulating angiogenesis in an individual, the methods generally involving administering to an individual an agent that modulates the expression or activity of GPR124. In one embodiment, the methods of the invention relate to inhibiting pathological angiogenesis by decreasing activity of GPR124, which method may be carried out in conjunction with administration of one or more other anti-angiogenic agents. | 11-04-2010 |
20100278811 | VASCULOSTATIC AGENTS AND METHODS OF USE THEREOF - Compositions and methods and are provided for treating disorders associated with compromised vasculostasis. Invention methods and compositions are useful for treating a variety of disorders including for example, stroke, myocardial infarction, cancer, ischemia/reperfusion injury, autoimmune diseases such as rheumatoid arthritis, eye diseases such as retinopathies or macular degeneration or other vitreoretinal diseases, inflammatory diseases, vascular leakage syndrome, edema, transplant rejection, adult/acute respiratory distress syndrome (ARDS), and the like. | 11-04-2010 |
20100278812 | NASAL IMMUNIZATION - Compositions and methods for intranasal delivery of antigens for immunization of a mammal are disclosed. Antigens include, peptides, proteins, peptidomimetics, DNA, RNA, carbohydrates and phospholipids. The compositions contain at least one antigen and a permeation enhancer. | 11-04-2010 |
20100284999 | CHARACTERIZATION OF THE CBIR1 ANTIGENIC RESPONSE FOR DIAGNOSIS AND TREATMENT OF CROHN'S DISEASE - This invention provides methods of diagnosing or predicting susceptibility to Crohn's Disease by determining the presence or absence of genetic variants. In one embodiment, the present invention provides methods to diagnose and/or predict susceptibility to Crohn's Disease in an individual by determining the presence or absence of anti-Cbir1 reactivity and the presence or absence of TLR5 risk variants. In another embodiment, the present invention provides methods to diagnose Crohn's Disease by determining the presence or absence of NFKB1 haplotype H3 and/or ASCA expression. In another embodiment, the present invention provides methods of diagnosing Crohn's Disease by determining the presence or absence of Cbir1 specific peripheral blood T cell proliferation. | 11-11-2010 |
20100285000 | USE OF VEGFR-2 INHIBITORS FOR TREATING METASTATIC CANCER - The present application provides compositions and methods for treating metastatic cancer. Patients having or at risk of developing metastases may be treated. Compositions useful for the invention include VEGFR-2 specific inhibitors. | 11-11-2010 |
20100285001 | Method and Compositions Related to Synergistic Responses to Oncogenic Mutations - Disclosed are compositions and methods related to new targets for cancer treatment. | 11-11-2010 |
20100285002 | TREATMENT OR PREVENTION OF INFLAMMATION BY TARGETING CYCLIN D1 - In one aspect, the invention relates to the treatment and/or prevention of inflammation by inhibition of cyclin D1. In one embodiment, Th1-mediated inflammation is selectively inhibited or reduced by a method comprising administering an agent that inhibits cyclin D1. In another embodiment, an autoimmune disease or a disorder characterized by or involving a Th1 inflammatory response is treated or prevented in a subject by a method comprising administering to the subject an agent that inhibits cyclin D1. | 11-11-2010 |
20100285003 | THERAPEUTIC PEPTIDES AND USES THEREOF - The present invention is directed to a family of therapeutic peptides capable of modulating cytokine expression and/or stimulating the immune system of subject without producing or sustaining serious side-effects. Methods using the peptides to modulate cytokine expression in a subject, treat a disease, enhance vaccination, and stimulate a subject's immune system response are also disclosed. | 11-11-2010 |
20100291065 | Compositions for Protein Delivery and Methods of Use Thereof - Compositions and methods for the delivery of a protein of interest are provided. | 11-18-2010 |
20100291066 | DONOR SPECIFIC ANTIBODY LIBRARIES - The present application concerns donor-specific antibody libraries derived from a patient donor who has suffered from, or is suffering from one or more diseases discussed herein. The present application also concerns the method of making and using the donor-specific antibodies. The present application further concerns the neutralizing antibodies obtained from the donor-specific antibody libraries and the methods of using these antibodies for the prevention/treatment of human disease. | 11-18-2010 |
20100291067 | Methods And Compositions Relating to Viral Latency - Disclosed are compositions and methods that relate generally to viruses, and more particularly to the agents and their identification and use of anti-HIV agents which cause latently infected cells to reactivate. | 11-18-2010 |
20100291068 | NUCLEIC ACID MOLECULES AND PROTEINS FOR THE IDENTIFICATION, ASSESSMENT, PREVENTION, AND THERAPY OF OVARIAN CANCER - The invention relates to newly discovered nucleic acid molecules and proteins associated with ovarian cancer. Compositions, kits, and methods for detecting, characterizing, preventing, and treating human ovarian cancers are provided. | 11-18-2010 |
20100291069 | METHODS OF TREATING A DIABETIC EMBRYOPATHY - Maternal diabetes can lead to a developmental malformation of an embryo. A developmental malformation caused by maternal diabetes is commonly referred to as a diabetic embryopathy. There is currently no effective treatment for reducing or inhibiting a diabetic embryopathy. To this end, the present invention is drawn to novel methods of treating a diabetic embryopathy. | 11-18-2010 |
20100297101 | Integrin alpha. II .B.beta.3 Specific Antibodies and Peptides - The present invention provides integrin α | 11-25-2010 |
20100297102 | SEROTONIN 5-HT3A RECEPTORS IN TREATMENT OF NEUROLOGICAL AND PSYCHIATRIC DISORDERS - Methods are provided for modulating post-natal migration of neurons. Activation of the 5-HT3A receptor increases migration, while pharmacological blockade of the 5-HT3A receptor disrupts neuroblast migration into the cortex and hippocampus. These neuroblasts mature into GABAergic interneurons, and thus are relevant to conditions associated with disturbances in 5-HT levels and GABAergic inhibition. | 11-25-2010 |
20100297103 | ANTIBODY HAVING ENHANCED ADCC ACTIVITY AND METHOD FOR PRODUCTION THEREOF - Disclosed is an antibody having an enhanced ADCC activity. Also disclosed is a method for producing the antibody. It was attempted to advance the technique of the amino acid mutation in an Fc region established by researchers of Genentech Inc. or the like, and a study was made on whether or not the ADCC activity can be enhanced by the mutation of an amino acid residue in an Fc region into cysteine (Cys) which may cause a drastic structural change that cannot be drawn by a computational search. As a consequence, a chemeric antibody is provided which has the mutation of an amino acid residue at least one position selected from the group consisting of 286th, 287th, 288th, 289th, 290th, 291st, 292nd, 294th, 298th, 301st, 302nd, 303rd, 305th, 306th, 307th, 308th and 309th positions into a Cys residue in an H-chain constant region. | 11-25-2010 |
20100297104 | DENDRITIC MACROMOLECULE AND A PROCESS THEREOF - The present invention is in relation to a dendritic molecule having symmetrically sited branches having four or more generations of dendrimers wherein the branch points are tertiary amines linked together with oxygen atom of ether and the heteroatoms are separated by a substituted or non-substituted linear three methylene linker. In addition the invention also provides a process to prepare such dendritic macromolecules. | 11-25-2010 |
20100297105 | ADMINISTERING ANTISENSE OLIGONUCLEOTIDES COMPLEMENTARY TO HUMAN APOLIPOPROTEIN B - Methods for long-term lowering of lipid levels in human subjects and for the treatment of conditions associated with elevated LDL-cholesterol and elevated ApoB are provided. | 11-25-2010 |
20100297106 | Pharmaceutical Formulations - A stable pharmaceutical formulation is provided that comprises a biologically active protein and an excipient selected from carnitine, creatine or creatinine. | 11-25-2010 |
20100297107 | HMGB1 PROTEIN INHIBITORS AND/OR ANTAGONISTS FOR THE TREATMENT OF VASCULAR DISEASES - A method of treating vascular diseases by administering an antagonist molecule that inhibits the interaction between a protein of the HMG box family and a receptor for the protein of the HMG box family. | 11-25-2010 |
20100297108 | METHOD OF PROVIDING PATIENT SPECIFIC IMMUNE RESPONSE IN AMYLOIDOSES AND PROTEIN AGGREGATION DISORDERS - A novel treatment of Alzheimer's disease and other disorders involving protein misfolding or aggregation is provided by enhancing or sustaining an antibody response against predominantly directed against pathological protein aggregates or neo-epitopes present on pathogenic forms of said protein or protein complex. Furthermore, therapeutic methods are also described, wherein ex vivo stimulated antigen-selected peripheral blood lymphocytes are regrafted into the cognate donor. | 11-25-2010 |
20100297109 | METHODS FOR INHIBITING FASCIN - The invention relates to compositions and methods useful for inhibiting fascin. These compositions and methods can be used to inhibit fascin-related diseases. For example, according to the invention inhibition of fascin inhibits metastasis of tumor cells in mammals. | 11-25-2010 |
20100303801 | Host cell specific binding molecules capable of neutralizing viruses and uses thereof - The present invention provides human binding molecules specifically binding to a host cell protein and having virus neutralizing activity, nucleic acid molecules encoding the human binding molecules, compositions comprising the human binding molecules and methods of identifying or producing the human binding molecules. The human binding molecules can be used in the diagnosis, prophylaxis and/or treatment of viral infections. | 12-02-2010 |
20100303802 | ANTIBODY DIRECTED TO G PROTEIN COUPLED RECEPTORS (GPCR) - The present invention provides an antibody directed to an epitope of a G-protein coupled receptor, wherein the antibody binds to the extracellular N-terminal region of the receptor and the binding of the antibody to the G-protein coupled receptor induces receptor internalization in cells. | 12-02-2010 |
20100303803 | CATENATE FOR IMMUNOSTIMULATION - The invention relates to a multimeric, non-coding nucleic acid molecule for modulating the activity of the human or animal immune system, and to a production method therefor, and to a vaccine containing said multimeric, non-coding nucleic acid molecule. Said multimeric, non-coding nucleic acid molecules can be non-coding nucleic acid molecules that consist of at least two of said molecules (dimer) or assemblies of several non-coding nucleic acid molecules. | 12-02-2010 |
20100303804 | COMPOSITION THAT CAN BE CURED BY POLYMERISATION FOR THE PRODUCTION OF BIODEGRADABLE, BIOCOMPATIBLE, CROSS-LINKABLE POLYMERS ON THE BASIS OF POLYVINYL ALCOHOL - The present invention relates to a polymerization-curable composition for the preparation of biodegradable, biocompatible, cross-linked polymers on the basis of polyvinyl alcohol comprising: 5 to 100% by weight of (a) vinyl ester monomer(s) of one of the general formulas (I) to (III): | 12-02-2010 |
20100303805 | IDENTIFICATION OF SMALL MOLECULES RECOGNIZED BY ANTIBODIES IN SUBJECTS WITH NEURODEGENERATIVE DISEASES - The present invention provides for the identification of individuals having neurodegenerative diseases (ND). Peptoids recognized by Parkinson's Disease- and Alzheimer's Disease-specific antibodies are identified, allowing one to diagnose or predict ND in subjects. | 12-02-2010 |
20100310547 | Treatment of Inflammatory Diseases - The present invention relates generally to the field of inflammatory diseases of the peripheral nervous system. More particularly, it concerns methods for treating inflammatory diseases of the peripheral nervous system by modulating sphingosine-1-phosphate receptor activity. In one embodiment, the present invention provides a method of treating a subject with chronic inflammatory demyelinating polyneuropathy (CIDP) or other autoimmune neuropathies comprising administering to the subject an effective amount of FTY720. | 12-09-2010 |
20100310548 | Methods of Manufacturing a Biologic Using a Stable Storage Intermediate - The present invention is directed to methods of isolating and purifying protein from a bioreactor process. The invention relates to employing a protein phase separation methodology to isolate or purify protein product in the forms of solid, semi-solid, or suspension during a protein manufacturing purification process as a stable storage intermediate. This approach is designed to allow the isolated protein product (purified or partially purified) to be stored over an extended period of time prior to further protein purification steps. | 12-09-2010 |
20100310549 | INHIBITORS OF TYPE 2 VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTORS - The present disclosure relates to novel vascular endothelial growth factor receptor (VEGFR)-binding polypeptides and methods for using these polypeptides to inhibit biological activities mediated by vascular endothelial growth factors (VEGFs). The present disclosure also provides various improvements relating to single domain binding polypeptides. | 12-09-2010 |
20100310550 | ALPHA 1- ANTITRYPSIN COMPOSITIONS - A streamlined method for purifying alpha-1-antitrypsin (AAT) from an AAT-containing protein mixture, such as a Cohn fraction IV precipitate, is provided. In the method of the invention, contaminating proteins are destabilized by cleavage of disulfide bonds with a reducing reagent, such as a dithiol, which does not affect AAT. The destabilized proteins are then preferentially adsorbed on a solid protein-adsorbing material, without the addition of a salt as a precipitant. Separation of the solid adsorbent from the solution leaves a purified AAT solution that is directly suitable for chromatographic purification, without the need for extensive desalting as in prior art processes. A process incorporating this method, which provides pharmaceutical grade AAT in high yield on a commercial scale, is also described. | 12-09-2010 |
20100316626 | METHODS FOR TREATMENT AND DIAGNOSIS OF PSYCHIATRIC DISORDERS - A method for preventing or treating a psychiatric disorder in a mammalian subject is provided. A method for preventing or treating a psychiatric disorder in a mammalian subject is provided which comprises administering to the subject a modulator of ErbB receptor signaling in an amount effective to reduce or eliminate the psychiatric disorder in the subject or to prevent its occurrence or recurrence. A method for diagnosis of a psychiatric disorder in a mammalian subject is provided. | 12-16-2010 |
20100316627 | Human antibodies to human IL-6 receptor - A human antibody or an antigen-binding fragment which binds human IL-6 receptor (hIL-6R) with a K | 12-16-2010 |
20100316628 | AGENTS AND METHODS FOR TREATING RESPIRATORY DISORDERS - The present invention relates to a novel method of preventing and/or treating respiratory disorders and respiratory-related complications in a subject by inhibiting the release of nitric oxide from basal cells in the respiratory tract. | 12-16-2010 |
20100316629 | Use of gene expression profiling to predict survival in cancer patient - Gene expression profiling in multiple myeloma patients identifies genes that distinguish between patients with subsequent early death or long survival after treatment. Poor survival is linked to over-expression of genes such as ASPM, OPN3 and CKS1B which are located in chromosome 1q. Given the frequent amplification of 1q in many cancers, it is possible that these genes can be used as powerful prognostic markers and therapeutic targets for multiple myeloma and other cancer. | 12-16-2010 |
20100322919 | Antibodies Against a Cancer-Associated Epitope of Variant NFKBIB and Uses Thereof - The present application provides the amino acid and nucleic acid sequences of heavy and light chain complementarity determining regions of a cancer specific antibody directed to an epitope of variant Nuclear Factor Kappa-B inhibitor beta (NFKBIB). In addition, the application provides cancer specific antibodies and immunoconjugates comprising the cancer specific antibody attached to a toxin or a label, and methods of uses thereof. The application also relates to diagnostic methods and kits using the cancer specific antibodies herein. Further, the application provides novel cancer-associated epitopes and antigens of variant NFKBIB, and uses thereof. | 12-23-2010 |
20100330066 | Methods for Use with Baff Antagonists - BAFF plays a central role in acquired immunity. The disclosure identifies BAFF-responsive genes that are substantially upregulated by administration of BAFF and substantially downregulated by treatment with a BAFF antagonist. Specific genes are: NF-κB2, CD23, H2-Mβ (the beta chain of H2-DM), Fig-1, and OBF-1. The disclosure provides methods and compositions for: monitoring the activity of a BAFF antagonist in a mammal; monitoring BAFF activity in a mammal; identifying a mammal to be treated with a BAFF antagonist; and related uses. Such methods include detecting one or more molecules selected from the group consisting of Fig-1 molecule, OBF-1 molecule, and H2-Mβ molecule in a biological sample of the mammal, and optionally further detecting NF-κB2 molecule and/or CD23 molecule in the biological sample. | 12-30-2010 |
20100330067 | Compounds and Methods for the Modulation of Toll-Like Receptor Function - The present invention relates to compositions and methods for use in the treatment of conditions such as septicaemia and septic shock. The invention further provides compositions and methods for the suppression Toll-like Receptor 4 mediated activation of the immune system. The invention further provides screening assays to identify compounds which have utility in the foregoing compositions and methods. | 12-30-2010 |
20100330068 | MONOMERIC VHH DOMAIN DERIVED FROM ANTI-VP6 CAMELID ANTIBODIES, DIMERIC DOMAIN, IMMUNISATION METHOD, ROTAVIRUS DETECTION METHOD, COMPOSITION, PREVENTION AND TREATMENT METHODS FOR ROTAVIRUS INFECTIONS - Monomeric VHH domain derived from anti-VP6 camelid antibodies, dimeric domain, immunisation method, rotavirus detection method, vaccine composition, prevention and treatment methods for rotavirus infections, wherein said domain may be any of the amino acid sequences shown in SEQ ID No. 1, SEQ ID No. 2, SEQ ID No. 3 or SEQ ID No. 4, and wherein said domains bind to protein VP6 of Group A rotavirus. | 12-30-2010 |
20100330069 | HETEROCYCLIC COMPOUNDS AND METHODS OF USE - Heterocyclic compounds derived from benzotriazine, triazines, triazoles and oxadiazoles are disclosed. The methods of synthesis and of use of such heterocyclic compounds are also provided. | 12-30-2010 |
20100330070 | Methods Of Making An Antibody And Compositions Thereof - The present invention relates to new methods for making antibodies that involves chemically modifying the antigen with methylglyoxal. The present invention further relates to antibodies made in this manner, and include antibodies specific to LL-37. The present invention pertains to assays that utilize anti-LL-37 antibodies and assess compounds that stimulate LL-37 production. Such compounds are useful in antimicrobial compositions. | 12-30-2010 |
20100330071 | METHOD TO PRODUCE A HIGHLY CONCENTRATED IMMUNOGLOBULIN PREPARATION FOR SUBCUTANEOUS USE - The present invention relates to a new and improved method for preparing a highly concentrated immunoglobulin composition from pooled plasma for subcutaneous injection. A composition comprising 20% or more immunoglobulin suitable for subcutaneous use is also described. | 12-30-2010 |
20100330072 | Myostatin binding agents - The present invention provides binding agents comprising peptides capable of binding myostatin and inhibiting its activity. In one embodiment the binding agent comprises at least one myostatin-binding peptide attached directly or indirectly to at least one vehicle such as a polymer or an Fc domain. The binding agents of the present invention produced increased lean muscle mass when administered to animals and decreased fat to muscle ratios. Therapeutic compositions containing the binding agents of the present invention are useful for treating muscle-wasting disorders and metabolic disorders including diabetes and obesity. | 12-30-2010 |
20100330073 | METHODS OF TREATMENT USING ANTIBODIES TO NEUTROKINE-ALPHA - The present invention relates to a novel Neutrokine-alpha, and a splice variant thereof designated Neutrokine-alphaSV, polynucleotides and polypeptides which are members of the TNF family. In particular, isolated nucleic acid molecules are provided encoding the human Neutrokine-alpha and/or Neutrokine-alphaSV polypeptides, including soluble forms of the extracellular domain. Neutrokine-alpha and/or Neutrokine-alphaSV polypeptides are also provided as are vectors, host cells and recombinant methods for producing the same. The invention further relates to screening methods for identifying agonists and antagonists of Neutrokine-alpha and/or Neutrokine-alphaSV activity. Also provided are diagnostic methods for detecting immune system-related disorders and therapeutic methods for treating immune system-related disorders. | 12-30-2010 |
20100330074 | USE OF SACCHARIDES CROSS-REACTIVE WITH BACILLUS ANTHRACIS SPORE GLYCOPROTEIN AS A VACCINE AGAINST ANTHRAX - Provided are immunogenic compositions and methods for eliciting an immune response against | 12-30-2010 |
20110002912 | COMPOSITION - The present invention relates to a composition for improving stem cell integration. The present invention also relates to a method of improving stem cell integration and kits for improving stem cell integration. | 01-06-2011 |
20110002913 | USE OF INTERLEUKIN-4 ANTAGONISTS AND COMPOSITIONS THEREOF - Methods for treating medical conditions induced by interleukin-4 involve administering an IL-4 antagonist to a patient afflicted with such a condition. Suitable IL-4 antagonists include, but are not limited to, IL-4 receptors (such as a soluble human IL-4 receptor), antibodies that bind IL-4, antibodies that bind IL-4R, IL-4 muteins that bind to IL-4R but do not induce a biological response, molecules that inhibit IL-4-induced signal transduction, and other compounds that inhibit a biological effect that results from the binding of IL-4 to a cell surface IL-4R. Particular antibodies provided herein include human monoclonal antibodies generated by procedures involving immunization of transgenic mice. Such human antibodies may be raised against human IL-4 receptor. Certain of the antibodies inhibit both IL-4-induced and IL-13-induced biological activities. | 01-06-2011 |
20110002914 | HYBRID TETNUS TOXOID PROTEINS THAT MIGRATE RETROGRADELY AND TRANSYNAPTICALLY INTO THE CNS - The non-toxic proteolytic C fragment of tetanus toxin (TTC peptide) has the same ability to bind nerve cells and be retrogradely transported through a synapse as the native toxin. A hybrid protein encoded by the LacZ-TTC gene fusion retains the biological functions of both proteins in vivo, i.e. retrograde transynaptic transport of the TTC fragment and βgal enzymatic activity. After intramuscular injection, enzymatic activity can be detected in motoneurons and connected neurons of brainstem areas. This strategy is useful for the delivery of a biological activity to neurons from the periphery to the central nervous system. Such a hybrid protein can also be used to map synaptic connections between neural cells. | 01-06-2011 |
20110002915 | RANDOM AND NON-RANDOM ALKYLENE OXIDE POLYMER ALLOY COMPOSITIONS - A polymeric material comprised of (i) at least one random copolymer comprised of ethylene oxide and one or more other alkylene oxide(s) and (ii) at least one non-random polymer comprised of one or more poly(alkylene oxide)s has been discovered. Preferably, it is a polymer alloy. Alkylene oxide homopolymers or block copolymers may be the non-random polymer. In a related discovery, an adhesive material can be made by suspending (a) particles in (b) a matrix of at least one poly(ethylene oxide) copolymer of ethylene oxide and propylene oxide, or a combination thereof. The handling characteristics may be adjusted for different utilities (e.g., from runny oil to hard wax). Applications include use as adhesive, cohesive, filler, lubricant, surfactant, or any combination thereof. In particular, the hard materials may be used for cleaning or waxing. | 01-06-2011 |
20110008318 | TOLL-LIKE RECEPTOR 5 LIGANDS AND METHODS OF USE - The invention provides an immunomodulatory flagellin peptide having at least about 10 amino acids of substantially the amino acid sequence GAVQNRFNSAIT, or a modification thereof, and having toll-like receptor 5 (TLR5) binding. Methods of inducing an immune response are also provided. | 01-13-2011 |
20110008319 | CARD DOMAIN CONTAINING POLYPEPTIDES, ENCODING NUCLEIC ACIDS, AND METHODS OF USE - The invention provides caspase recruitment domain (CARD)-containing polypeptides, CARD, NB-ARC, ANGIO-R, LRR and SAM domains therefrom, as well as encoding nucleic acid molecules and specific antibodies. The invention also provides related screening, diagnostic and therapeutic methods. | 01-13-2011 |
20110008320 | Further Use of Protein Kinase N Beta - The present invention is related to use of protein kinase N beta or a fragment or derivative thereof as a downstream target of the PI 3-kinase pathway, preferably as a downstream drug target of the PI 3-kinase pathway. | 01-13-2011 |
20110008321 | Vectors, Host Cells, and Methods of Production and Uses - Antibody expression vectors and plasmids can incorporate various antibody gene portions for transcription of the antibody DNA and expression of the antibody in an appropriate host cell. The expression vectors and plasmids have restriction enzyme sites that facilitate ligation of antibody-encoding DNA into the vectors. The vectors incorporate enhancer and promoter sequences that can be varied to interact with transcription factors in the host cell and thereby control transcription of the antibody-encoding DNA. A kit can incorporate these vectors and plasmids. | 01-13-2011 |
20110008322 | ANTI-C35 ANTIBODY COMBINATION THERAPIES AND METHODS - The present invention is directed to methods of killing cancer cells, the methods comprising administering at least one C35 antibody and either at least one HER2 or at least one EGFR antibody. In some embodiments, the antibodies are administered with a therapeutic agent. The present invention is further directed to C35, HER2 and EGFR antibodies useful in these methods. | 01-13-2011 |
20110008323 | Cadherin-11 EC1 Domain Antagonists for Treating Inflammatory Joint Disorders - The present invention relates to Cadherin-11 antagonists and compositions comprising Cadherin-11 antagonists. The invention also relates to methods for treating inflammatory joint disorders, such as rheumaotid arthritis, in a mammalian subject by administering a therapeutically effective amount of a Cadherin-11 antagonist. | 01-13-2011 |
20110008324 | Antibody Selective for a Tumor Necrosis Factor-Related Apoptosis-Inducing Ligand Receptor and Uses Thereof - An antibody of the invention interacts with human DR5 to produce agonistic or antagonistic effects downstream of the receptor including inhibition of cell proliferation and apoptosis. Nucleic acid sequences and amino acid sequences of anti-DR5 antibodies have been elucidated and vectors and cells containing and expressing these sequences have been generated. Methods and uses for the antibodies are detailed including treatment of apoptosis-related disease and treatment of dysregulated cell growth. | 01-13-2011 |
20110014180 | Preparations for tissue restoration containing atrial diuretic hormone and family molecules as active ingredients; method of restoring tissue using the preparation; agents for growing, restoring, promoting growth of hair and agents for promoting restoration of skin tissue and cardiac muscle tissue containing atrial diuretic hormone family molecules as active ingredients; method of growing, restoring, promoting growth of hair by using the agents; and method of promoting restoration of skin tissue and cardiac muscle tissue | 01-20-2011 |
20110014181 | Microneedle Delivery Device and Methods of Using Same - Described herein are microneedle bioactive agent delivery systems, associated apparatus and methods of using such. The microneedles described herein are deliverable using a needle or syringe apparatus that can interface with existing medical devices or the devices can be used as standalone systems. The systems deliver at least one bioactive agent to a tissue in need thereof, for example, the myocardium. | 01-20-2011 |
20110014182 | ANTIGEN BINDING PROTEINS - Antigen binding proteins that bind β-amyloid peptide, in particular human β-amyloid peptide; methods of treating diseases or disorders characterised by elevated β-amyloid levels or β-amyloid deposits, particularly Alzheimer's disease and diseases or disorders affecting the eye or optic nerve characterised by elevated β-amyloid levels or β-amyloid deposits, including age related macular degeneration and glaucoma type diseases and β-amyloid dependent cataract formation, with said antigen binding proteins; pharmaceutical compositions comprising said antigen binding proteins; and methods of manufacture. | 01-20-2011 |
20110014183 | MCAM MODULATION AND USES THEREOF - Methods, uses, agents and compositions useful for the diagnosis, prevention and/or treatment of inflammatory conditions, such as neuroinflammatory conditions such as multiple sclerosis, and for the identification and selection of inflammatory cytokine-secreting T cell or a precursor thereof, based on the expression and/or modulation of melanoma cell adhesion molecule (MCAM) are disclosed. | 01-20-2011 |
20110014184 | INACTIVATING ORGANISMS USING CARBON DIOXIDE AT OR NEAR ITS SUPERCRITICAL PRESSURE AND TEMPERATURE CONDITIONS - Whole organisms are inactivated by at least a factor of 10 | 01-20-2011 |
20110014185 | METHODS INVOLVING GRAF POLYPEPTIDES - The invention relates to a method of identifying a modulator of clathrin-independent endocytosis, said method comprising
| 01-20-2011 |
20110014186 | ARYLSULFONAMIDE-BASED MATRIX METALLOPROTEASE INHIBITORS - The present invention provides a compound of formula (I): | 01-20-2011 |
20110020317 | BREAST TUMOUR GRADING - We describe a method of assigning a grade to a breast tumour, which grade is indicative of the aggressiveness of the tumour, the method comprising detecting the expression of a gene selected from the genes set out in Table D1 (SWS Classifier 0). | 01-27-2011 |
20110020318 | Inhibitors of the Interaction Between HMGB Polypeptides and Toll-Like Receptor 2 as Anti-Inflammatory Agents - The invention features a method of treating an inflammatory condition in an individual, comprising administering an agent inhibits the interaction between a Toll-like receptor 2 (TLR2) and a high mobility group B (HMGB) polypeptide to the individual. The invention also features methods for identifying agents that inhibit the interaction between TLR2 and HMGB. | 01-27-2011 |
20110020319 | USE OF ANTI- SPHINGOSINE-1-PHOSPHATE ANTIBODIES IN COMBINATION WITH CHEMOTHERAPEUTIC AGENTS - The present invention relates to use of anti-S1P antibodies in combination with chemotherapeutic agents for treatment and/or prevention of cancer, tumor growth, metastasis and/or growth of metastatic tumors. | 01-27-2011 |
20110020320 | Genetic Variants Contributing to Risk of Prostate Cancer - It has been discovered that certain genetic markers are associated with risk of prostate cancer. The invention describes diagnostic applications for determining a susceptibilty to prostate cancer using such markers, including methods, uses, kits, and computer applications. | 01-27-2011 |
20110020321 | METHODS AND COMPOSITIONS FOR USING MHC CLASS II INVARIANT CHAIN POLYPEPTIDE AS A RECEPTOR FOR MACROPHAGE MIGRATION INHIBITORY FACTOR - Methods and compositions for using the MHC class II invariant chain polypeptide, Ii (also known as CD74), as a receptor for macrophage migration inhibitory factor (MIF), are disclosed. These include methods and compositions for using this receptor, as well as agonists and antagonists of MIF which bind to this receptor, or which otherwise modulate the interaction of MIF with CD74 or the consequences of such interaction, in treatment of conditions characterized by locally or systemically altered MIF levels, particularly inflammatory conditions and cancer. | 01-27-2011 |
20110020322 | CRYSTALLIZATION OF ANTI-CD20 ANTIBODIES - The present invention relates generally to crystalline forms of anti-CD20 antibodies and purification of anti-CD20 antibodies involving crystallization. | 01-27-2011 |
20110020323 | GRAM-POSITIVE BACTERIA SPECIFIC BINDING COMPOUNDS - The present invention provides improved binding compounds capable of specifically binding Gram-positive bacteria. Binding compounds are provided that are fully human, enabling therapeutic applications in human individuals. | 01-27-2011 |
20110020324 | COMPOUND CAPABLE OF BINDING S1P RECEPTOR AND PHARMACEUTICAL USE THEREOF - A compound having an ability to bind to an S1P receptor (particularly EDG-6, preferably EDG-1 and EDG-6), for example, the compound represented by formula (I) of the present invention, a salt thereof, a solvate thereof or a prodrug thereof is useful for prevention and/or treatment of rejection of transplantation, graft-versus-host disease, autoimmune disease, allergic disease and the like. | 01-27-2011 |
20110020325 | METHODS FOR REDUCING GRANULOMATOUS INFLAMMATION - This document provides methods and materials for reducing bacterial induced granulomatous inflammation in a mammal using agents that reduce B7-H1 expression or activity. | 01-27-2011 |
20110020326 | METHOD OF TREATING POLYCYSTIC KIDNEY DISEASE - The present invention is directed toward methods for treating, inhibiting the progression of or eradicating polycystic kidney disease in a mammal in need thereof by providing a cMET inhibitor. | 01-27-2011 |
20110027260 | BCL-G POLYPEPTIDES, ENCODING NUCLEIC ACIDS AND METHODS OF USE - The invention provides Bcl-G polypeptides and encoding nucleic acids. Bcl-G polypeptides include Bcl-G | 02-03-2011 |
20110027261 | ANTI-HEPCIDIN ANTIBODIES AND USES THEREOF - Monoclonal antibodies are provided that selectively bind human hepcidin-25 and are characterized as having high affinity for human hepcidin-25 and strong human mature hepcidin neutralizing properties. The antibodies of the invention are useful therapeutically for increasing serum iron levels, reticulocyte count, red blood cell count, hemoglobin, and/or hematocrit in a human and for the treatment and diagnosis of mature hepcidin-promoted disorders such as anemia, in a human subject. | 02-03-2011 |
20110027262 | PLATFORM ANTIBODY COMPOSITIONS - The present invention provides novel compositions of human IgG | 02-03-2011 |
20110027263 | SOLUBLE INTERLEUKIN-20 RECEPTOR - A soluble receptor to IL-20 having two polypeptide subunits, IL-20RA (formerly called ZcytoR7) and IL-20RB (formerly called DIRS1). The two subunits are preferably linked together. In one embodiment one subunit is fused to the constant region of the light chain of an immunoglobulin, and the other subunit is fused to the constant region of the heavy chain of the immunoglobulin. The light chain and the heavy chain are connected via a disulfide bond. | 02-03-2011 |
20110027264 | GAMMA SECRETASE MODULATORS FOR THE TREATMENT OF ALZHEIMER'S DISEASE - This invention provides novel compounds that are modulators of gamma secretase. The compounds have the formula: Also disclosed are methods of modulating gamma secretase activity and methods of treating Alzheimer's disease using the compounds of formula (I). | 02-03-2011 |
20110033441 | PYRIMIDINE DERIVATIVES FOR THE TREATMENT OF ABNORMAL CELL GROWTH - The present invention relates to salts, solvates and substoichiometric solvates of N-[3-[[[2-[(2,3-dihydro-2-oxo-1H-indo1-5-yl)amino]-5-(trifluoromethyl)-4-pyrimidinyl]amino]methyl]-2-pyridinyl]-N-methylmethanesulfonamide. The invention also provides pharmaceutical compositions comprising such complexes, as well as methods of treating abnormal cell growth by administering the complexes of the invention. | 02-10-2011 |
20110033442 | TARGETS, INCLUDING YAP1, FOR ANTIFUNGAL DRUG DISCOVERY AND THERAPY - The present invention is based on the discovery of a two organism model system that can be used to identify virulence factors. The system is also useful in the process of drug delivery. More specifically, we have established valid fungal infection in | 02-10-2011 |
20110033443 | Method for Increasing Bone Mass - The present invention features methods for promoting the differentiation of osteoblast bone forming cells to a mineralization phenotype and increasing bone mass using inhibitors of Brahma. Subjects benefiting from such treatment may have non-union fractures, osteopenia or osteoporosis, osteosarcoma, or a bone graft or bone fusion or orthopedic and dental implants, osteolytic bone disease, skeletal defects or deficiencies or periodontal disease. | 02-10-2011 |
20110033444 | Genetic variants in a hypertension susceptibility gene Stk39 and uses thereof - The present invention is drawn to diagnosis and treatment of essential hypertension. In this regard, the present invention discloses genetic variants in a hypertension susceptibility gene Stk39 and its use in the diagnosis and treatment of essential hypertension. | 02-10-2011 |
20110038849 | INHIBITORY POLYNUCLEOTIDE COMPOSITIONS AND METHODS FOR TREATING CANCER - Compositions and methods for treating diseases, such as cancers. The compositions are effective to silence, down-regulate or suppress the expression of a validated target gene by stimulating the process of RNA interference of gene expression, thus inhibiting tumor growth. The invention also provides methods for treating diseases, such as cancers, by inactivation of a validated target gene product, using neutralizing antibody or small molecule drug, to inhibit tumor growth. More particularly, the compositions and methods are directed toward a cancer or a precancerous growth in a mammal, associated with pathological expression of a certain target genes identified herein. The compositions inhibit expression of the target gene when introduced into a tissue of the mammal. The methods include administering the compositions of the invention to a subject in need thereof in an amount effective to inhibit expression of a target gene in a cancerous tissue or organ. | 02-17-2011 |
20110038850 | G Protein-Coupled Receptor and Modulators Thereof For The Treatment of Gaba-Related Neurological Disorders Including Sleep-Related Disorders - The present invention relates to methods of using BRS-3 to screen candidate compounds as compounds suitable for the treatment of sleep-related disorders. Inverse agonists and antagonists of the invention are useful as therapeutic agents for promoting sleep and for preventing or treating sleep disorders ameliorated by promoting sleep, such as insomnia and the like. Agonists and partial agonists of the invention are useful as therapeutic agents for promoting wakefulness and for preventing or treating excessive sleepiness, such as excessive sleepiness associated with narcolepsy and the like. The invention further relates to methods of using a BRS-3 to screen candidate compounds as pharmaceutical agents for a GABA-related neurological disorder such as a sleep disorder, an anxiety disorder, a convulsive disorder, migraine, a depressive disorder, a psychotic disorder, or a cognitive disorder. Compounds of the invention encompass compounds having sleep-promoting, wakefulness-promoting, anxiolytic, anticonvulsant, antidepressant, antipsychotic, and cognition-enhancing activities. | 02-17-2011 |
20110038851 | TREATMENT OF SYNUCLEINOPATHIES - This invention relates generally to treating synucleinopathies in subjects that are not clinically diagnosed with a lysosomal storage disease, as well as associated methods of making medicaments and screening methods. | 02-17-2011 |
20110038852 | ANTIVIRALS THAT TARGET TRANSPORTERS, CARRIERS, AND ION CHANNELS - This invention provides methods for preventing or treating infection by viruses, in particular an influenza virus by modulating transporters, carriers, and ion channels. Methods to identify, validate, and classify the cellular proteins required by viruses during infection of host cells in order to select agents which can inhibit viral infection are described herein. The method employs a siRNA screening platform and uses gene silencing to map the ‘viral infectome’—a compilation of cellular proteins that the virus needs to establish infection and drive the infectious cycle. Charting the infectome provides information on the viral biology by the identification of host cell proteins involved in viral infection and allows the development of novel anti-viral drugs that prevent the viruses from establishing productive infection in cells. | 02-17-2011 |
20110038853 | Use of Kif13A and AP-1 Inhibitors for Inhibiting Melanogenesis - The present invention relates to novel pharmaceutical or cosmetic compositions comprising at least one inhibitor of a sub-unit of AP-1 adaptor complex, of a kinesin interacting with AP-1, in particular Kif13A, or of the interaction between a sub-unit of AP-1 adaptor complex and said kinesin, as well as the use of same to manufacture a drug intended for the treatment of pigmentary disorders and as a depigmentation agent. | 02-17-2011 |
20110044973 | TREATMENT OF CYSTIC DISEASE WITH LYSOPHOSPHATIDIC ACID ANTAGONISTS - A method for treating cystic diseases is disclosed herein. The method comprises administering lysophosphatidic acid receptor antagonists. | 02-24-2011 |
20110052563 | GONADAL FUNCTION IMPROVING AGENTS - Metastin, compounds that promote the activity of metastin or its receptors and the like are excellent gonadal function improving agents, ovulation inducers or promoters, gonadotropic hormone secretion promoters, gonadotropic hormone secretion inhibitors, sex hormone secretion promoters, sex hormone secretion inhibitors, etc., and can be used as agents for preventing/treating sterility, hormone-sensitive cancers, endometriosis, etc. Metastin and its receptors are useful for screening for these pharmaceuticals. | 03-03-2011 |
20110052564 | ENHANCEMENT OF IMMUNOGENICITY OF ANTIGENS - The invention provides means and methods for producing and/or selecting immunogenic compositions, comprising providing said composition with at least one crossbeta structure and testing at least one immunogenic property. | 03-03-2011 |
20110052565 | NON-AGGREGATING HUMAN VH DOMAINS - The present invention relates to non-aggregating VH domains or libraries thereof. The V | 03-03-2011 |
20110052566 | COGNITIVE FUNCTION - Inhibition of eIF-2α phosphorylation can be used to improve cognitive function and/or to treat dementia, including Alzheimer's Disease. In particular, this can be achieved by inhibiting the kinase activity of PKR in a non-toxic manner. | 03-03-2011 |
20110052567 | Methods Compositions, Uses, and Kits Useful for Vitamin D Deficiency and Related Disorders - Methods for diagnosing, treating, and preventing catabolism-related vitamin D deficiency and related disorders; related compositions, apparatus and kits, are disclosed. A method involves measuring CYP24 expression and/or activity, or a proxy thereof such as FGF23 level, in a patient and correlating abnormally elevated CYP24 expression and/or activity with catabolism-related vitamin D deficiency or with susceptibility for catabolism-related vitamin D deficiency. In response to abnormally elevated CYP24 expression and/or activity, the method further includes administering a CYP24 inhibitor to the vitamin D deficient or at-risk patient, and preferably avoiding activation of the vitamin D binding receptor, such as by avoiding administration of active vitamin D compounds to such patients. Optionally, a vitamin D prohormone or prohormone can be administered. | 03-03-2011 |
20110052568 | TABLET COMPRISING NATURAL ALLICIN AND METHOD FOR PRODUCING THE SAME - A tablet including 1,000 weight parts of 21-90% natural allicin powder, 10-30 weight parts of 50-95% sesamin, 10-30 weight parts of 50-95% IgY or IgG, and a release agent. The allicin content of the tablet is 200-800 mg/g. The allicin tablet has high allicin content and capability of anti-bacteria and anti-inflammation, and can be administered based on the body weight of an animal in need thereof but causes no side effects. A method for producing the allicin tablet by mixing and uniformly stirring starch, garlic powder, and natural allicin powder to yield a mixture, adding the natural sesamin, Ig Y or Ig G, and magnesium stearate to the mixture, uniformly stirring, and tabletting. | 03-03-2011 |
20110059063 | Antigen binding proteins that bind PAR-2 - The present invention provides compositions and methods relating to or derived from anti-PAR-2 antibodies. In particular embodiments, the invention provides human antibodies that bind PAR-2, PAR-2-binding fragments and derivatives of such antibodies, and PAR-2-binding polypeptides comprising such fragments. Other embodiments provide nucleic acids encoding such antibodies, antibody fragments and derivatives and polypeptides, cells comprising such polynucleotides, methods of making such antibodies, antibody fragments and derivatives and polypeptides, and methods of using such antibodies, antibody fragments and derivatives and polypeptides, including methods of treating or diagnosing subjects having PAR-2-related disorders or conditions. | 03-10-2011 |
20110059064 | Vm23 and Vm24, two scorpion peptides that block human T-lymphocyte potassium channels (sub-type Kv1.3) w/High Selectivity and Decrease the in vivo DTH-responses in Rats - Potassium channels Kv1.3 are known to be implicated in immunological diseases and graft rejections. Disclosed are peptides capable of blocking with high affinity and specificity potassium channels Kv1.3, their pharmaceutical compositions, and methods for their use to block Kv1.3 potassium channels, to treat various immunological conditions and to diagnostic applications. Methods for their chemical synthesis and correct folding are also disclosed. Exemplary peptides correspond to protein components (Vm23 and Vm24) isolated from the venom of the Mexican scorpion | 03-10-2011 |
20110059065 | FUNCTION AND REGULATION OF ADAMTS-1 - The present invention relates to ADAMTS-1 and uses thereof. The present invention also relates to fragments of ADAMTS-1 and methods of inhibiting cell growth and metastasis. The present invention also provide methods of identifying inhibitors and activators relating to the function of ADAMTS-1. | 03-10-2011 |
20110059066 | PAKs as Modifiers of the CHK Pathway and Methods of Use - Human PAK genes are identified as modulators of the CHK pathway, and thus are therapeutic targets for disorders associated with defective CHK function. Methods for identifying modulators of CHK, comprising screening for agents that modulate the activity of PAK are provided. | 03-10-2011 |
20110059067 | MODULATION OF OLIGONUCLEOTIDE CPG-MEDIATED IMMUNE STIMULATION BY POSITIONAL MODIFICATION OF NUCLEOSIDES - The invention provides methods for modulating the immune response caused by CpG dinucleotide-containing compounds. The methods according to the invention enables both decreasing the immunostimulatory effect for antisense applications, as well as increasing the immunostimulatory effect for immunotherapy applications. | 03-10-2011 |
20110064721 | CATHEPSIN-D NEUROPROTECTION - Provided herein are methods and compositions for promoting neuroprotection in a subject and for treating a neural disorder associated with protein aggregation comprising administering to the subject an agent that increases expression or activity of cathepsin-D. Also provided are methods of screening for agents that increase expression or activity of cathepsin-D and methods of screening for neuroprotective agents. | 03-17-2011 |
20110064722 | MODULATORS OF ALPHA-SYNUCLEIN TOXICITY - Disclosed are genes that, when overexpressed in cells expressing alpha-synuclein, either suppress or enhance alpha-synuclein mediated cellular toxicity. Compounds that modulate expression of these genes or activity of the encoded proteins can be used to inhibit alpha-synuclein mediated toxicity and used to treat or prevent synucleinopathies such as Parkinson's disease. Also disclosed are methods of identifying inhibitors of alpha-synuclein mediated toxicity. | 03-17-2011 |
20110064723 | Formulation for room temperature stabilization of a live attenuated bacterial vaccine - This invention provides methods and compositions for stabilizing proteins and vaccines in dried formulations. In particular, a cavitation method and compositions of preparing a dried vaccine are provided that stabilize the viability of live bacteria and live virus vaccines at room temperature. | 03-17-2011 |
20110064724 | Methods for Identifying Compounds for the Treatment of Type 1 Diabetes - The present invention provides methods of identifying candidate compounds for the treatment of type I diabetes comprising contacting pancreatic β cells with an amount of apolipoprotein CIII (“apoCIII”) effective to increase intracellular calcium concentration, in the presence of one or more test compounds, and identifying those test compounds that inhibit an apoCIII-induced increase in intracellular calcium concentration in the pancreatic β cells. The present invention also provides methods for treating patients with type I diabetes comprising administering to the patient an amount effective of an inhibitor of apoCIII to reduce apoCIII-induced increase in intracellular calcium concentration in pancreatic β cells. | 03-17-2011 |
20110070221 | GNAQ MUTATIONS IN MELANOMA - The present invention provides methods of detecting mutations in a Gnaq gene in a melanocytic neoplasm for diagnostic and prognostic purposes. The invention further provides methods of treating such melanocytic neoplasm by modulating the activity of the mutated Gnaq gene. | 03-24-2011 |
20110070222 | Therapeutic Modulation of Ocular Surface Lubrication - Provided herein are ophthalmically acceptable pharmaceutical compositions comprising a PRG4 inducing compound in combination with PRG4 (including a lubricant fragments, homologs, or isoforms thereof), and methods of using the same. The PRG4 inducing compound in the pharmaceutical composition of the present invention upregulates PRG4 expression and localization in the ocular surface for efficient surface boundary lubrication. In some instances, pharmaceutical compositions described herein are utilized for treating ophthalmic conditions, e.g., ocular boundary deficiency and symptoms associated therewith. | 03-24-2011 |
20110070223 | Uses of Lp-PLA2 in combination to assess coronary risk - This invention relates to a method for assessing risk of Coronary Vascular Disease (CVD). Specifically, it relates to utilizing risk assessment from both Lipoprotein Associated Phospholipase A2 (Lp-PLA2) and C-reactive protein (CRP) in combination. In addition the invention relates to a method for assessing risk of Coronary Vascular Disease (CVD) in a patient with low to normal Low Density Lipoprotein Cholesterol (LDL) levels utilizing both LDL and Lipoprotein Associated Phospholipase A2 (Lp-PLA2). Moreover, the invention relates to the use of risk associated with Lp-PLA2, CRP and LDL in combination and specific ranges thereof to predict Coronary Vascular Disease. | 03-24-2011 |
20110070224 | METHODS COMPOSITIONS AND DEVICES UTILIZING STINGING CELLS/CAPSULES FOR DELIVERING A THERAPEUTIC OR A COSMETIC AGENT INTO A TISSUE - A delivery device including at least one stinging capsule and methods of use are described. | 03-24-2011 |
20110076262 | HUMANIZED ANTI-FGF19 ANTAGONISTS AND METHODS USING SAME - The present invention concerns antagonists of the FGF19/FGFR4 pathways, and the uses of same. | 03-31-2011 |
20110076263 | Endoglin Antibodies - The present application relates to compositions of humanized and humanized/deimmunized anti-endoglin antibodies and antigen-binding fragments thereof. One aspect relates to antibodies having one or more modifications in at least one amino acid residue of at least one of the framework regions of the variable heavy chain, the variable light chain or both. Another aspect relates to antibodies which bind endoglin and inhibit angiogenesis. Another aspect relates to the deimmunization of humanized antibodies to reduce immunogenicity. Another aspect relates to the use of humanized and humanized/deimmunized antibodies which bind endoglin for the detection, diagnosis or treatment of a disease or condition associated with endoglin, angiogenesis or a combination thereof. | 03-31-2011 |
20110081337 | FUNCTION OF GPR4 IN VASCULAR INFLAMMATORY RESPONSE TO ACIDOSIS AND RELATED METHODS - The present invention relates to methods for the treatment of inflammation. Specifically, disclosed herein are methods to inhibit vascular inflammatory responses by inhibiting the proton-sensing GPR4 receptor. Such methods can be utilized, most preferably, in pharmaceutical compositions to modulate inflammation in acidosis-related diseases. | 04-07-2011 |
20110086019 | POLYPEPTIDES, ANTIBODY VARIABLE DOMAINS AND ANTAGONISTSMETHODS FOR - The invention relates to anti-TNFR1 polypeptides and antibody single variable domains (dAbs) that are resistant to degradation by a protease, as well as antagonists comprising these. The polypeptides, dAbs and antagonists are useful for as therapeutics and/or prophylactics that are likely to encounter proteases when administered to a patient, for example for pulmonary administration, oral administration, delivery to the lung and delivery to the GI tract of a patient, as well as for treating inflammatory disease, such as arthritis or COPD. | 04-14-2011 |
20110086020 | Agent exhibiting immunoregulatory properties and the use thereof for treating autoimmune diseases - The invention relates to medicine. The inventive agent which exhibits immunoregulatory properties and accelerated clinical performance at a recrudescence stage and is mainly used for treating autoimmune diseases comprises trophoblastic β-1-glycoprotein and immunoglobulin (Ig) which is embodied in the form of a multivalent ligand G (Ig-G) or A (Ig-A) or M (Ig-M) immunoglobulin. According to the second invention, an agent for treating autoimmune diseases comprises β-1-glycoprotein and immunoglobulin (Ig-G), wherein the multivalent ligand G or A (Ig-A) is used in the form of an immunoglobulin and the β-1-glycoprotein and immunoglobulin (Ig-G) are taken in equal portions on in portions whose ratio is equal to 1:19, respectively. For treating autoimmune diseases, the agent containing β-1-glycoprotein and immunoglobulin (Ig) is parenterally administratable. | 04-14-2011 |
20110086021 | Sclerostin and the inhibition of WNT signaling and bone formation - The loss of the SOST gene product sclerostin leads to sclerosteosis characterized by high bone mass (HBM). In this report, we found that sclerostin could antagonize canonical Wnt signaling in human embryonic kidney A293 cells and mouse osteoblastic MC3T3 cells. This sclerostin-mediated antagonism could be reversed by over-expression of Wnt coreceptor LRP5. In addition, we found that sclerostin bound to LRP5 as well as LRP6 and identified the first two YWTD-EGF repeat domains of LRP5 as being responsible for the binding. Although these two repeat domains are required for transducing canonical Wnt signals, canonical Wnt did not appear to compete with sclerostin for binding to LRP5. Examination of the expression of sclerostin and Wnt7b, an autocrine canonical Wnt, during primary calvarial osteoblast differentiation revealed that sclerostin is expressed at the late stages of osteoblast differentiation coinciding with the expression of osteogenic marker osteocalcin and trailing after the expression of Wnt7b. Given the plethora of evidence indicating that canonical Wnt signaling stimulates osteogenesis, we believe that the HBM phenotype associated with the loss of sclerostin may at least in part be attributed to an increase in canonical Wnt signaling resulting from the reduction in sclerostin-mediated Wnt antagonism. | 04-14-2011 |
20110086022 | Methods for diagnosing and treating neuroendocrine cancer - The present invention relates to a method for diagnosing neuroendocrine cancers via detecting the presence of N-methyl D-asparate-associated (NMDA) glutamate receptors type 1 and/or type 2. Methods for preventing and treating neuroendocrine cancers are also disclosed. | 04-14-2011 |
20110091444 | Methods and compositions for treatment and prevention of major depressive disorder - The present invention relates to methods of diagnosing, prognosing or treating diseases or disorders in which elevated levels of Abeta protein, including abeta | 04-21-2011 |
20110091445 | MODULATION OF INTESTINAL FLORA OF HIV PATIENTS - The present invention is in the field of nutrition for HIV-infected subjects and concerns methods and composition comprising dietary fiber for the normalization of the intestinal flora of HIV-infected subjects. | 04-21-2011 |
20110091446 | SINGLE DOMAIN ANTIBODIES CAPABLE OF MODULATING BACE ACTIVITY - The present invention relates to single domain antibodies with a specificity for BACE1. More specifically, the invention provides single variable domain antibodies derived from camelids which bind to BACE1 and are capable of inhibiting the activity of BACE1. Said antibodies can be used for research and medical applications. Specific applications include the use of BACE1 specific antibodies for the treatment of Alzheimer's disease. | 04-21-2011 |
20110091447 | LYMPHOCYTE CONTROL OF OBESITY AND INSULIN RESISTANCE - Methods for the treatment, inhibition, prevention, etc. of metabolic syndrome (MetSyn) and/or Type-2 diabetes (T2D) using a T cell activating antibody that stimulates activation and immunomodulation of T-cells to affect the immune environment of adipose tissue and improve insulin sensitivity. Also methods for the treatment, inhibition, prevention, amelioration, reversal, etc., of metabolic syndrome (MetSyn) and/or Type-2 diabetes (T2D) using leukemia inhibitory factor (LIF), or a functional portion thereof. Compositions administered to individuals having or at risk of developing MetSyn and/or T2D may include pharmaceutical compositions. Methods may also provide tolerogenic vaccines based on the administration of identified auto-antigens from individuals having or at risk of developing MetSyn and/or T2D. | 04-21-2011 |
20110091448 | METHODS FOR REGULATION OF STEM CELLS - Methods are provided for increasing stem cells, hematopoietic progenitor/stem cells, mesenchymal progenitor/stem cells, mesodermal progenitor/stem cells, muscle progenitor/stem cells, or neural progenitor/stem cells in vivo in a mammalian subject. Methods are also provided for treating an immune related disease, a mesenchymal/mesoderm degenerative disease, or a neurodegenerative disease in a mammalian subject in need thereof. | 04-21-2011 |
20110097317 | Thioredoxin Interacting Protein (TXNIP) As Regulator Of Vascular Function - The present invention relates to screening assays for the identification of agents that can modify the interaction of thioredoxin interacting protein (TXNEP) on thioredoxin (TRX)5 preferably by inhibiting TXNIP downregulation of TXR. The use of such compounds, including the disclosed siRNA and antibodies against TXNIP, is contemplated for therapeutic or prophylactic treatment of vascular disease conditions, particularly those associated with pro-inflammatory activity of the TNF- ASK1-JNK-p38 pathways. | 04-28-2011 |
20110097318 | Solid-State Protein Formulation - Provided are systems comprising delivery vehicles for the stable storage of immobilized proteins, e.g., protein therapeutics, in a form amenable to administration, such as by injection or infusion, in combination with an elution fluid. Also provided are proteins adsorbed to chromatography media in a form compatible with a one-step administration of the protein. Exemplary delivery vehicles are pre-filled syringes and pre-filled infusion modules; exemplary proteins are antibodies useful in therapy. Also provided are methods of producing the immobilized proteins and methods of using the immobilized proteins, e.g., protein therapeutics. | 04-28-2011 |
20110097319 | Antibody Capable of Binding Specifically to AB-Oligomer, and Use Thereof - The present inventors successfully produced monoclonal antibodies that are specific to only soluble Aβ oligomers, but do not recognize soluble Aβ monomers, which are physiological molecules. It was demonstrated that the antibodies are useful as diagnostic/therapeutic monoclonal antibodies for Alzheimer's disease. | 04-28-2011 |
20110104143 | Treating Basal-Like Genotype Cancers - Provided herein are methods of treating a subject with cancer comprising administering to the subject a death receptor agonist. Also provided herein are methods of screening a breast cancer cell for responsiveness to a DR5 agonist. Further provided herein are antibodies that selectively bind an N-terminal CARD of DDX3, a DDX3 lacking an N-terminal CARD, and an 80 kDa baculovirus TAP repeat (BIR). | 05-05-2011 |
20110104144 | METHODS FOR TREATING CUTANEOUS LUPUS USING AMINOISOINDOLINE COMPOUNDS - Methods of treating cutaneous lupus in a human are disclosed. Specific methods encompass the administration of (+)-2-[1-(3-ethoxy-4-methoxyphenyl)-2-methylsulfonylethyl]-4-acetylaminoisoindoline-1,3-dione, 4-(amino)-2-(2,6-dioxo(3-piperidyl))-isoindoline-1,3-dione (ACTIMID™), 3-(4-amino-1-oxo-1,3-dihydro-isoindol-2-yl)-piperidine-2,6-dione (REVLIMID®), or cyclopropyl 2-[(1S)-1-(3-ethoxy-4-methoxyphenyl)-2-(methylsulfonyl)ethyl]-3-oxoisoindolin-4-yl}carboxamide, alone or alternatively, in combination with a second active agent. | 05-05-2011 |
20110110923 | FISH ASSAY FOR EML4 AND ALK FUSION IN LUNG CANCER - Methods and compositions provided relate to conducting a FISH assay for detecting a chromosomal inversion between EML4 and ALK. The FISH assay described herein is useful for diagnostic and prognostic purposes, as well as for determination of therapeutic strategies. | 05-12-2011 |
20110110924 | Resistin as a Marker and Therapeutic Target for Cardiovascular Disease - The risk or progression of cardiovascular disease and coronary artery disease is assessed in a mammalian subject by measuring the level or concentration of circulating serum resistin in a subject and comparing the measured level to resistin levels within a standardized or standard population. Methods of treating cardiovascular diseases and/or inflammatory disorders involve administering to a patient a composition that can reduce the circulating levels of resistin. | 05-12-2011 |
20110110925 | Compositions and Methods for the Treatment and Diagnosis of Cancer - Compositions and methods for the diagnosis and treatment of cancer, particularly T-ALL, are disclosed. | 05-12-2011 |
20110110926 | COMPOSITIONS AND METHODS FOR TREATING OR PREVENTING PROSTATE CANCER AND FOR DETECTING ANDROGEN RECEPTOR VARIANTS - The invention features diagnostic and therapeutic methods and compositions featuring androgen receptor variant proteins and nucleic acid molecules whose expression is increased in androgen related diseases or disorders. | 05-12-2011 |
20110110927 | THIOPHENYL-SUBSTITUTED 2-IMINO-3-METHYL PYRROLO PYRIMIDINONE COMPOUNDS AS BACE-1 INHIBITORS, COMPOSITIONS, AND THEIR USE - In its many embodiments, the present invention provides provides certain thiophenyl-substituted 2-imino-3-methyl pyrrolo pyrimidone compounds, including compounds (or tautomers or a pharmaceutically acceptable salts thereof) having the structural Formula (III): wherein R | 05-12-2011 |
20110110928 | FC VARIANTS WITH ALTERED BINDING TO FCRN - The present application relates to a variant Fc region comprising the double mutation 428L/434S that increases serum half-life and the numbering is according to the EU index. | 05-12-2011 |
20110117078 | Methods for the Treatment of Cancers - Methods for the treatment of cancers involving dysregulation of thromboxane receptor β (TP-β) are provided, including in certain aspects methods for diagnosing such cancers. Specific cancers included are genitourinary cancers, gastrointestinal cancers and leukemias. | 05-19-2011 |
20110117079 | THERAPEUTIC DLL4 BINDING PROTEINS - Improved DLL4 binding proteins are described, including antibodies, CDR-grafted antibodies, human antibodies, and DLL4 binding fragments thereof, proteins that bind DLL4 with high affinity, and DLL4 binding proteins that neutralize DLL4 activity. The DLL4 binding proteins are useful for treating or preventing cancers and tumors and especially for treating or preventing tumor angiogenesis, and/or other angiogenesis-dependent diseases such as ocular neovascularization, or angiogenesis-independent diseases characterized by aberrant DLL4 expression or activity such as autoimmune disorders including multiple sclerosis. | 05-19-2011 |
20110117080 | Anti-REG4 Antibodies - Antibodies to human REG4 are provided, as well as uses thereof, e.g., in treatment of proliferative disorders. Also provided is a method of screening for an antibody that inhibits REG4 bioactivity. | 05-19-2011 |
20110117081 | FUNCTIONALIZED PYRROLIDINES AND USE THEREOF AS IAP INHIBITORS - A compound of Formula (1) or a salt thereof, methods for the preparation and use of such a compound, especially as an IAP inhibitor, and related compounds, compositions, and methods. | 05-19-2011 |
20110123518 | Inhalant Formulation Containing Sulfoalkyl Ether Cyclodextrin and Corticosteroid - An inhalable formulation containing SAE-CD and corticosteroid is provided. The formulation is adapted for administration to a subject by nebulization with any known nebulizer. The formulation can be included in a kit. The formulation is administered as an aqueous solution; however, it can be stored as a dry powder, ready-to-use solution, or concentrated composition. The formulation is employed in an improved nebulization system for administering corticosteroid by inhalation. SAE-CD present in the formulation significantly enhances the chemical stability of budesonide. A method of administering the formulation by inhalation is provided. The formulation can also be administered by conventional nasal delivery apparatus. | 05-26-2011 |
20110123519 | RECOMBINANT ANTIGEN - Recombinant protein of the catalytic subunit of the phosphatase Serine/threonine protein of | 05-26-2011 |
20110123520 | SITE-SPECIFIC DELIVERY OF NUCLEIC ACIDS BY COMBINING TARGETING LIGANDS WITH ENDOSOMOLYTIC COMPONENTS - The invention relates to compositions and methods for site-specific delivery of nucleic acids by combining them with targeting ligands and endosomolytic components. | 05-26-2011 |
20110123521 | METHODS FOR MODULATING EXPRESSION OF RBP4 - Methods are provided for modulating RBP4 by administering a RBP4-specific modulator. Also provided are methods for treating cardiovascular and metabolic disorders in a subject or delaying or preventing risk factors thereof through the modulation of RBP4. The present invention is also directed to methods of decreasing lipid levels in a subject or for preventing or delaying the onset of a rise in lipid levels in a subject, comprising administering to said subject a RBP4-specific inhibitor. | 05-26-2011 |
20110129455 | INHIBITORS OF AKT ACTIVITY - Invented are novel pyrrole compounds, the use of such compounds as inhibitors of protein kinase B activity and in the treatment of cancer and arthritis. | 06-02-2011 |
20110135629 | EYA2S As Modifiers of the PTEN/AKT Pathway and Methods of Use - Human MPTENAKT genes are identified as modulators of the PTEN/AKT pathway, and thus are therapeutic targets for disorders associated with defective PTEN/AKT function. Methods for identifying modulators of PTEN/AKT, comprising screening for agents that modulate the activity of MPTENAKT are provided. | 06-09-2011 |
20110135630 | CHEMICAL MODIFICATION OF ANTIBODY FRAGMENTS - The present invention provides methods for expressing glycoproteins comprising a N-terminal cysteine. Methods are also provided for chemically modifying the glycoproteins comprising a N-terminal cysteine. | 06-09-2011 |
20110135631 | INHIBITION OF MACROPHAGE-STIMULATING PROTEIN RECEPTOR (RON) AND METHODS OF TREATMENT THEREOF - The invention provides antibodies or fragments thereof, including human antibodies, specific for Macrophage-Stimulating Protein Receptor (MSP-R or RON), which inhibit RON activation. Also provided are methods to inhibit RON, particularly the use of RON antibodies to treat diseases such as cancer. | 06-09-2011 |
20110135632 | METHODS FOR THE MODULATION OF ANGIOGENESIS - The present invention relates to methods and compositions of promoting or inhibiting capillary endothelial (CE) cell migration, promoting or inhibiting the formation of CE networks and promoting or inhibiting angiogenesis, and uses thereof. In particular, the present invention relates to methods and compositions for promoting capillary endothelial (CE) cell migration, promoting the formation of CE networks and promoting angiogenesis, and uses thereof for the purposes of treating angiogenesis-related disorders characterized by loss or decreased angiogenesis, such as ischemic injury and the like. One aspect of the invention related to use of at least one pro-angiogenic agent selected from at least one of an p190RhoGAP inhibitor, a TFII-I inhibitor or a GATA-2 activator for promoting the formation of CE networks and promoting angiogenesis, and uses thereof for the purposes of treating angiogenesis-related disorders characterized by loss or decreased angiogenesis. Another aspect of the invention related to use of at least one anti-angiogenic agent selected from at least one of an p190RhoGAP activator, a TFII-I activator or a GATA-2 inhibitor for inhibiting the formation of CE networks and inhibiting angiogenesis, and uses thereof for the purposes of treating angiogenesis-related disorders characterized by uncontrolled or elevated angiogenesis. | 06-09-2011 |
20110142820 | Novel Targets for Regulation of Angiogenesis - The present invention relates to the identification of polynucleotides and polypeptides having increased expression in tumor blood vessels. The invention further relates to the use of the identified polynucleotides and polypeptides, and inhibitors of the polynucleotides and polypeptides, in the regulation of angiogenesis and the diagnosis and treatment of angiogenesis-related diseases such as cancer. | 06-16-2011 |
20110142821 | ROLES FOR DUAL ENDOTHELIN-1/ANGIOTENSIN II RECEPTOR (DEAR) IN HYPERTENSION AND ANGIOGENESIS - The present application is directed to the identification of mutations and/or polymorphisms in the Dual Endothelin-1/Angiotensin II Receptor (Dear) that indicate susceptibility to, or show current affliction with, hypertension. Additionally, the present invention discloses methods for the modulation of angiogenesis via the regulation of Dear. | 06-16-2011 |
20110150859 | METHOD FOR SELECTING RESPONDERS TO BLOCKADE OF INTEGRIN RECEPTORS - The present invention relates to a method for identifying responders to a blockade of integrin receptors, as well as to a method for determining responsiveness to a treatment involving with said blockade in a patient in need of such treatment. Furthermore, the present invention relates to a kit for use in said methods. | 06-23-2011 |
20110150860 | NOVEL 25869, 25934, 26335, 50365, 21117, 38692, 46508, 16816, 16839, 49937, 49931 AND 49933 MOLECULES AND USES THEREFOR - The invention provides isolated nucleic acids molecules, designated 25869, 25934, 26335, 50365, 21117, 38692, 46508, 16816, 16839, 49937, 49931 and 49933 nucleic acid molecules. The invention also provides antisense nucleic acid molecules, recombinant expression vectors containing 25869, 25934, 26335, 50365, 21117, 38692, 46508, 16816, 16839, 49937, 49931 or 49933 nucleic acid molecules, host cells into which the expression vectors have been introduced, and nonhuman transgenic animals in which a 25869, 25934, 26335, 50365, 21117, 38692, 46508, 16816, 16839, 49937, 49931 or 49933 gene has been introduced or disrupted. The invention still further provides isolated 25869, 25934, 26335, 50365, 21117, 38692, 46508, 16816, 16839, 49937, 49931 or 49933 proteins, fusion proteins, antigenic peptides and anti-25869, 25934, 26335, 50365, 21117, 38692, 46508, 16816, 16839, 49937, 49931 or 49933 antibodies. Diagnostic and therapeutic methods utilizing compositions of the invention are also provided. | 06-23-2011 |
20110150861 | SORF CONSTRUCTS AND MULTIPLE GENE EXPRESSION - Embodiments of the invention relate to vector constructs and methods for expression of polypeptides including multimeric products such as therapeutic antibodies. Particular constructs allow for the generation of expression products from a single open reading frame (sORF). An embodiment provides an isolated or purified expression vector for generating one or more recombinant protein products comprising a single open reading frame insert; said insert comprising a signal peptide nucleic acid sequence encoding a signal peptide; a first nucleic acid sequence encoding a first polypeptide; a first intervening nucleic acid sequence encoding a first protein cleavage site, wherein said first protein cleavage site is provided by an intein segment of a Ion protease gene of | 06-23-2011 |
20110150862 | INHIBITORS OF STIM1 FOR THE TREATMENT OF CARDIOVASCULAR DISORDERS - The invention relates to inhibitors of STIM1 for the treatment and/or the prevention of cardiac disorders such as atherosclerosis, post-angioplasty restenosis, pulmonary arterial hypertension, vein-graft disease, cardiac hypertrophy, cardiac arrhythmias, valvulopathies, diastolic dysfunction, chronic heart failure, ischemic heart failure, and myocarditis. | 06-23-2011 |
20110150863 | MODULATION OF IMMUNOSTIMULATORY PROPERTIES OF OLIGONUCLEOTIDE-BASED COMPOUNDS BY UTILIZING MODIFIED IMMUNOSTIMULATORY DINUCLEOTIDES - The invention relates to the therapeutic use of oligonucleotides as immunostimulatory agents in immunotherapy applications. More particularly, the invention provides immunomers and an immunostimulatory oligonucleotides for use in methods for generating an immune response or for treating a patient in need of immunostimulation. The immunomers and an immunostimulatory oligonucleotides of the invention preferably comprise novel purines. The immunomers according to the invention further comprise at least two oligonucleotides linked at their 3′ ends, internucleoside linkages or functionalized nucleobase or sugar to a non-nucleotidic linker, at least one of the oligonucleotides being an immunomodulatory oligonucleotide and having an accessible 5′ end. | 06-23-2011 |
20110150864 | SUBSTITUTED AMINOTHIAZOLONE INDAZOLES AS ESTROGEN RELATED RECEPTOR-ALPHA MODULATORS - The present invention relates to compounds of Formula (I), | 06-23-2011 |
20110150865 | ANTIBODIES TO LYMPHOTOXIN-ALPHA - The invention provides various antibodies that bind to lymphotoxin-α, methods for making such antibodies, compositions and articles incorporating such antibodies, and their uses in treating, for example, an autoimmune disorder. The antibodies include murine, chimeric, and humanized antibodies. | 06-23-2011 |
20110158977 | Immunogenic compositions for Chlamydia trachomatis - The present invention provides variant LcrE sequences and/or combinations of variant LcrE sequences across the | 06-30-2011 |
20110158978 | ANG-2 INHIBITION TO TREAT MULTIPLE SCLEROSIS - Methods and compositions are disclosed for treating multiple sclerosis in a human subject by administering a therapeutically effective amount of an H4L4 antibody or a 2XCon4(C) peptibody. | 06-30-2011 |
20110158979 | GENETIC COMPONENT OF COMPLICATIONS IN TYPE 2 DIABETES - The invention provides with means to predict, in subjects affected by type 2 diabetes (T2D), the probability of developing complications related to the disease. The invention involves 1) use of genetic features (SNPs, STRs, or other genomic markers) together with other chromosomal features and phenotypic information to establish a patient profile specifically developed for prediction of complications of T2D 2) use of a set of SNPs allowing to discriminate between individuals according to their descent. The invention also provides with methods for characterizing and selecting, within a population of subjects with type-2 diabetes, subjects that are suited for clinical trials based on the identification of one or more genetic features. Also described are combinations and kits for carrying out the above-described methods. | 06-30-2011 |
20110158980 | METHODS TO TREAT AND SCREEN FOR AGENTS TO TREAT OBESITY - Described herein are methods for treating obesity or promoting weight loss using agents that alter pyruvate flux in an adipocyte. Methods are provided for administering an agent or combination of agents to an obese individual to alter the flux of pyruvate in an adipocyte. Also described herein is a method for modifying triglyceride storage in an adipocyte by contacting an adipocyte with an agent or combination of agents that alter pyruvate flux. | 06-30-2011 |
20110165144 | METHODS FOR TREATING RHEUMATOID ARTHRITIS - Provided are methods of treating rheumatoid arthritis by inhibiting Neuromedin U signalling. | 07-07-2011 |
20110165145 | IGF-II/IGF-IIE BINDING PROTEINS - Proteins that bind to IGF-II and/or IGF-IIE and methods of using such proteins are described. Also disclosed are new methods for treatment of cancer. Cancer is treated by administration of an IGF-II/IGF-IIE binding protein and an additional therapy such as a growth hormone/growth hormone releasing hormone pathway modulator or epidermal growth factor receptor inhibitor. | 07-07-2011 |
20110165146 | METHODS OF DIAGNOSING ALZHEIMER'S DISEASE - Methods and compositions relating to Alzheimer's disease are provided. Specifically, proteins that are differentially expressed in the Alzheimer's disease state relative to their expression in the normal state are provided. Proteins associated with Alzheimer's disease are identified and described. Methods of diagnosis of Alzheimer's disease using the differentially expressed proteins are also provided, as are methods for the identification and therapeutic use of compounds for the prevention and treatment of Alzheimer's disease. | 07-07-2011 |
20110165147 | NOVEL 18636, 2466, 43238, 1983, 52881, 2398, 45449, 50289, 52872 AND 26908 MOLECULES AND USES THEREFOR - The invention provides isolated nucleic acids molecules, designated 18636, 2466, 43238, 1983, 52881, 2398, 45449, 50289, 52872 and 26908 nucleic acid molecules. The invention also provides antisense nucleic acid molecules, recombinant expression vectors containing 18636, 2466, 43238, 1983, 52881, 2398, 45449, 50289, 52872 and 26908 nucleic acid molecules, host cells into which the expression vectors have been introduced, and nonhuman transgenic animals in which a 18636, 2466, 43238, 1983, 52881, 2398, 45449, 50289, 52872 or 26908 gene has been introduced or disrupted. The invention still further provides isolated 18636, 2466, 43238, 1983, 52881, 2398, 45449, 50289, 52872 or 26908 proteins, fusion proteins, antigenic peptides and anti-18636, 2466, 43238, 1983, 52881, 2398, 45449, 50289, 52872 or 26908 antibodies. Diagnostic and therapeutic methods utilizing compositions of the invention are also provided. | 07-07-2011 |
20110165148 | NUCLEIC ACID AND CORRESPONDING PROTEIN ENTITLED 162P1E6 USEFUL IN TREATMENT AND DETECTION OF CANCER - A novel gene (designated 162P1E6) and its encoded protein, and variants thereof, are described wherein 162P1E6 exhibits tissue specific expression in normal adult tissue, and is aberrantly expressed in the cancers listed in Table I. Consequently, 162P1E6 provides a diagnostic, prognostic, prophylactic and/or therapeutic target for cancer. The 162P1E6 gene or fragment thereof, or its encoded protein, or variants thereof, or a fragment thereof, can be used to elicit a humoral or cellular immune response; antibodies or T cells reactive with 162P1E6 can be used in active or passive immunization. | 07-07-2011 |
20110165149 | TARGETING ABCB5 FOR CANCER THERAPY - The invention related to methods for treating a subject by manipulating ABCB5 on a cell as well as related products. The methods include methods of treating cancer using ABCB5 binding molecules such as antibodies and fragments thereof. | 07-07-2011 |
20110171203 | METHODS FOR TREATING NEOPLASTIC DISEASE TARGETING O-LINKED N-ACETYLGLUCOSAMINE MODIFICATIONS OF CELLULAR PROTEIN - Methods for treating a neoplastic disease in a mammalian subject are provided. The method provides administering an inhibitor of O-GlcNAc transferase in an amount effective to reduce or eliminate the neoplastic disease in the mammalian subject. Method for diagnosing a risk factor for a neoplastic disease in a mammalian subject and methods for identifying a test compound which inhibits a hexosamine signaling pathway in a cell or tissue are provided. | 07-14-2011 |
20110171204 | ANTIBODIES TO NTB-A - Anti-NTB-A antibodies and antigen-binding fragments thereof, as well as pharmaceutical compositions comprising such antibodies and antigen-binding fragments are described. Also described are methods of using such antibodies and antigen-binding regions to bind NTB-A and treat diseases, such as hematologic malignancies, which are characterized by expression of NIB-A. | 07-14-2011 |
20110171205 | NOVEL 15571, 2465, 14266, 2882, 52871, 8203 AND 16852 MOLECULES AND USES THEREFOR - The invention provides isolated nucleic acids molecules, designated 15571, 2465, 14266, 2882, 52871, 8203 or 16852 nucleic acid molecules. The invention also provides antisense nucleic acid molecules, recombinant expression vectors containing 15571, 2465, 14266, 2882, 52871, 8203 or 16852 nucleic acid molecules, host cells into which the expression vectors have been introduced, and nonhuman transgenic animals in which a 15571, 2465, 14266, 2882, 52871, 8203 or 16852 gene has been introduced or disrupted. The invention still further provides isolated 15571, 2465, 14266, 2882, 52871, 8203 or 16852 proteins, fusion proteins, antigenic peptides and anti-15571, 2465, 14266, 2882, 52871, 8203 or 16852 antibodies. Diagnostic and therapeutic methods utilizing compositions of the invention are also provided. | 07-14-2011 |
20110171206 | ANTIBODY COMBINATIONS AND USE OF SAME FOR TREATING CANCER - A method of identifying a combination of antibodies with a combined improved anti-tumor activity is provided. The method comprising: (a) identifying binding epitopes of anti ErbB-2 antibodies; and (b) selecting a combination of at least two antibodies of the anti ErbB-2 antibodies exhibiting binding to different epitopes on the ErbB-2, at least one of the different epitopes being localized to a dimerization site of the ErbB-2, the combination of antibodies being with the combined improved anti-tumor activity. Also provided are novel antibody combinations uncovered according to the present teachings. | 07-14-2011 |
20110171207 | COMPOSITIONS AND METHODS FOR TREATING INFLAMMATION AND AUTO-IMMUNE DISEASES - Compositions containing soluble B7-H4 (sH4) antagonists in an amount effective to reduce, inhibit, or mitigate an inflammatory response in an individual and methods for the treatment or prophylaxis of inflammatory disorders and autoimmune diseases or disorders are provided. Soluble H4 has been discovered to interfere with B7-H4 activity including B7-H4's activity as an inhibitor of T cell immunity. Thus, interference of sH4 biological activity is an effective method to restore B7-H4 activity and thereby provide an effective method for treating inflammatory diseases or disorders including autoimmune diseases or disorders. | 07-14-2011 |
20110177057 | PHARMACEUTICAL PREPARATION AND MANUFACTURING METHOD THEREOF - This invention provides a pharmaceutical preparation for DDS containing a pharmaceutical agent fixed by bonding to a monomolecular layer that is covalently bonded to a magnetic particle surface, (a) by reacting an alkoxysilane compound with the magnetic microparticle surface by dispersing a magnetic microparticle in a liquid mixture including an epoxy-containing alkoxysilane compound, a silanol condensation catalyst, and a non-aqueous organic solvent; (b) by washing the microparticle surface with an organic solvent to remove remaining surplus alkoxysilane compound for producing an epoxy-containing monomolecular layer that is covalently bonded to the microparticle surface; and (c) by fixing an imino-containing pharmaceutical agent such as a protein, amino acid, enzyme, antibody, antibiotic, antimicrobial, or contrast medium by reaction with the epoxy group. | 07-21-2011 |
20110177058 | METHODS AND COMPOSITIONS FOR MODULATING HGF/MET - The invention provides methods and compositions for modulating the HGF/c-met signaling pathway, in particular by regulating binding of HGF β chain to c-met. | 07-21-2011 |
20110177059 | PSA AND KLK2 AS THERAPEUTIC TARGETS AND MOLECULES INHIBITING PSA AND KLK2 - Disclosed herein are compositions and methods relating to prostate-specific antigen (PSA), KLK2 and androgen receptor. Further provided are methods and compositions for inhibiting PSA and/or KLK2 activity. Further provided are compositions and methods for treating or preventing cancer. | 07-21-2011 |
20110177060 | IAP BIR DOMAIN BINDING COMPOUNDS - IAP BIR domain binding compounds of Formula (I), (II), (III), or (IV), and the use thereof, for example, for the treatment or prevention of proliferative diseases. | 07-21-2011 |
20110182877 | SUSTAINED DELIVERY OF COMPSTATIN ANALOGS FROM GELS - The present invention features the sustained delivery of compstatin analog and, optionally, an additional active agent, by release from a macroscopic, gel-like deposit formed by administering a liquid solution containing the compstatin analog to an extravascular location in the body of a mammalian subject such as the vitreous chamber. | 07-28-2011 |
20110182878 | Anti-Ricin Antibody - The subject of the present invention is an anti-ricin antibody and the use thereof for the treatment of an individual suffering from ricin poisoning. | 07-28-2011 |
20110182879 | NOVEL HUMAN TRANSFERASE FAMILY MEMBERS AND USES THEREOF - The invention provides isolated nucleic acids molecules, designated 33877, 47179, 26886, 46743, 27417, 32252, and 53320 nucleic acid molecules, which encode novel human transferase family members. The invention also provides antisense nucleic acid molecules, recombinant expression vectors containing 33877, 47179, 26886, 46743, 27417, 32252, or 53320 nucleic acid molecules, host cells into which the expression vectors have been introduced, and nonhuman transgenic animals in which a 33877, 47179, 26886, 46743, 27417, 32252, or 53320 gene has been introduced or disrupted. The invention still further provides isolated 33877, 47179, 26886, 46743, 27417, 32252, or 53320 proteins, fusion proteins, antigenic peptides and anti-33877, 47179, 26886, 46743, 27417, 32252, or 53320 antibodies. Diagnostic methods utilizing compositions of the invention are also provided. | 07-28-2011 |
20110182880 | Combination Therapies Against Cancer - Specific oligonucleotide sequences, when given subcutaneously and in particular when administered on a mucous membrane, e.g. intranasally, intravaginally, or rectally, have a profound effect on various human cancer forms as confirmed in vivo, in animal studies, and in vitro, in human PBMCs collected from blood from healthy subjects and from patients suffering from CLL. The compounds are also preferably used in combination with a cancer therapy chosen among radiation treatment, hormone treatment, surgical intervention, chemotherapy, immunological therapies, photodynamic therapy, laser therapy, hyperthermia, cryotherapy, angiogenesis inhibition, or a combination of any of these, and most preferably an immunological treatment comprising the administration of an antibody to the patient. | 07-28-2011 |
20110182881 | SIGNATURE AND DETERMINANTS ASSOCIATED WITH METASTASIS AND METHODS OF USE THEREOF - The present invention provides methods of detecting cancer using biomarkers. | 07-28-2011 |
20110182882 | Icotinib Hydrochloride, Synthesis, Crystalline Forms, Pharmaceutical Compositions, and Uses Thereof - The invention relates to 4-[(3-ethynylphenyl)amino]-6,7-benzo-12-crown-quinazoline hydrochloride, its new crystalline forms, its therapeutic usage for treatment of diseases mediated by EGFR kinase and its combinatory therapeutic usage together with other therapeutic agents. The invention also provides synthetic methods for preparation of 4-[(3-ethynylphenyl)amino]-6,7-benzo-12-crown-quinazoline hydrochloride, its new crystalline forms, and the relevant synthetic intermediates for synthesis of 4-[(3-ethynylphenyl)amino]-6,7-benzo-12-crown-quinazoline hydrochloride. | 07-28-2011 |
20110182883 | NOVEL GENE DISRUPTIONS, COMPOSITIONS AND METHODS RELATING THERETO - The present invention relates to transgenic animals, as well as compositions and methods relating to the characterization of gene function. Specifically, the present invention provides transgenic mice comprising disruptions in PRO218, PRO228, PRO271, PRO273, PRO295, PRO302, PRO305, PRO326, PRO386, PRO655, PRO162, PRO788, PRO792, PRO940, PRO941, PRO1004, PRO1012, PRO1016, PRO474, PRO5238, PRO1069, PRO1111, PRO1113, PRO1130, PRO1195, PRO1271, PRO1865, PRO1879, PRO3446, PRO3543, PRO4329, PRO4352, PRO5733, PRO9859, PRO9864, PRO9904, PRO9907, PRO10013, PRO90948, PRO28694, PRO16089, PRO19563, PRO19675, PRO20084, PRO21434, PRO50332, PRO38465 or PRO346 genes. Such in vivo studies and characterizations may provide valuable identification and discovery of therapeutics and/or treatments useful in the prevention, amelioration or correction of diseases or dysfunctions associated with gene disruptions such as neurological disorders; cardiovascular, endothelial or angiogenic disorders; eye abnormalities; immunological disorders; oncological disorders; bone metabolic abnormalities or disorders; lipid metabolic disorders; or developmental abnormalities. | 07-28-2011 |
20110182884 | P-CADHERIN ANTIBODIES - The present invention relates to antibodies including human antibodies and antigen-binding portions thereof that bind to P-cadherin, and that function to inhibit P-cadherin. The invention also relates to heavy and light chain immunoglobulins derived from human P-cadherin antibodies and nucleic acid molecules encoding such immunoglobulins. The present invention also relates to methods of making human P-cadherin antibodies, compositions comprising these antibodies and methods of using the antibodies and compositions. The invention also relates to transgenic animals or plants comprising nucleic acid molecules of the present invention. | 07-28-2011 |
20110182885 | FORMULATIONS AND TREATMENTS FOR WELL-BEING - A formulation for well-being in humans including: extracts from the herbal varieties, | 07-28-2011 |
20110189164 | Peptide Stabilizer Compounds and Screening Method - Peptide stabilizer compounds are provided that in combination with a biologically active peptide, can increase the protease elimination half-time of the biologically active peptide in vivo. The peptide stabilizer compounds are preferably in the form of peptide sequences that confer resistance to proteolysis upon conjugated biologically active peptides. Also provided is a method for the selection of novel proteolysis resistant compounds from in vitro generated libraries, and pharmaceutical compositions comprising the stabilizer compounds identified thereby. | 08-04-2011 |
20110189165 | METHOD OF IDENTIFYING DISEASE RISK FACTORS - Provided herein is a method for identifying a genetic variant that is associated with development of a condition of interest (e.g., Alzheimer's disease), and genetic variants so identified. Methods of treatment with an active agent (e.g., with a particular active agent and/or at an earlier age) is also provided, upon detecting a genetic variant described herein. In some embodiments, the genetic variant is a deletion/insertion polymorphism (DIP) of the TOMM40 gene. Kits for determining if a subject is at increased risk of developing late onset Alzheimer's disease is also provided. Kits for determining if a subject is responsive to treatment for a condition of interest with an active agent are further provided. | 08-04-2011 |
20110200579 | NOVEL GENE DISRUPTIONS, COMPOSITIONS AND METHODS RELATING THERETO - The present invention relates to transgenic animals, as well as compositions and methods relating to the characterization of gene function. Specifically, the present invention provides transgenic mice comprising disruptions in PRO57290 genes. Such in vivo studies and characterizations may provide valuable identification and discovery of therapeutics and/or treatments useful in the prevention, amelioration or correction of diseases or dysfunctions associated with gene disruptions such as cardiovascular, endothelial or angiogenic disorders; immunological disorders; oncological disorders; bone metabolic abnormalities or disorders; or developmental abnormalities. | 08-18-2011 |
20110200580 | METHODS OF TREATMENT AND PREVENTION OF DIET-INDUCED OBESITY AND SEQUELAE THEREOF - Disclosed are methods of treating or preventing diet-induced obesity and/or one or more sequelae thereof in a subject. These methods comprise administering to a subject in need of treatment or at risk for developing diet-induced obesity and/or one or more sequelae thereof, a therapeutically effective amount of a pharmaceutical composition comprising at least one inhibitor of RP 105 and/or MD-I activity. Also disclosed are methods of identifying compounds that inhibit development of diet-induced obesity and/or one or more sequelae thereof. In some aspects, these methods comprise: providing at least one first cell comprising TLR4, MD-2. RP105. MD-K and a TLR4-responsive promoter operably linked to a nucleic acid sequence encoding a reporter, contacting the at least one first cell with lipopolysaccharide and with a candidate compound; and determining a level of expression of the reporter in the presence of the LPS and the candidate compound, in some aspects, these methods comprise: providing at least one first cell comprising TLR2, TLR1, TLR6, MD-2, RP H/S, MD-K and a TLR2-responsive promoter operably linked to a nucleic acid sequence encoding a reporter, contacting the at least one first cell with a lipopeptide ligand of TLR2 and with a candidate compound, and determining a level of expression of the reporter in the presence of the lipopeptide ligand of TLR2 and the candidate compound | 08-18-2011 |
20110200581 | PHARMACEUTICAL COMPOSITIONS - Synthesis natural tubulisine derivatives of formula (A) having a high cytotoxicity | 08-18-2011 |
20110200582 | LIPIDS, LIPID COMPOSITIONS, AND METHODS OF USING THEM - Disclosed are formulation and optimization protocols for delivery of therapeutically effective amounts of biologically active agents to liver, tumors, and/or other cells or tissues. Also provided are compositions and uses for cationic lipid compounds of formula (I). | 08-18-2011 |
20110200583 | Asthma Susceptibility Loci Located at Chromosome 1q31 for Use in Diagnostic and Therapeutic Methods - Methods and composition are provided for diagnosing pediatπc onset asthma based on the single nucleotide polymorphism on chromosome 1q31 wherein said single nucleotide polymorphism is set forth in Table 2 or Table 6 of the instant invention Method and composition are also provided for treating and preventing asthma or other inflammatory conditions in a patient in need thereof compπsing administering an effective amount of an at least one inhibitor which reduces the expression of DENND1 B gene product. | 08-18-2011 |
20110200584 | METHOD TO STIMULATE IMMUNE FUNCTION AND REGENERATION - The present relates to a method to stimulate thymocytes to differentiate, proliferate and increase thymic output by administration of a hormone-based reagent. | 08-18-2011 |
20110200585 | CD127 BINDING PROTEINS - Antigen binding proteins which bind to human IL-7 receptor (CD127) are provided. The antigen binding proteins are typically antibodies, and are useful in the treatment of diseases or disorders in humans, particularly autoimmune diseases such as multiple sclerosis. | 08-18-2011 |
20110200586 | AMINOTHIAZOLONES AS ESTROGEN RELATED RECEPTOR-ALPHA MODULATORS - The present invention relates to compounds of Formula (I), | 08-18-2011 |
20110200587 | AMINOTHIAZOLONES AS ESTROGEN RELATED RECEPTOR-ALPHA MODULATORS - The present invention relates to compounds of Formula (I), | 08-18-2011 |
20110200588 | METHODS FOR GENETIC ANALYSIS - Methods of treating an individual exhibiting a medical condition are disclosed. The methods involve determining a score of an individual based on the individual's genotypic information, comparing the score to at least one threshold value, wherein the result of the comparison is indicative of a beneficial response to a treatment, and providing a suitable treatment to the individual. | 08-18-2011 |
20110200589 | DECONVOLUTION METHOD - The present invention relates generally to novel applications in combating infectious disease, cancer, allergy and autoimmune diseases. In one aspect, the invention relates to identifying one or more protein binding moieties of interest. In another aspect, the present invention relates to identifying one or more candidate vaccines. | 08-18-2011 |
20110206657 | ANTIBODIES BINDING TO AN INTRACELLULAR PRL-1 OR PRL-3 POLYPEPTIDE - We provide an antibody capable of | 08-25-2011 |
20110212076 | Viral Therapeutic - The invention provides a method of inhibiting viral infection of a mammalian cell, said method comprising reducing or inhibiting ps20 polypeptide expressed by said cell. Suitably ps20 is inhibited by contacting said cell with an antibody capable of binding to ps20 polypeptide. Suitably said antibody is ps20 neutralising antibody. The invention also provides antibody capable of binding ps20 polypeptide, siRNA targeted to a transcript encoding ps20 polypeptide, or antisense ps20 polynucleotide for use as a medicament for viral infection. The invention also provides a method of identifying an agent for inhibiting a viral infection, comprising determining level of ps20 expression in first and second samples, the first contacted with test agent; and comparing the level of ps20 expression in said first and second samples; wherein lower level of ps20 expression in said first sample relative to said second sample identifies test agent as an agent for inhibiting a viral infection. | 09-01-2011 |
20110212077 | BI-ARYL META-PYRIMIDINE INHIBITORS OF KINASES - The invention provides biaryl meta-pyrimidine compounds having the general structure (A). The pyrimidine compounds of the invention are capable of inhibiting kinases, such as members of the Jak kinase family, and various other specific receptor and non-receptor kinases. | 09-01-2011 |
20110212078 | SYNTHESIS AND USE OF HETEROCYCLIC ANTIBACTERIAL AGENTS - This invention relates to compounds of the following Formula (I); or a pharmaceutically acceptable salt, solvate, ester or isomer thereof, which is useful for the treatment of diseases or conditions mediated by LpxC. | 09-01-2011 |
20110212079 | ADAPTIVE BIOCHEMICAL SIGNATURES - The present invention is related to methods of generating adaptive biochemical signatures in live cells and the use of said signatures to identify diagnostic and therapeutic modalities for human disease. The methods described herein comprise contacting a provocative agent to live cells and measuring and analyzing adaptive readouts. The methods of the invention may be used for therapeutic or diagnostic purposes. | 09-01-2011 |
20110212080 | UREA DERIVATIVES AS ANTIBACTERIAL AGENTS - This invention relates to compounds of the Formula (I): or a pharmaceutically acceptable salt, solvate, ester or isomer thereof, which is useful for the treatment of diseases or conditions mediated by LpxC. | 09-01-2011 |
20110212081 | KRUPPEL-LIKE FACTORS AND FAT REGULATION - Disclosed herein are methods and cell lines used in fat regulation. The methods and cell lines incorporate Krüppel-like factors including, without limitation, klf-1 and klf-3. | 09-01-2011 |
20110212082 | METHOD FOR PRODUCING TABLET COMPRISING NATURAL ALLICIN - A method for producing a tablet including mixing and uniformly stirring starch, garlic powder, and natural allicin powder to yield a mixture, adding natural sesamin, Ig Y or Ig G, and magnesium stearate to the mixture, uniformly stiffing, and tabletting. The allicin tablet has high allicin content and capability of anti-bacteria and anti-inflammation, and can be administered based on the body weight of an animal in need thereof but causes no side effects. | 09-01-2011 |
20110212083 | ROLE OF SOLUBLE UPAR IN THE PATHOGENESIS OF PROTEINURIC KIDNEY DISEASE - Compositions which specifically block urokinase receptor (uPAR) in podocytes; compositions which modulate or block soluble urokinase receptor (suPAR); compositions which modulate pathways in which uPAR is associated with, protect against renal diseases or disorders. Methods of treatment in vivo involve use of one or more compositions. | 09-01-2011 |
20110217288 | Involvement of Androgen/Androgen Receptor Pathway in Fabry Disease - Novel therapies for the treatment of Fabry disease by using androgen/androgen receptor (AR) pathway-related molecules as biomarkers and use of approaches targeting androgen/AR pathway are presented herein. The involvement of aberrant androgen/AR pathway in Fabry disease has never been previously described. The present invention describes, (i) use of approaches that target androgen/AR pathway as therapeutic treatments for Fabry disease and (2) use of the levels of androgen/AR pathway-related molecules in body fluids or tissues as biomarkers for evaluation of disease progression and efficacy of treatments in Fabry patients. | 09-08-2011 |
20110217289 | Melt-Coated Dosage Forms - Formulations of sparingly water-soluble active ingredientscomprising carrier particles provided with active ingredient-containing coatings, the sparingly soluble active ingredients being embedded in coatings composed of amphiphilic copolymers, and the coatings being applied in the form of a solvent-free melt. | 09-08-2011 |
20110217290 | TREATMENT AND/OR PREVENTION OF PEANUT INDUCED ANAPHYLAXIS - Compositions and methods for the treatment of food allergies, particularly peanut allergy are provided. The compositions and methods are based on the observation that agents which interfere with the association of platelet activating fact (PAF) with its receptor (PAF-R) significantly reduce the severity and duration of anaphylaxis. Combination therapy with a PAF inhibitor and a histamine inhibitor provided an increased beneficial effect compared to treatment alone. | 09-08-2011 |
20110223152 | USE OF INHIBITORS OF LEUKOTRIENE B4 RECEPTOR BLT2 FOR TREATING HUMAN CANCERS - The present invention relates to a new use of inhibitors of leukotriene B4 receptor BLT2 for treating human cancers. More particularly, the present invention relates to a pharmaceutical composition for treating human cancers comprising BLT2 inhibitors and a method for treating human cancers using BLT2 inhibitors. | 09-15-2011 |
20110223153 | MODIFIED SILK FILMS CONTAINING GLYCEROL - The present invention provides for compositions and methods for preparing aqueous insoluble, ductile, flexible silk fibroin films. The silk films comprise silk fibroin and about 10% to about 50% (w/w) glycerol, and are prepared by entirely aqueous processes. The ductile silk film may be further treated by extracting the glycerol from and re-drying the silk film. Active agents may be embedded in or deposited on the glycerol modified silk film for a variety of medical applications. The films may be into 3-dimentional structures, or placed on support surfaces as labels or coatings. The glycerol modified silk films of the present invention are useful in variety of applications such as tissue engineering, medical devices or implants, drug delivery, and edible pharmaceutical or food labels. | 09-15-2011 |
20110229456 | MODULATION OF IMMUNOSTIMULATORY PROPERTIES OF OLIGONUCLEOTIDE-BASED COMPOUNDS BY OPTIMAL PRESENTATION OF 5' ENDS - The invention relates to the therapeutic use of oligonucleotides as immunostimulatory agents in immunotherapy applications. More particularly, the invention provides immunomers for use in methods for generating an immune response or for treating a patient in need of immunostimulation. The immunomers of the invention comprise at least two oligonucleotides linked at their 3′ ends, internucleoside linkages or functionalized nucleobase or sugar to a non-nucleotidic linker, at least one of the oligonucleotides being an immunostimulatory oligonucleotide and having an accessible 5′ end. | 09-22-2011 |
20110229457 | INJECTABLE DRUG DELIVERY SYSTEM - The invention provides a formulation that includes a biocompatible solvent system, a biodegradable polymer that is substantially soluble in the biocompatible solvent system, and an active pharmaceutical ingredient that is substantially insoluble in the biocompatible solvent system. The formulation can form a drug-eluting implant, when injected into mammalian tissue. The solvent system and the biodegradable polymer can be selected so that the implant provides extended, delayed, controlled and/or modified release of the active pharmaceutical ingredient, for example, over the course of days, weeks or months. | 09-22-2011 |
20110229458 | METHODS FOR SELECTING PROTEASE RESISTANT POLYPEPTIDES - The disclosure relates to a method for selecting, isolating and/or recovering a peptide or polypeptide from a library or a repertoire of peptides and polypeptides (e.g., a display system) that is resistant to degradation by a protease such as a protease found in the serum. Generally, the method comprises providing a library or repertoire of peptides or polypeptides, incubating the library or repertoire with a protease under conditions suitable for protease activity, and selecting, isolating and/or recovering a peptide or polypeptide that is resistant to degradation by the protease and has a desired biological activity. The selected peptides and polypeptides have utility as therapeutics, e.g., for treating disease in humans. | 09-22-2011 |
20110236370 | Genetic Alterations on Chromosomes 21q, 6q and 15q and Methods of Use Thereof for the Diagnosis and Treatment of Type I Diabetes - Compositions and methods for the detection and treatment of T1D are provided. | 09-29-2011 |
20110236371 | Compositions And Methods For The Treatment Of Neurologic And Psychiatric Conditions - The invention provides pharmaceutical compositions and methods of use thereof for preventing or ameliorating disorders of the nervous system. More specifically, the invention provides pharmaceutical compositions, including phosphopeptides, that when administered disrupt TrkB-mediated activation of PLCγ1 phosphorylation. The invention further provides method of treatment comprising administering inhibitors of TrkB-mediated activation of PLCγ1 phosphorylation alone or in combination with other pharmaceutical compositions to prevent or ameliorate nervous system disorders such as epilepsy, stroke, anxiety, migraine, and pain. | 09-29-2011 |
20110236372 | Display Library for Antibody Selection - Synthetic antibody display library containing human germline antibody molecules with variation in VH CDR3 and VL CDR3 and at position 52 of VH CDR2, for screening and selection of antibody molecules specific for antigens of interest. | 09-29-2011 |
20110243921 | PREVENTION AND TREATMENT OF CUTANEOUS LUPUS ERYTHEMATOSUS - Disclosed herein, in certain embodiments, are methods and compositions for the prevention and treatment of autoimmune disease. Further disclosed herein, in certain embodiments, are methods for the prevention and treatment of cutaneous lupus erythematosus. Additionally disclosed herein, in certain embodiments, are compositions for the prevention and treatment of cutaneous lupus erythematosus. | 10-06-2011 |
20110243922 | Genetic Alterations Associated with Type I Diabetes and Methods of Use Thereof for Diagnosis and Treatment - Compositions and methods for the detection and treatment of T1D are provided. | 10-06-2011 |
20110243923 | ORGANIC COMPOUNDS - The present invention relates to modulators of the interaction between Epstein-Barr Virus induced receptor-2 (EBi2) and cholest-5-ene-3b,7b,25-triol (7, 25-dihydroxycholesterol) (“7,25DHC”) and/or cholest-5-ene-3b, 7b-diol (7-hydroxycholesterol) (“7HC”). The modulator maybe a small chemical molecule, antibody or other therapeutic protein. Methods of medical treatment and methods of identifying modulators are also described. | 10-06-2011 |
20110250193 | COMPOSITION COMPRISING EXPRESSION OR ACTIVITY INHIBITORS OF NINJURIN1 FOR THE PREVENTION AND TREATMENT OF INFLAMMATORY DISEASE - The present invention relates to a composition comprising a Ninjurin1 expression or activity inhibitor for the prevention and treatment of inflammatory disease. Ninjurin1 protein is specifically expressed in macrophages around blood vessels, increases cell-cell adhesion and cell-matrix adhesion, increases expressions of Wnt7 | 10-13-2011 |
20110256121 | METHODS AND KITS FOR DIAGNOSING OR MONITORING AUTOIMMUNE AND CHRONIC INFLAMMATORY DISEASES - The present invention relates to compositions and methods for diagnosing, monitoring and/or treating disease (e.g., autoimmune or chronic inflammatory disease, heart disease and/or stroke). In particular, the present invention provides methods for diagnosing, monitoring and treating disease based upon detecting or altering (e.g., altering expression or methylation status of) disease proteins (e.g., CD70, CD40L, and/or KIR). The present invention also provides kits for detecting methylation status of disease proteins (e.g., CD70, CD40L, and/or KIR) and for diagnosing, monitoring and/or treating diseases (e.g., autoimmune or chronic inflammatory disease, heart disease and/or stroke). | 10-20-2011 |
20110256122 | POLYPEPTIDES, ANTIBODY VARIABLE DOMAINS & ANTAGONISTS - The present disclosure relates to immunoglobulin single variable domains (dAbs) e.g., dAbs which are protease resistant, and also to formulations, and compositions comprising such dAbs for ocular delivery and to their uses to treat ocular diseases and conditions. | 10-20-2011 |
20110262425 | THERAPEUTIC AGENT FOR MLL LEUKEMIA AND MOZ LEUKEMIA OF WHICH MOLECULAR TARGET IS M-CSF RECEPTOR, AND USE THEREOF - An objective of the present invention is to provide therapeutic agents for MLL leukemia and MOZ leukemia, which include an M-CSF receptor inhibitor as an active ingredient. Another objective of the present invention is to provide methods of screening for pharmaceutical compositions that treat or prevent leukemia by suppressing the expression or activity of M-CSF receptor. Still another objective of the present invention is to provide methods of testing for leukemia, which include the step of determining the expression level of an M-CSF receptor. The present inventors conducted dedicated studies, and as a result revealed that the M-CSF receptor (M-CSFR, CSF1R, c-FMS, or CD115) is highly expressed in cells having the activity of inducing MLL or MOZ leukemia (leukemia stem cells), both of which are intractable acute leukemia. Specifically, the present inventors discovered that the M-CSF receptor signal is closely associated with the leukemia onset. | 10-27-2011 |
20110262426 | METHODS AND KITS USED IN IDENTIFYING GLIOBLASTOMA - The invention encompasses methods and kits used in the identification of invasive glioblastoma based upon the expression of TROY. The methods and kits also allow prediction of disease outcome as well as therapeutic outcome. | 10-27-2011 |
20110262427 | AMINO ACID SEQUENCES THAT MODULATE THE INTERACTION BETWEEN CELLS OF THE IMMUNE SYSTEM - The present invention relates to amino acid sequences that block the interaction between (a target on) an antigen presenting cell (APC) and (a target on) a T-cell. More particularly, the present invention relates to amino acid sequences that are directed against (as defined herein) a target on an APC (also referred to herein as “APC target”) or a target on a T-cell (also referred to herein as “T-cell target”). The invention further relates to compounds or constructs, and in particular proteins and polypeptides, that comprise or essentially consist of one or more such amino acid sequences. | 10-27-2011 |
20110262428 | TREATING CANCER BY MODULATING RNA HELICASES - The present invention relates to a method for treating cancer in a subject by inhibiting DHX36, by administering to said subject a therapeutically effective amount of a modulator of DHX36. | 10-27-2011 |
20110262429 | HUMAN TIMP-1 ANTIBODIES - Human antibodies that bind to TIMP-1 can be used as reagents to diagnose and treat disorders in which TIMP-1 is elevated, such as liver fibrosis, alcoholic liver disease, cardiac fibrosis, acute coronary syndrome, lupus nephritis, glomerulosclerotic renal disease, benign prostate hypertrophy, colon cancer, lung cancer, and idiopathic pulmonary fibrosis. | 10-27-2011 |
20110268722 | COMBINATION THERAPIES WITH MITOCHONDRIAL-TARGETED ANTI-TUMOR AGENTS - Described are mitochondria-targeted anti-tumor agents, death receptor agonists, autophagy inhibitors, and NF-κB signaling pathway inhibitors, and methods of making and using the same for the treatment of disorders associated with unwanted cell proliferation. | 11-03-2011 |
20110268723 | CCR3 Inhibition for Ocular Angiogenesis and Macular Degeneration - Provided are methods and compositions for the treatment or prevention of ocular angiogenesis and neovascularization. Administration of inhibitors of the CCR3 receptor or its ligands eotaxin (CCL11), eotaxin-2 (CCL24) or eotaxin-3 (CCL26) inhibits ocular angiogenesis. | 11-03-2011 |
20110268724 | METHODS AND MATERIALS RELATING TO CD84-LIKE POLYPEPTIDES AND POLYNUCLEOTIDES - The invention provides novel polynucleotides and polypeptides encoded by such polynucleotides and mutants or variants thereof that correspond to a novel human secreted CD84-like polypeptide. These polynucleotides comprise nucleic acid sequences isolated from cDNA library from human spleen (Hyseq clone identification numbers 2938352 (SEQ ID NO: 1)). Other aspects of the invention include vectors containing processes for producing novel human secreted CD84-like polypeptides, and antibodies specific for such polypeptides. | 11-03-2011 |
20110274683 | Antibodies That Bind CSF1R - Antibodies that bind CSF1R are provided. Antibody heavy chains and light chains that are capable of forming antibodies that bind CSF1R are also provided. Polynucleotides encoding antibodies to CSF1R are provided. Polynucleotides encoding antibody heavy chains and lights chains are also provided. Methods of treatment using antibodies to CSF1R are provided. Such methods include, but are not limited to, methods of treating rheumatoid arthritis, bone loss, and multiple sclerosis. | 11-10-2011 |
20110280860 | PHARMACEUTICAL COMPOSITIONS COMPRISING MONOTERPENES - The present invention provides a process for purifying a monoterpene or sesquiterpene having a purity greater than about 98.5% (w/w). The process comprises the steps of derivatizing the monoterpene (or sesquiterpene) to produce a monoterpene (or sesquiterpene) derivative, separating the monoterpene (or sesquiterpene) derivative, and releasing the monoterpene (or sesquiterpene) from the derivative. Also encompassed by the scope of the present invention is a pharmaceutical composition comprising a monoterpene (or sesquiterpene) having a purity greater than about 98.5% (w/w). The purified monoterpene can be used to treat a disease such as cancer. The present monoterpene (or sesquiterpene) may be administered alone, or may be co-administered with radiation or other therapeutic agents, such as chemotherapeutic agents. | 11-17-2011 |
20110280861 | METHOD FOR MIR-125A IN PROMOTING HEMATOPOIETIC STEM CELL SELF RENEWAL AND EXPANSION - Embodiments of the invention relate to methods and compositions for the expansion of hematopoietic stem cell (HSC) self renewal. The microRNA-125a is a master control of HSC self-renewal. Increased expression of mir-125a increased HSC self-renewal by 6-30 folds. Increased expression of mir-125a can be used to expand HSC ex vivo and in vivo. | 11-17-2011 |
20110280862 | GEP AND DRUG TRANSPORTER REGULATION, CANCER THERAPY AND PROGNOSIS - Described herein are methods for manipulating GEP and/or drug transporters (e.g., ABCB5 and/or ABCF1) on a cell, as well as related products. Also described herein are methods for treating cancer cells using GEP and/or drug transporter and/or their binding molecules and suppression thereof. Methods of cancer treatment targeting the GEP and/or drug transporters, alone or in combination with chemotherapy are also described herein. Also provided herein are sets of markers whose expression patterns can be used to differentiate clinical conditions, such as high or low levels of GEP and drug transporters. Based on the levels of GEP and drug transporters, the likelihood of cancer recurrences, drug sensitivity, and prognosis can be determined. Methods of classifying and treating patients based on the prognosis are also provided herein. | 11-17-2011 |
20110280863 | METHODS AND COMPOSITIONS FOR THE DETECTION AND TREATMENT OF PREECLAMPSIA - Methods, kits and compounds are provided that relate to the diagnosis, treatment, and/or prevention of preeclampsia. | 11-17-2011 |
20110280864 | Low Viscosity Highly Concentrated Suspensions - The present invention also provides a high concentration low viscosity suspension of an pharmaceutically acceptable solvent with one or more sub-micron or micron-sized non-crystalline particles comprising one or more proteins or peptides. Optionally one or more additives in the pharmaceutically acceptable solvent to form a high concentration low viscosity suspension with a concentration of at least 20 mg/ml and a solution viscosity of between 2 and 100 centipoise that is suspendable upon shaking or agitation, wherein upon delivery the one or more sub-micron or micron-sized peptides dissolves and do not form peptide aggregates syringeable through a 21 to 27-gauge needle. | 11-17-2011 |
20110280865 | Ets-2 Biomarkers for Fibrotic Diseases and Uses Thereof - Methods and compositions for detecting, treating, characterizing, and diagnosing interstitial lung and/or fibrotic diseases are described. | 11-17-2011 |
20110280866 | ANTI-CD 160 MONOCLONAL ANTIBODIES AND USES THEREOF - The present invention concerns an antibody or fragment thereof, capable of binding to CD 160, said antibody comprising a) a light chain comprising three light chain complementary regions (CDRs) having the following amino acid sequences: (i) the light chain CDR1: QSISNH (SEQ ID NO: 1), (ii) the light chain CDR2: YAS, (iii) the light chain CDR3: QQSNSWPLT (SEQ ID NO: 2), and a light chain framework sequence from an immunoglobulin light chain; and b) a heavy chain comprising three heavy chain complementary regions (CDRs) having the following amino acid sequences: (i) the heavy chain CDR1: GYTFTDYW (SEQ ID NO: 3), (ii) the heavy chain CDR2: IYPGDDDA (SEQ ID NO: 4); (iii) the heavy chain CDR3: ARRGIAAVVGGFDY (SEQ ID NO: 5); and a heavy chain framework sequence from an immunoglobulin heavy chain; a pharmaceutical comprising said antibody and the use of said antibody for preparation of a medicament for treating and/or preventing a pathology associated with endothelial cells proliferation engaged in an angiogenesis process. | 11-17-2011 |
20110280867 | HETEROCYCLIC ASPARTYL PROTEASE INHIBITORS - Disclosed are compounds of the formula I | 11-17-2011 |
20110286997 | Genetic Alterations on Chromosome 16 and Methods of Use Thereof for the Diagnosis and Treatment of Type 1 Diabetes - Compositions and methods for the detection and treatment of T1D are provided. | 11-24-2011 |
20110286998 | METHODS FOR TREATING AND PREVENTING CANCERS THAT EXPRESS THE HYPOTHALAMIC-PITUITARY-GONADAL AXIS OF HORMONES AND RECEPTORS - Methods are provided for treating HPG axis-positive cancers, preventing or slowing proliferation of cells of HPG axis-positive cancer origin, preventing HPG axis-positive cancers in a patient at risk of contracting such cancers, preventing or inhibiting an upregulation of the cell cycle in HPG axis-positive cancer-derived cells in a patient, and decreasing the level of HPG axis-positive cancer-specific markers in a patient. | 11-24-2011 |
20110286999 | METHODS FOR REVERSING MULTIPLE RESISTANCE IN ANIMAL CELLS - The present invention is related to the use of a virus, preferably an adenovirus for reversing resistance in cells. | 11-24-2011 |
20110293598 | METHOD TO PRODUCE AN IMMUNOGLOBULIN PREPARATION WITH IMPROVED YIELD - The present invention provides improved methods for the manufacturing of IVIG products. These methods offer various advantages such as reduced loss of IgG during purification and improved quality of final products. In other aspects, the present invention provides aqueous and pharmaceutical compositions suitable for intravenous, subcutaneous, and/or intramuscular administration. In yet other embodiments, the present invention provides methods of treating a disease or condition comprising administration of an IgG composition provided herein. | 12-01-2011 |
20110293599 | METHOD FOR MODULATING MUSCLE DIFFERENTIATION OR REGENERATION - Present invention relates to method for promoting or inhibiting muscle differentiation or regeneration using an enhancer or an inhibitor capable of modulating the binding of TAZ polypeptide with MyoD polypeptide; method for screening a substance capable of up- or down-regulating muscle differentiation or regeneration by use of interaction between TAZ polypeptide and MyoD polypeptide; an isolated peptide consisting of an amino acid sequence of SEQ ID NO. 2 which binds to and activates the MyoD polypeptide; a polynucleotide encoding the isolated peptide; and a pharmaceutical composition comprising the isolated peptide or the polynucleotide. | 12-01-2011 |
20110293600 | Anticancer Composition Comprising Antitumor Agent and Substance Having Inhibitory Effects on L1CAM Activity and Expression - The present invention relates to an anticancer composition comprising an antitumor agent as well as a substance having inhibitory effects on the activity or expression of L1CAM; more particularly, to an anticancer composition, which comprises an anti-L1CAM antibody specific to L1CAM, serving as a substance for inhibiting the activity of L1CAM; an oligonucleotide inhibiting the generation of L1CAM, serving as a substance for inhibiting the expression of L1CAM; and a substance selected from cisplatin, gemcitabine, 5-fluorouracil and taxol, serving as an antitumor agent. The composition according to the present invention has the benefit of the combined use of a substance having inhibitory effects on the activity or an expression of L1CAM and an antitumor agent concurrently, separately or sequentially so that it demonstrates stronger and more significant pharmaceutical effects than the exclusive use of those substances on inhibiting proliferation and inducing apoptosis in cancer cells, thereby making it very useful for cancer treatment. | 12-01-2011 |
20110300127 | DRUG-CONTAINING COMPOSITION - It is an object of the present invention to provide a drug-containing composition capable of stably retaining a water-soluble compound without the loss of drug efficacy of a pharmaceutically active ingredient and thus preventing the compound from diffusing in the body, which is unlikely to cause disassociation at a non-target site and thus achieves disassociation/sustained release/delivery specifically at a target site. The present invention provides a composition which is composed of: (a) at least one a water-soluble compound; and (b) a carrier comprising a polymer having binding affinity with the water-soluble compound. | 12-08-2011 |
20110300128 | USE OF FOXP2 AS A MARKER FOR ABNORMAL LYMPHOCYTES AND AS A TARGET FOR THERAPY OF DISORDERS ASSOCIATED WITH ABNORMAL LYMPHOCYTES - The present invention is directed to a method for detecting abnormal lymphocytes said method comprising detecting an amount or expression of the FOXP2 gene in lymphocytes in a sample, wherein an increased amount or expression of the FOXP2 gene in said lymphocytes indicates the presence of abnormal lymphocytes. Additionally, the invention concerns a method for detecting or assessing a condition associated with the presence of abnormal lymphocytes. The methods of the invention may also be useful for diagnosing myeloma or MGUS or for determining the prognosis for patients with lymphoma, myeloma or MGUS. The severity of bone disease or bone colonisation of tumours may also be able to be predicted. Further, treatment of conditions associated with the presence of abnormal lymphocytes using an agent which inhibits FOXP2 expression and/or FOXP2 activity is provided. An antibody which binds to the N-terminus of FOXP2 has also been developed. | 12-08-2011 |
20110305684 | IMMUNOSTIMULATORY PROPERTIES OF OLIGONUCLEOTIDE-BASED COMPOUNDS COMPRISING MODIFIED IMMUNOSTIMULATORY DINUCLEOTIDES - The invention relates to the therapeutic use of oligonucleotides as immunostimulatory agents in immunotherapy applications. More particularly, the invention provides an immunostimulatory oligonucleotides for use in methods for generating an immune response or for treating a patient in need of immunostimulation. The immunostimulatory oligonucleotides of the invention preferably comprise novel purines. The immunostimulatory oligonucleotides according to the invention further comprise at least two oligonucleotides linked at their 3′ ends, internucleoside linkages or functionalized nucleobase or sugar to a non-nucleotidic linker, at least one of the oligonucleotides being an immunostimulatory oligonucleotide and having an accessible 5′ end. | 12-15-2011 |
20110305685 | SUPRAMOLECULAR APPROACH FOR PREPARATION OF SIZE CONTROLLABLE NANOPARTICLES - A supramolecular approach has been developed for preparation of size-controllable nanoparticles, from three different molecular building blocks. | 12-15-2011 |
20110311512 | Genetic Variants Underlying Human Cognition and Methods of Use Thereof as Diagnostic and Therapeutic Targets - Compositions and methods for the detection and treatment of neurological disorders, including ASD, are provided. | 12-22-2011 |
20110311513 | Methods for treating coagulation disorders - The invention is directed to methods for treating coagulation disorders, in particular, hemophilia. Such methods utilize novel compositions including Amnion-derived Multipotent Progenitor cells (herein referred to as AMP cells) alone or in combination with other agents and/or treatment modalities. | 12-22-2011 |
20110311514 | Methods for treating disorders of amino acid metabolism - The invention is directed to methods for treating disorders of amino acid metabolism, in particular, maple sugar urine disease (MSUD). Such methods utilize novel compositions including Amnion-derived Multipotent Progenitor cells (herein referred to as AMP cells) alone or in combination with other agents and/or treatment modalities. | 12-22-2011 |
20110311515 | PULMONARY ADMINISTRATION OF IMMUNOGLOBULIN SINGLE VARIABLE DOMAINS AND CONSTRUCTS THEREOF - The present invention relates to a method wherein an immunoglobulin single variable domain (such as a Nanobody) and/or construct thereof are absorbed in pulmonary tissue. More particularly, the invention provides systemic delivery of an immunoglobulin single variable domain and/or construct thereof via the pulmonary route. | 12-22-2011 |
20110311516 | Chemically Programmed Vaccination - Provided herein is a method for chemically programmed vaccination. Methods include inducing a covalent-binding polyclonal antibody response in a subject and programming the polyclonal response with a targeting compound. | 12-22-2011 |
20110311517 | Antibodies and methods for treating estrogen receptor-associated diseases - Provided herein in certain embodiments are antibodies, antibody fragments, pharmaceutical compositions, methods for modulating the functions of estrogen receptor alpha 36, and methods for preventing and/or treating diseases mediated by estrogen receptor alpha 36. | 12-22-2011 |
20110311518 | NOVEL SYNTHETIC AGONISTS OF TLR9 - The invention relates to synthetic chemical compositions that are useful for modulation of Toll-Like Receptor (TLR)-mediated immune responses. In particular, the invention relates to agonists of Toll-Like Receptor 9 (TLR9) that generate unique cytokine and chemokine profiles. | 12-22-2011 |
20110311519 | METHODS OF TREATMENT OF BONE DEGENERATIVE DISEASES - Methods of reducing bone loss and treating degenerative bone diseases such as osteoporosis are disclosed. The methods comprise administration of an agent that inhibits signaling through the IL-17 pathway, such as an antibody or a quinazoline analogue such as halofuginone. | 12-22-2011 |
20110311520 | METHODS FOR TREATMENT OF ALLERGIC ASTHMA - Methods of treatment of allergic asthma with IgE antagonists, including anti-IgE antibodies, IgE variants, peptide antagonists, peptidomimetics and other small molecules, are described. | 12-22-2011 |
20110311521 | Novel therapy for anxiety - The present invention relates to a method of modulating, treating or effecting prophylaxis of a subject having anxiety or at risk of developing symptoms of anxiety, said method being characterized in that a therapeutically effective amount of a modulator of chondroitin sulphate proteoglycans is administered to said subject. | 12-22-2011 |
20110318331 | Nanoparticles and Use Thereof - A novel nanoparticle and use thereof were provided in the present invention. In particular, the nanoparticle is used for delivering therapeutic component, such as oligonucleotide and hydrophobic drug. | 12-29-2011 |
20110318332 | IMMUNOGLOBULIN G COMPOSITION - The invention relates to an immunoglobulin G composition comprising mannitol, glycine and a nonionic detergent, in which the immunoglobulin G concentration is 100 g/l±20 g/l. | 12-29-2011 |
20110318333 | NOVEL NON-TOXIC COMPOSITION AND METHOD OF USING SUCH FOR TREATING A DEGENERATIVE OR AN IMMUNE SYSTEM-RELATED DISEASE - There is provided a non-toxic composition and method of using such for treating a degenerative or an immune-related disease. The non-toxic composition comprises a sprouted grain composition comprising digestive enzymes, a clustered water composition, and a substantially undenatured whey protein composition. | 12-29-2011 |
20120003207 | METHODS AND COMPOSITIONS FOR MODULATING PROLINE LEVELS - Methods and compositions for modulating amino acid levels in a subject are provided herein. | 01-05-2012 |
20120009177 | GENE EXPRESSION MARKERS FOR PREDICTING RESPONSE TO INTERLEUKIN-6 RECEPTOR-INHIBITING MONOCLONAL ANTIBODY DRUG TREATMENT - This invention provides methods, compositions, and kits relating to gene product biomarkers where gene expression levels are correlated with therapeutic response of rheumatoid arthritis patients to treatment with an IL-6 receptor antagonist, such as an IL6-R antibody. The methods, compositions, and kits of the invention can be used to identify rheumatoid arthritis patients who are likely, or not likely, to respond to IL-6 receptor antagonist treatments. | 01-12-2012 |
20120009178 | TWEAK BINDING ANTIBODIES - Anti-Tweak antibodies are described. | 01-12-2012 |
20120020949 | MHC-LESS cells - The present disclosure relates to compositions, methods, systems, computer-implemented methods, and computer program products thereof that relate to biological cells for delivery of at least one therapeutic agent to a biological tissue or subject. | 01-26-2012 |
20120020950 | ANTIBACTERIAL COMPOUNDS - Disclosed are compounds of formula (I), which are of use in the treatment of bacterial diseases and infections, to compositions containing those compounds and to methods of treating bacterial diseases and infections using the compounds. In particular, the compounds are useful for the treatment of infection with, and diseases caused by, | 01-26-2012 |
20120020951 | Adverse side-effects associated with administration of anti-hyaluronan agents and methods for ameliorating or preventing the side-effects - Provided herein are methods for ameliorating an adverse effect of systemic administration of a PEG hyaluronan degrading enzyme to a subject. The methods involve systemically administering a PEGylated hyaluronan degrading enzyme, particularly a PEGylated hyaluronidase, such as any of the animal or bacterial hyaluronidases, to the subject and administering an amount of a corticosteroid sufficient to ameliorate the adverse effect. Also provided are method of treating a hyaluronan-associated disease or condition for single-agent therapy or combination therapy. | 01-26-2012 |
20120020952 | METHODS FOR PRODUCING MIXTURES OF ANTIBODIES - The invention relates to a method for producing a mixture comprising two or more different antibodies in a single recombinant host cell. In one embodiment, a mixture of different monovalent antibodies is produced. In another embodiment, a mixture of monovalent and bivalent antibodies is produced. The invention also relates to mixtures of antibodies obtainable by the method of the invention and to light chain sequences that are particularly useful in the method of the invention. | 01-26-2012 |
20120020953 | DIAGNOSIS AND TREATMENT OF CANCER - Provided herein are methods for diagnosing cancer by determining the level of expression of SETDB1 in a biological sample. Also provided herein are methods for treating cancer by administering an inhibitor of SETDB1 to a subject in need thereof. | 01-26-2012 |
20120020954 | METHODS OF PREDICTING CLINICAL COURSE AND TREATING MULTIPLE SCLEROSIS - Provided are methods and kits for classifying a subject as being more likely to have benign multiple sclerosis (BMS) or as being more likely to have typical relapsing remitting multiple sclerosis (RRMS). Classification of multiple sclerosis disease course is performed by comparing a level of expression of at least one gene involved in the RNA polymerase I pathway in a cell of the subject to a reference expression data of said at least one gene obtained from a cell of at least one subject pre-diagnosed as having BMS and/or from a cell of at least one subject pre-diagnosed as having typical RRMS, thereby classifying the subject as being more likely to have BMS or as being more likely to have typical RRMS. Also provided are methods of diagnosing and treating multiple sclerosis and methods of monitoring treatment efficiency. | 01-26-2012 |
20120034206 | BREAST CANCER ERADICATION PROGRAM - A method of treating breast cancer that is at least partially ER | 02-09-2012 |
20120039864 | GENETIC POLYMORPHISMS ASSOCIATED WITH VENOUS THROMBOSIS, METHODS OF DETECTION AND USES THEREOF - The present invention is based on the discovery of genetic polymorphisms that are associated with coronary heart disease and in particular VT and response to drug treatment. In particular, the present invention relates to nucleic acid molecules containing the polymorphisms, variant proteins encoded by such nucleic acid molecules, reagents for detecting the polymorphic nucleic acid molecules and proteins, and methods of using the nucleic acid and proteins as well as methods of using reagents for their detection. | 02-16-2012 |
20120039865 | IDENTIFICATION OF SORTILIN AS A NEURONAL RECEPTOR FOR THE FRONTOTEMPORAL DEMENTIA PROTEIN, PROGRANULIN - The present invention is related to methods for identifying compounds that modulate the interaction between progranulin and sortilin. The present invention is also related to methods for modulating the interaction between progranulin and sortilin, the activity of progranulin or sortilin, or the activity of progranulin and sortilin. The present invention also includes methods of treating or preventing a disease, disorder, or condition by modulating the interaction between progranulin and sortilin, the activity of progranulin or sortilin, or the activity of progranulin and sortilin. | 02-16-2012 |
20120039866 | METHODS OF TREATING PAIN - The invention relates to methods for treating pain disorders including neuropathic and inflammatory pain and to methods to reduce or eliminate nociceptive tolerance induced by opiate analgesic use by administering an agent that suppresses or blocks S1P biological activity. | 02-16-2012 |
20120039867 | Immune System Function in Conditions Characterized by Elevated Double Strand Breaks - Methods and compositions for improving immune system function are provided. These methods find particular use in improving immune system function in individuals with a condition in which naïve lymphocytes comprise elevated amounts of DNA double strand breaks (DSB), for example, individuals with Rheumatoid Arthritis, individuals that have received a bone marrow transplant, or elderly individuals, e.g. individuals that are 50 or more years old. Also provided are methods and compositions for screening for novel compounds that will improve immune system function in such individuals. | 02-16-2012 |
20120039868 | Biomarkers for Graft Rejection - Methods are disclosed for diagnosing rejection in a transplanted subject, monitoring rejection in a transplanted subject at risk thereof, preventing, inhibiting, reducing or treating rejection in a transplanted subject, or identifying agents for use in the prevention, inhibition, reduction or treatment of rejection, based on genes which are differentially expressed in transplanted subjects. | 02-16-2012 |
20120045429 | Methods and Agent for Modulating the RNA Polymerase II-Histone Surface - The present invention relates to the identification of an intranucleosomal DNA loop formed during transcription through a nucleosome and use of the same to identify an agent that modulates the RNA Polymerase II-histone surface. | 02-23-2012 |
20120045430 | DENDRIMER-LIKE MODULAR DELIVERY VECTOR - Various nucleic acid-based matrixes are provided, comprising nucleic acid monomers as building blocks, as well as nucleic acids encoding proteins, so as to produce novel biomaterials. The nucleic acids are used to form dendrimers that are useful as supports, vectors, carriers or delivery vehicles for a variety of compounds in biomedical and biotechnological applications. In particular, the macromolecules may be used for the delivery of drugs, genetic material, imaging components or other functional molecule to which they can be conjugated. An additional feature of the macromolecules is their ability to be targeted for certain organs, tumors, or types of tissues. Methods of utilizing such biomaterials include delivery of functional molecules to cells. | 02-23-2012 |
20120045431 | METHOD OF STABILIZING AND STERILIZING PEPTIDES OR PROTEINS - The present invention provides a method for sterilizing a protein-containing bioerodible implant. The sterilization is accomplished using β-radiation, or high energy electrons. Following sterilization the implant can be used in a variety of methods for the sustained release of a therapeutic protein to treat a disease or condition in a human or non-human subject. The sterilization process is compatible with proteins containing one or more disulfide bonds or easily oxidized methionine residues. | 02-23-2012 |
20120058105 | METHOD OF TREATMENT OF VASCULAR COMPLICATIONS - The present invention provides methods for the prevention or treatment of one or more vascular complication(s) in a subject at risk of developing diabetes mellitus, impaired glucose tolerance and/or hyperglycemia or a subject suffering from diabetes mellitus, impaired glucose tolerance and/or hyperglycemia, wherein an amount of a composition effective to inhibit, repress, delay or otherwise reduce expression and/or activity and/or level of TXNIP and/or an amount of a composition effective to induce, enhance or otherwise increase expression and/or activity and/or level of TRX is/are administered to a subject in need thereof. The present invention also provides methods for identifying and isolating modulators of TXNIP expression and/or activity and/or level and/or TRX expression and/or activity and/or level for use in such therapeutic and prophylactic methods. | 03-08-2012 |
20120058106 | NOVEL CANCER-ASSOCIATED ANTIGEN - The present invention provides a novel cancer-associated antigen that can be used in the treatment and diagnosis of cancer. Further, the invention provides amino acid and nucleic acid sequence of the novel antigen, binding proteins, and immunoconjugates. The invention also relates to diagnostic and therapeutic methods and kits. | 03-08-2012 |
20120058107 | PYRROLO [3,2-C] PYRIDINE-4-ONE 2-INDOLINONE PROTEIN KINASE INHIBITORS - The present invention relates to pyrrolo[3,2-c]pyridine-4-one 2-indolinone compounds of Formula (I) and their pharmaceutically acceptable salts thereof, wherein R | 03-08-2012 |
20120064060 | COMPOUND HAVING S1P RECEPTOR BINDING POTENCY AND USE THEREOF - Provided are: a compound represented by formula (I): | 03-15-2012 |
20120064061 | ADHESIVE COMPOSITION COMPRISING TANNIN, POLY(ETHYLENE GLYCOL), AND WATER, LOWER ALCOHOL OR MIXTURE THEREOF - Provided is an adhesive composition disclosed herein includes tannin, poly(ethylene glycol) and water. The adhesive composition has little toxicity, allows adhesion even in the absence of a thermosetting curing agent, and is hardly soluble in water to show moisture resistance, unlike known tannin adhesives. Therefore, the adhesive composition may be used as a medical adhesive, adhesive depot for sustained release of drug, anti-adhesion agent, cell/protein adsorption barrier and medical hemostatic applicable to various wet environments. | 03-15-2012 |
20120064062 | INHIBITORS OF BACTERIAL PLASMINOGEN ACTIVATORS - Organic compounds showing the ability to inhibit bacterial omptin proteases, specifically | 03-15-2012 |
20120064063 | Compositions of F(ab')2 Antibody Fragments - The present invention is directed to a pharmaceutical composition comprising F(ab′) | 03-15-2012 |
20120064064 | ANTIGEN-BINDING PROTEINS - The present invention relates to antigen binding proteins comprising an immunoglobulin heavy chain and an immunoglobulin light chain, wherein the heavy chain comprises an epitope binding domain linked to the n-terminus of CH1-CH2-CH3, and the light chain comprises an epitope binding domain linked to the n-terminus of CL, wherein one or more epitope-binding domains are linked to the C-terminus of the immunoglobulin heavy chain, and/or one or more epitope-binding domains are linked to the C-terminus of the immunoglobulin light chain, methods for making such proteins, and uses thereof. | 03-15-2012 |
20120070426 | PEPTIDE-BASED PASSIVE IMMUNIZATION THERAPY FOR THE TREATMENT OF ATHEROSCLEROSIS - The present invention relates to passive immunization for treating or preventing atherosclerosis using an isolated human antibody directed towards at least one oxidized fragment of apolipoprotein B in the manufacture of a pharmaceutical composition for therapeutical or prophylactical treatment of atherosclerosis by means of passive immunization, as well as method for preparing such antibodies, and a method for treating a mammal, preferably a human using such an antibody to provide for passive immunization. | 03-22-2012 |
20120070427 | VORTEX-INDUCED SILK FIBROIN GELATION FOR ENCAPSULATION AND DELIVERY - The present invention provided for a novel process of forming silk fibroin gels, and controlling the rate of β-sheet formation and resulting hydrogelation kinetics, by vortex treatment of silk fibroin solution. In addition, the vortex treatment of the present invention provides a silk fibroin gel that may be reversibly shear-thinned, enabling the use of these approach for precise control of silk self-assembly, both spatially and temporally. Active agents, including biological materials, viable cells or therapeutic agents, can be encapsulated in the hydrogels formed from the processes, and be used as delivery vehicles. Hence, the present invention provide for methods for silk fibroin gelation that are useful for biotechnological applications such as encapsulation and delivery of active agents, cells, and bioactive molecules. | 03-22-2012 |
20120076770 | Modulation of autophagy and and serotonin for treatment of multiple myeloma related diseases - THE INVENTION RELATES TO compounds, proteins and methods of treatment therewith. Aspects of embodiments of the invention further relates to compounds and methods of treatment for bone, bone marrow, and bone tissue. | 03-29-2012 |
20120076771 | SURFACE MODIFICATION OF SILK FIBROIN MATRICES WITH POLY(ETHYLENE GLYCOL) USEFUL AS ANTI-ADHESION BARRIERS AND ANTI-THROMBOTIC MATERIALS - The present invention provides compositions and methods for the production of silk fibroin matrices surface-PEGylated on one or more surfaces. Such surface-PEGylated silk fibroin matrices can be used in biomedical applications, such as anti-adhesive and anti-thrombosis materials. Silk matrices may be surface-PEGylated, for example, by a reaction with a functional group-activated PEG. Controlling the degree of PEGylation on surface of silk fibroin matrix can regulate both the degradation rate of the silk matrix, and the differentiated adhesion of cells or differentiated adsorption of proteins on the surface of the silk matrix. The present invention also provides for silk fibroin matrices having one or more surfaces possessing differentiated adhesion properties, which allows for tissue integration on the adherent side and inhibition of tissue adhesion to the opposing tissues or organs. Embedding active agents in silk fibroin matrices provides more benefits, such as promoting tissue ingrowth on the adherent side of the matrix. | 03-29-2012 |
20120076772 | STABILIZATION OF IMMUNOGLOBULINS THROUGH AQUEOUS FORMULATION WITH HISTIDINE AT WEAK ACIDIC TO NEUTRAL PH - The present invention provides, among other aspects, storage stabile aqueous formulations of immunoglobulins with histidine at a mildly acidic to neutral pH. The present invention also provides methods for stabilizing immunoglobulin compositions by formulating with histidine at a mildly acidic to neutral pH. Advantageously, the methods and formulations provided herein allow stabile aqueous compositions of immunoglobulins at mildly acidic to neutral pH useful for parenteral administration. | 03-29-2012 |
20120076773 | Novel Drug Delivery Devices - Compositions provided by contacting a biotin-containing component and an avidin-containing component are useful as drug delivery devices. Bioactive agents may be covalently bound to the biotin-containing component, the avidin-containing component, or both, mixed therewith, or combinations of the foregoing. | 03-29-2012 |
20120082658 | Methods for the Treatment of Allergic Diseases - The present invention is directed generally to a TLR8 agonist VTX-378, for use in the treatment or prevention of allergic diseases, including allergic rhinitis. | 04-05-2012 |
20120082659 | Methods And Compositions Related To Synergistic Responses To Oncogenic Mutations - Disclosed are compositions and methods related to new targets for cancer treatment. | 04-05-2012 |
20120082660 | ANTI-TNF INDUCED APOPTOSIS (ATIA) DIAGNOSTIC MARKERS AND THERAPIES - The invention features diagnostic and therapeutic methods and compositions featuring Anti-TNF Induced Apoptosis (ATIA). ATIA is useful as a diagnostic marker for cancer, in particular for glioblastoma. ATIA is also a therapeutic target in diseases such as cancer. The invention encompasses combination therapies where knockdown of ATIA is used in combination with other treatment. The invention also features kits for use in the diagnostic and therapeutic methods. | 04-05-2012 |
20120087909 | NEUTRALIZING MONOCLONAL ANTIBODIES TO RESPIRATORY SYNCYTIAL VIRUS - The present invention relates to the identification and cloning of a novel neutralizing human monoclonal antibody to the Respiratory Syncytial Virus. The invention provides such antibodies, fragments of such antibodies retaining RSV-binding ability, chimeric antibodies retaining RSV-binding ability, and pharmaceutical compositions including such antibodies. The invention further provides for isolated nucleic acids encoding the antibodies of the invention and host cells transformed therewith. Finally, the invention provides for diagnostic and therapeutic methods employing the antibodies and nucleic acids of the invention. | 04-12-2012 |
20120087910 | SPARC ANGIOGENIC DOMAIN AND METHODS OF USE - The invention provides compositions and methods which exploit the discovery of the SPARC carboxy angiogenic domain. | 04-12-2012 |
20120087911 | CRYSTAL STRUCTURE - This invention relates to a crystallisable composition comprising a TSHR polypeptide, to crystals comparing a TSHR polypeptide and to TSHR-related applications. | 04-12-2012 |
20120087912 | TREATMENT METHODS USING DKK-1 ANTIBODIES - The present invention provides antibodies and immunologically functional fragments thereof that specifically bind Dkk-1 polypeptides. The subject antibodies and fragments bind with high affinity to a conformational epitope located in the carboxy region of the Dkk-1 protein. Methods for preparing such antibodies or fragments thereof as well as physiologically acceptable compositions containing the antibodies or fragments are also provided. Use of the antibodies and fragments to treat various diseases including bone disorders, inflammatory diseases, neurological diseases, ocular diseases, renal diseases, pulmonary diseases and skin diseases are also disclosed. | 04-12-2012 |
20120093801 | TARGETED DELIVERY OF THERAPEUTIC AGENTS WITH LYOPHILIZED MATRICES - Embodiments of surgical grafts, and methods, for the delivery of therapeutic agents to a target tissue via acellular matrices, are described. In some embodiments, nonviable matrices are successful in preventing or lessening adhesion formation by guiding tissue repair and remodeling, while also providing the target tissue with therapeutic agents that can act as repair and remodeling factors. An exemplary method to modulate flexor tendon healing and provide elimination or reduction of fibrotic adhesions involves loading a freeze-dried flexor digitorum longus allograft with recombinant adeno-associated viral (rAAV) vectors for the targeted and transient expression of growth/differentiation factor 5 (GDF5). | 04-19-2012 |
20120093802 | BIOACTIVE COMPOSITION INCLUDING STABILIZED PROTEIN AND PROCESS FOR PRODUCING THE SAME - A bioactive composition includes a porous hydrogel matrix. At least one protein is immobilized in the porous hydrogel matrix forming a hydrogel protein composite that is stable in an organic solvent. A process for stabilizing a bioactive composition includes the steps of: forming hydrogel matrix pores around protein molecules and reducing a water content within the hydrogel matrix pores forming a hydrogel protein composite that is stable in an organic solvent. | 04-19-2012 |
20120093803 | MEANS AND METHODS OF STERILIZATION OF BIOFUNCTIONAL COMPOSITIONS - The present invention, inter alia, relates to a closed sterilized container comprising at least one carrier which is a stabilizer; and at least one biomolecule reversibly attached to the carrier, wherein said carrier partially or completely covers the attached biomolecules and wherein said at least one carrier is selected from the group consisting of (poly)peptides such as dipeptides or tripeptides, amino acids, polyalcohols, polyethyleneglycols, ionic liquids, compatible solutes, saponins and a mixture thereof. The invention also relates to methods for producing sterilized containers according to the invention and uses thereof. | 04-19-2012 |
20120093804 | Concatamers for Immunemodulation - The invention relates to a polymeric, non-coding nucleic acid molecule for modulation of the activity of the human and animal immune system as well as a method for the manufacture thereof and a vaccine, comprising the polymeric, non-coding nucleic acid molecule, wherein polymeric, non-coding nucleic acid molecules may be understood as non-coding nucleic acid molecules, comprising at least four covalently bound molecules (tetramer) or are assemblies of more non-coding nucleic acid molecules (high molecular polymers) which are covalently bound to each other. | 04-19-2012 |
20120100129 | N-Terminal Truncated Protofibrils/Oligomers for Use in Therapeutic and Diagnostic Methods for Alzheimer's Disease and Related Disorders - A vaccine for delaying onset of or for treatment of Alzheimer's disease or an Alzheimer-related disorder in an individual comprises a therapeutically effective amount of a physiologically acceptable protofibril/oligomer comprising N-terminal truncated Aβ. An antibody for delaying an onset of or for treatment of Alzheimer's disease or an Alzheimer-related disorder in an individual binds one or more truncated AO protofibrils/oligomers, but exhibits no or substantially no cross-reactivity with full length Aβ monomers, and optionally said antibody shows cross-reactivity to N-terminal truncated Aβ monomers. Methods for delaying an onset of or for treatment of Alzheimer's disease or an Alzheimer-related disorder employ the vaccine or antibody. Methods of detecting soluble N-terminal truncated amyloid-beta (Aβ) protofibrils/oligomers and N-terminal truncated Aβ monomers employ the antibody. | 04-26-2012 |
20120107301 | METHOD OF TREATING AUTOIMMUNE DISEASE BY INDUCING ANTIGEN PRESENTATION BY TOLERANCE INDUCING ANTIGEN PRESENTING CELLS - Antibodies to antigen presenting cells may be utilized to interfere with the interaction of the antigen presenting cell and immune cells, including T cells. Peptides may be linked to said antibodies thereby generating an immune response to such peptides. Preferably peptides linked to the antibodies are associated with autoimmunity. | 05-03-2012 |
20120114633 | Inhibitors Of Bacterial Type III Secretion System - Organic compounds showing the ability to inhibit effector toxin secretion or translocation mediated by bacterial type III secretion systems are disclosed. The disclosed type III secretion system inhibitor compounds are useful for combating infections by Gram-negative bacteria such as | 05-10-2012 |
20120114634 | METHODS FOR INDUCING A SUSTAINED IMMUNE RESPONSE AGAINST A B-CELL IDIOTYPE USING AUTOLOGOUS ANTI-IDIOTYPIC VACCINES - The present invention relates to methods of inducing and maintaining an immune response against a B-cell idiotype in a subject using an autologous anti-idiotypic vaccine. In one embodiment, the immune response is induced and maintained for treatment of a B-cell derived malignancy selected from among non-Hodgkin's lymphoma. Hodgkin's lymphoma, chronic lymphocytic leukemia, multiple myeloma, and mantle cell lymphoma. | 05-10-2012 |
20120121574 | ANTIMICROBIAL, ANTIVIRAL, ANTICANCER AND IMMUNOMODULATORY PEPTIDES AND USES THEREFORE - Polypeptides derived from constant domains of antibody light (L) and/or heavy (H) chains as well as from complementary determining regions (CDRs) of immunoglobulin variable regions are disclosed possessing broad spectrum biological activities including, among others, antifungal, antibacterial, antiviral, anticancer and/or immunomodulatory activity in vitro, ex vivo and/or in vivo. | 05-17-2012 |
20120121575 | PROHIBITIN AS TARGET FOR CANCER THERAPY - The present invention relates to pharmaceutical compositions comprising inhibitors of Prohibitin (PHB) for the prevention or/and treatment of hyperproliferative disorders. | 05-17-2012 |
20120121576 | ACTRIIA BINDING AGENTS AND USES THEREOF - The disclosure provides, among other aspects, neutralizing antibodies and portions thereof that bind to ActRIIA and uses for same. | 05-17-2012 |
20120121577 | ANTIBODIES AS T CELL RECEPTOR MIMICS, METHODS OF PRODUCTION AND USES THEREOF - Antibodies are produced that recognize peptides displayed in the context of MHC molecules and thus mimic the specificity of a T cell receptor (TCR). The antibodies are produced by immunizing a host with at least one peptide/MHC complex to elicit an immune response thereto. The desired antibodies can differentiate the peptide/MHC complex from the MHC molecule alone, the peptide alone, and a complex of MHC and irrelevant peptide. Finally, the desired antibodies are isolated. | 05-17-2012 |
20120121578 | METHODS OF USING IMMUNOGLOBULIN AGGREGATES - The current invention provides a method of treating a mammal in need of such treatment with aggregated IgG derived from pooled human plasma. The invention further provides using the discarded fraction obtained during the course of standard IgG fractionation as the source of the aggregated IgG. The methods of the invention further provide for enhancing the aggregation of the aggregate fraction as well as enriching and modifying glycoforms. | 05-17-2012 |
20120121579 | TREATMENT OF ONCOSTATIN M RECEPTOR BETA MEDIATED HEART FAILURE - The present invention relates to an inhibitor of the oncostatin M receptor β or an inhibitor of an activator of the oncostatin M receptor β for use in the treatment and/or prevention of heart failure. The present invention also relates to a method of treating and/or preventing heart failure comprising administering a pharmaceutically effective amount of an inhibitor of the oncostatin M receptor β or an inhibitor of an activator of the oncostatin M receptor β to a subject in need thereof. Further, the present invention also relates to methods of identifying a compound suitable as a lead compound and/or as a medicament for the treatment and/or prevention of heart failure. | 05-17-2012 |
20120121580 | METHODS FOR PRODUCING HIGH CONCENTRATION LYOPHILIZED PHARMACEUTICAL FORMULATIONS - The present invention relates to methods of producing lyophilized pharmaceutical compositions comprising a high concentration of therapeutic protein or antibody prior to lyophilization, wherein the lyophilized formulation can be reconstituted with a diluent in about 15 minutes or less. The invention also relates to the high concentration lyophilized formulations produced by the methods described herein. The lyophilized formulations produced by the methods of the invention are stable and are suitable for veterinary and human medical use and are suitable for modes of administration including oral, pulmonary and parenteral, such as intravenous, intramuscular, intraperitoneal, or subcutaneous injection. Also provided by the invention are high concentration pharmaceutical compositions that have long term stability and can be reconstituted, following lyophilization, in a short period of time, preferably 15 minutes or less. | 05-17-2012 |
20120128656 | Vaccine compositions and methods - The present invention relates to pharmaceutical vaccine compositions comprising at least one vaccine antigen together with living immune cells. These immune cells include at least a portion of activated T-cells and act as an adjuvant. Methods for using these pharmaceutical compositions to prevent or treat diseases, such as cancer, infectious diseases and autoimmune disease are also included. | 05-24-2012 |
20120128657 | SYNTHETIC MACROCYCLIC COMPOUNDS AND METHODS FOR TREATING CANCER - Disclosed herein are macrocyclic compounds that are effective to inhibit cell migration. In one embodiment, the compounds have the structure: or any pharmaceutically acceptable salt or solvate thereof, wherein: m is 0 or 1; R | 05-24-2012 |
20120128658 | RAGE G82S-RELATED METHODS AND COMPOSITIONS FOR TREATING INFLAMMATORY DISORDERS - This invention provides methods, compositions and articles of manufacture for inhibiting the onset of and treating inflammatory disorders such as rheumatoid arthritis. The instant invention is based on the blockade of RAGE G82S function. | 05-24-2012 |
20120128659 | AGENTS CAPABLE OF DOWNREGULATING AN MSF-A - DEPENDENT HIF-1ALPHA AND USE THEREOF IN CANCER TREATMENT - Methods and pharmaceutical compositions for the treatment of cancer or acute ischemia are provided. Also provided are methods of identifying agents capable of preventing the formation of or dissociating the MSF-A-HIF-1alpha protein complex, and methods of determining the prognosis of an individual having cancer by identifying the presence or absence of such a protein complex. | 05-24-2012 |
20120128660 | DIAGNOSIS OF RESTENOSIS IN PATIENTS UNDERGOING PERCUTANEOUS CORONARY INTERVENTION - The present invention relates to compounds, compositions, methods and/or kits for determining and/or predicting and/or diagnosing and/or treating restenosis in a patient. | 05-24-2012 |
20120134981 | GENES LINKING SEVERAL COMPLICATIONS OF TYPE-2 DIABETES (T2D) - The invention provides means and methods to predict, in subjects affected by type II diabetes (T2D), the probability of developing complications which include, but are not limited to, micro/macrovascular disorder, hypertension, neuropathy, atrial fibrillation, nephropathy and other major adverse cardiovascular events (MACE) that are associated with the disease, by detecting one or more genetic features. The genetic features that are useful in prediction include, but are not limited to, genes, single nucleotide polymorphisms (SNPs) and other genomic markers. The invention further involves characterizing individuals based on the probability of developing complications related to T2D, such as, micro/macrovascular disorder, hypertension, neuropathy, atrial fibrillation, nephropathy or MACE, based on the identification of one or more aforementioned genetic features. Also described are combinations and kits for carrying out the above-described methods. | 05-31-2012 |
20120134982 | POLYPEPTIDES, ANTIBODY VARIABLE DOMAINS & ANTAGONISTS - The present invention relates to polypeptides e.g. protease resistant polypeptides, immunoglobulin (antibody) single variable domains e.g. which are protease resistant and also to vascular endothelial growth factor (VEGF) antagonists comprising these. The invention further relates to uses, formulations, and compositions comprising such polypeptides e.g. for delivery to the eye. | 05-31-2012 |
20120134983 | Method for Identifying Interventions that Control the Translational Activity of Ribosomal Proteins in Different MRNA Expression - The present invention relates to systems and methods for screening compounds and/or mutant ribosomal proteins in a eukaryotic cell that increase or decrease the translation of a target gene and thereby ameliorate or revert a defective and/or undesired translation of a target gene. Disclosed are compounds and proteins as identified with the methods and systems of the invention, pharmaceutical and cosmetic compositions thereof, their uses for the preparation of a medicament, methods of treatment of a disease or condition or cosmetic condition related to the defective translation of a gene, for example genetic diseases such as Epidermolysis bullosa, as well as diagnostic measures practical for the clinical evaluation of such diseases or conditions. Also, kits are provided which comprise the identified compounds and/or proteins in addition to suitable means for performing the methods of the invention | 05-31-2012 |
20120134984 | MOLECULES WITH EXTENDED HALF-LIVES AND USES THEREOF - The invention is directed to a molecule comprising an albumin binding domain (ABD) and an FcRn binding moiety, wherein said molecule has enhanced pharmacologic properties in vivo. | 05-31-2012 |
20120141456 | Use of DR6 and p75 Antagonists to Promote Survival of Cells of the Nervous System - The present invention relates to Death Receptor-6 (DR6) proteins which are members of the tumor necrosis factor (TNF) receptor family, and have now been shown to be important for regulating apoptosis in cells of the nervous system. In addition, it has been discovered that p75 is a ligand for DR6. As a result, this invention relates to methods for inhibiting the interaction of DR6 and p75 using DR6 and/or p75 antagonists. In addition, the methods described herein include methods of promoting survival of cells of the nervous system using DR6 antagonists, optionally in combination with p75 antagonists, and methods of treating neurodegenerative conditions by the administration of a DR6 antagonists, optionally in combination with a p75 antagonist. | 06-07-2012 |
20120141457 | Lateral Flow Immunoassay for Complement Activation and Methods of Use for Point-of-Care Assessment of Complement-Associated Disorders - A method for treating an individual at risk for a complement-associated disorder is provided, including: (a) obtaining a sample of a body fluid from the individual; (b) measuring a complement activation level in the sample via a point-of-care lateral flow immunoassay; (c) correlating the complement activation level in the sample to a risk of a complement-associated disorder by comparing the complement activation level in the sample to a reference level in a control, wherein a deviation in complement activation level in the sample compared to the reference level in the control indicates the individual is at risk for a complement-associated disorder; (d) selecting a treatment for the individual, based on the correlating of step (c); and (e) treating the individual with the treatment selected in accordance with step (d). Lateral flow immunoassays and a method of monitoring an individual suffering from a complement-associated disorder are also provided herein. | 06-07-2012 |
20120141458 | COMPOSITIONS AND METHODS FOR TREATMENT IN BROAD-SPECTRUM, UNDIFFERENTIATED OR MIXED CLINICAL APPLICATIONS - The disclosure provides improved compositions and methods for passive immunization. In embodiments, a composition comprising a synergistic combination of specific polyclonal antibodies in a carrier matrix is provided. The disclosure provides effective, economical compositions and methods for the treatment of diarrhea and enteric infections in broad-spectrum, undifferentiated, or mixed clinical applications. | 06-07-2012 |
20120141459 | MOLECULAR TARGETS FOR ALS AND RELATED DISORDERS - Provided herein are compositions and methods for diagnosis, risk assessment, research, and therapy related to amyotrophic lateral sclerosis (ALS) and ALS-related disorders. In particular, the present invention relates to mutations in the UBQLN2 gene that cause dominantly inherited chromosome X-linked ALS and ALS/dementia. | 06-07-2012 |
20120141460 | METHOD FOR THE PRODUCTION OF VARIABLE DOMAINS - The present invention provides methods for the expression and/or production of variable domains with a C-terminal extension that can be used for coupling of the variable domain to one or more further groups, residues or moieties. In the method of the invention a yield of at least 80% of variable domains with a cysteine containing C-terminal extension is obtained. Also variable domains are provided and polypeptides comprising one or more variable domains obtainable by the methods of the present invention, as well as compounds that comprise such variable domains and/or polypeptides coupled to one or more groups, residues or moieties. | 06-07-2012 |
20120141461 | COMPOSITIONS AND METHODS FOR DIAGNOSING AND TREATING FIBROTIC DISORDERS - The present invention relates to biomarkers, therapeutic targets, and therapeutic agents for treating and diagnosing firotic disorders. In particular, the present invention relates to diagnosis, drug screening, and therapeutic targeting of NOX4 biomarkers of pulmonary fibrosis and other fibrotic diseases and conditions. | 06-07-2012 |
20120148564 | METHODS OF USING SNS-595 FOR TREATMENT OF CANCER SUBJECTS WITH REDUCED BRCA2 ACTIVITY - Methods of using SNS-595 for treatment of a subject having cancer with BRCA2 mutation are described. In certain embodiments, the methods comprise administering a therapeutically effective amount of SNS-595 to a subject in need thereof. | 06-14-2012 |
20120148565 | INCREASING LIFESPAN BY MODULATION OF WWP-1 AND UBC-18 - Ubiquitin ligase wwp-1 and ubiquitin conjugating enzyme ubc-18 are identified in nematodes as mediators of dietary restriction induced longevity and therefore as targets for modulation of lifespan in animals. Methods of screening for compounds that modulate longevity by assaying wwp-1 ubiquitination pathway parameters are provided, as are related systems. In addition, methods of using wwp-1 and/or ubc-18 to modulate longevity or delay onset of age-related diseases are described. | 06-14-2012 |
20120148566 | PRODUCT AND METHOD FOR TREATMENT OF CONDITIONS ASSOCIATED WITH RECEPTOR-DESENSITIZATION - Particular members of the multisubunit immune recognition receptor (MIRR) family of receptors, specifically, the B cell antigen receptor (BCR), the pre-B cell receptor (pre-BCR), the pro-B cell receptor (pro-BCR), Ig Fc receptors (FcR), and NK receptors, can be physically uncoupled from their associated transducers. The invention describes regulatory compounds and methods for mimicking such dissociation/destabilization for the purposes of receptor desensitization and for treatment of conditions in which receptor desensitization or alternatively, enhanced or prolonged receptor sensitization, is desirable. Compounds and methods for enhancing or prolonging receptor sensitization are also disclosed, as are methods for identifying regulatory compounds suitable for use in the present methods. | 06-14-2012 |
20120148567 | PARTICULATE HYALURONIC ACID FORMULATIONS FOR CELLULAR DELIVERY OF BIOACTIVE AGENTS - There is presently provided a suspension of immiscible particles in a solution, wherein the particles comprise an agglomeration of a bioactive agent; and a plurality of conjugates of a hyaluronic acid and a flavonoid wherein the particles are on average from about 15 nm to about 300 nm in diameter and wherein the bioactive agent is releasably retained in the particles by the flavonoid. There is also provided a therapeutic formulation comprising such a suspension and methods for using the suspension and therapeutic formulation, including for delivery of a bioactive agent to a cell and for treating a disease, including cancer. | 06-14-2012 |
20120148568 | Variant Immunoglobulins with Improved Manufacturability - This invention relates to the modification of the amino acid sequence of an immunoglobulin molecule at certain key positions within regions of the VH and VL FR and CDR3 domains and/or the CH1 domain which are prone to aggregation. Immunoglobulins modified as described may display improved manufacturability, for example, reduced aggregation propensity and/or increased production levels. | 06-14-2012 |
20120148569 | PICRORHIZA KURROA EXTRACT FOR PREVENTION, ELIMINATION AND TREATMENT OF INFECTION DISEASES - An anti-viral composition comprising terpenes and fatty acids found in the Scophulariaceae family of plants is disclosed. It further comprises other lipophillic constituents and the aglycons of the glycosides occurring in said family of plants. Preferably, the composition is derived by extraction of the roots and rhizomes of mixtures of | 06-14-2012 |
20120148570 | METHODS AND COMPOSITIONS FOR TREATING RESPIRATORY DISEASE-CHALLENGED ANIMALS - Methods and compostions are disclosed for modulating the immune system of animals. Applicant has identified that oral administration of immunoglobulins purified from animal blood can modulate the immune system for treatment of respiratory disease challenges, as well as modulate serum IgG levels for treatment of immune dysfunction disorders, potentiation of vaccination protocols, and improvement of overall health and weight gain in animals, including humans. | 06-14-2012 |
20120156191 | ANTI-JAM-A ANTIBODIES - The present invention relates to novel isolated antibodies, derived compounds, and functional isolated antibody fragments, capable of inhibiting the proliferation of tumor cells in vitro and/or in vivo and obtained by functional screening. | 06-21-2012 |
20120156192 | Treatment of Diseases and Disorders Using Self-Renewing Colony Forming Cells Cultured and Expanded In Vitro - The present invention relates to methods and uses of cells for the prevention and treatment of a wide variety of diseases and disorders and the repair and regeneration of tissues and organs using low passage and extensively passaged in vitro cultured, self-renewing, colony forming somatic cells (CF-SC). For example, adult bone marrow-derived somatic cells (ABM-SC), or compositions produced by such cells, are useful alone or in combination with other components for treating, for example, cardiovascular, neurological, integumentary, dermatological, periodontal, and immune mediated diseases, disorders, pathologies, and injuries. | 06-21-2012 |
20120156193 | Antibodies That Specifically Bind to A Beta Oligomers and Use Thereof - The present inventors successfully produced monoclonal antibodies that are specific to only soluble A beta oligomers, but do not recognize soluble A beta monomers, which are physiological molecules. It was demonstrated that the anti-bodies are useful as diagnostic/therapeutic monoclonal antibodies for Alzheimer's disease. | 06-21-2012 |
20120164133 | METHODS OF IDENTIFYING AN ORGANISM - This disclosure features methods of identifying an organism. The methods include: (a) obtaining a nucleic acid sample from an organism; (b) imaging said nucleic acid; (c) obtaining a restriction map of said nucleic acid; and (d) correlating the restriction map of said nucleic acid with a restriction map database, thereby identifying the organism. | 06-28-2012 |
20120164134 | SUGAR-FREE CHEWABLE SUPPLEMENT - A sugar-free chewable composition for delivering dietary supplements and pharmaceutical compounds. The chewable composition includes a sugar-free delivery vehicle and an active ingredient. The delivery vehicle may include a sugar-free gummy candy. The active ingredient may include an over-the-counter drug or a prescription drug to provide a desired effect on the user. The active ingredient may also include any combination of nutraceuticals, vitamins, minerals, antioxidants, soluble and insoluble fiber, herbs, plants, amino acids, probiotics, prebiotics, and digestive enzymes. | 06-28-2012 |
20120164135 | METHOD FOR PREPARING COMPREHENSIVE ANTI-SURFACE ANTIBODY USING MICROORGANISM IMMOBILIZED AS ANTIGEN WITH PROTEIN CROSSLINKING AND IMMOBILIZATION REAGENT - A method for preparing comprehensive antibodies against whole proteins that are expressed on the surface of a microorganism and the comprehensive antibodies obtained by the method are provided. The method for preparing comprehensive antibodies against whole proteins that are expressed on the surface of a microorganism comprises:
| 06-28-2012 |
20120164136 | Compositions and Methods for Treatment of Cancer by Disrupting the LH/LHR Signaling Pathway - The present invention discloses compositions and methods for treating diseases such as cancer by targeting luteinizing hormone (LH) or its receptor (LHR) involved in androgen synthesis or testosterone production. | 06-28-2012 |
20120171193 | Diagnostic and Treatment Methods for Characterizing Bacterial Microbiota in Skin Conditions - The present invention relates to methods for characterization of bacterial skin microbiota to provide diagnostic, therapeutic, and preventive measures for alleviating skin conditions. In certain embodiments, the invention relates to characterization of bacterial skin microbiota associated with psoriasis and related diagnostic, therapeutic, and preventive measures for alleviating psoriasis. These methods will be useful for detecting, diagnosing, and monitoring individuals who have or are at risk of certain skin conditions. | 07-05-2012 |
20120171194 | Method of Cell Differentiation and Uses Therefor in Screening, Diagnosis and Therapy - The present invention provides a method of producing non-haematopoietic cells, in particular cells having one or more properties of endothelial cells, from monocytes. A range of diagnostic and prognostic assay methods for determining whether or not a subject has atherosclerosis or vascular complication associated therewith, or a predisposition for developing atherosclerosis or complication associated therewith employing this method are provided. A range of screens to identify and isolate compositions of matter that modulate the ability of monocytes to differentiate into such non-haematopoietic cells and/or that modulate the ability of such non-haematopoietic cells to become incorporated into endothelium e.g., vascular endothelium, are also provided. | 07-05-2012 |
20120177632 | METHODS OF OPTIMIZING DISEASE TREATMENT - Provided are methods for optimizing treatment of an autoimmune disease in a subject, methods for identifying and/or selecting a compound as a therapeutic for an autoimmune disease, methods of identifying a patient that is responsive to IFN-β therapy, and methods for identifying an agent that inhibits NLRP | 07-12-2012 |
20120177633 | Methods for accelerating the healing of connective tissue injuries and disorders - The invention is directed to methods for accelerating the healing of connective tissue injuries and disorders. In particular, the invention is directed to accelerating the healing of injuries and disorders of tendons and ligaments. Such methods utilize novel compositions including, but not limited to, extraembryonic cytokine-secreting cells (herein referred to as ECS cells), including, but not limited to, Amnion-derived Multipotent Progenitor cells (herein referred to as AMP cells) and conditioned media derived therefrom (herein referred to as Amnion-derived Cellular Cytokine Solution or ACCS), including pooled ACCS, and Physiologic Cytokine Solution (PCS). | 07-12-2012 |
20120177634 | DEMETHYLPENCLOMEDINE ANALOGS AND THEIR USE AS ANTI-CANCER AGENTS - This disclosure concerns novel demethylpenclomedine analogs. Also disclosed are pharmaceutical compositions and methods for using such compositions to treat hyperproliferative disorders. In one embodiment the analogs are represented by the formula | 07-12-2012 |
20120183527 | MEASUREMENT OF ANTI-AMYLOID ANTIBODIES IN HUMAN BLOOD - The present invention provides improved immunoaffinity methods for detecting high avidity anti-amyloid antibodies present in a biological sample. In other aspects, the present invention provides methods for diagnosing diseases associated with amyloid proteins. Also provided by the present invention are methods for identifying candidates likely to respond to treatment comprising administration of an immunoglobulin preparation. | 07-19-2012 |
20120183528 | PNMT AS A NOVEL MARKER FOR PROGENITOR CELLS - In certain aspects, the present invention provides methods and compositions relating to a Pnmt-positive progenitor cell. In certain aspects, the present invention relates to methods for isolating and transplanting the subject progenitor cells, and methods for treating diseases such as myocardiac injuries and neurodegenerative disorders. | 07-19-2012 |
20120183529 | COMPOSITIONS AND METHODS OF USE FOR THERAPEUTIC ANTIBODIES - The present invention relates to antibodies that specifically bind to the BAFF receptor (BAFFR). The invention more specifically relates to specific antibodies that are BAFFR antagonists with in vivo B cell depleting activity and compositions and methods of use for said antibodies to treat pathological disorders that can be treated by killing or depleting B cells, such as systemic lupus erythematosus or rheumatoid arthritis or other autoimmune diseases or lymphomas, leukemias and myelomas. | 07-19-2012 |
20120183530 | STABILIZED IMMUNE MODULATORY RNA (SIMRA) COMPOUNDS - The invention relates to the therapeutic use of novel stabilized oligoribonucleotides as immune modulatory agents for immune therapy applications. Specifically, the invention provides novel RNA-based oligoribonucleotides with improved nuclease and RNase stability and that have immune modulatory activity through TLR7 and/or TLR8. | 07-19-2012 |
20120183531 | Methods for Inhibiting Yellow Color Formation in a Composition - The present invention is related to methods for preventing or retarding (i.e., inhibiting) yellow color or peroxide formation in a composition. The present invention is also related to methods of reducing or decreasing the amount of yellow color or peroxide in a composition. More specifically, the present invention relates to the use of an antioxidant, an oxygen scavenger, pH, a chelating agent, and/or at least two factors in the methods of the invention. The present invention is also related to methods for predicting the rate of yellow color or peroxide formation in a composition. | 07-19-2012 |
20120183532 | COMPOUNDS STIMULATING UNDESIRABLE CELLULAR ADHESION AND APPLICATIONS THEREOF - The invention relates to non-glycosylated proteins, based on the Kre9 protein of | 07-19-2012 |
20120189612 | COMPOSITIONS AND METHODS FOR TREATING CANCER WHILE PREVENTING OR REDUCING CARDIOTOXICITY AND/OR CARDIOMYOPATHY - The present invention provides methods for treating cardiotoxicity, cardiomyopathy, and/or cancer in a subject, as well as related compositions and kits, that employ a therapeutic agent, or a nucleic acid sequence encoding a therapeutic agent, selected from apolipoprotein A-1 (ApoA1), an ApoA1 mimetic, an agent that increases expression of ApoA1, or a binding agent specific for oxidized ApoA1, where the therapeutic agent is effective in preventing or reducing the level of cardiotoxicity and/or cardiomyopathy induced by the chemotherapeutic. | 07-26-2012 |
20120189613 | STIM2-MEDIATED CAPACITIVE CALCIUM ENTRY - The present invention relates to a pharmaceutical composition comprising an inhibitor of STIM2 or an inhibitor of STIM2-regulated plasma membrane calcium channel activity and optionally a pharmaceutically acceptable carrier, excipient and/or diluent. Furthermore, the present invention relates to an inhibitor of STIM2 or an inhibitor of STIM2-regulated plasma membrane calcium channel activity for the treatment and/or prevention of a neurological disorder associated with pathologically increased cytosolic calcium concentrations. Also disclosed are methods of treating and/or preventing a neurological disorder associated with pathologically increased cytosolic calcium concentrations comprising administering a pharmaceutically effective amount of an inhibitor of STIM2 or of an inhibitor of STIM2-regulated plasma membrane calcium channel activity to a subject in need thereof. The present invention further relates to methods of identifying a compound suitable as a lead compound and/or as a medicament for the treatment and/or prevention of a neurological disorder associated with pathologically increased cytosolic calcium concentrations. | 07-26-2012 |
20120189614 | INHIBITORS OF FILOVIRUS ENTRY INTO HOST CELLS - Organic compounds showing the ability to inhibit viral glycoprotein (GP)-mediated entry of a filovirus into a host cell are disclosed. The disclosed filovirus entry inhibitor compounds are useful for treating, preventing, or reducing the spread of infections by filovirus including the type species Marburg virus (MARV) and Ebola virus (EBOV). Preferred inhibitors of the invention provide therapeutic agents for combating the Ivory Coast, Sudan, Zaire, Bundibugyo, and Reston Ebola virus strains. | 07-26-2012 |
20120189615 | CROSS- STRUCTURE COMPRISING AMYLOID-BINDING PROTEINS AND METHODS FOR DETECTION OF THE CROSS- STRUCTURE, FOR MODULATING CROSS- STRUCTURES FIBER FORMATION AND FOR MODULATING CROSS- STRUCTURE-MEDIATED TOXICITY - The invention relates to the field of biochemistry, molecular biology, structural biology and medicine. More in particular, the invention relates to cross-β structures and the biological role of these cross-β structures. In one embodiment, the invention discloses a method for modulating extracellular protein degradation and/or protein clearance comprising modulating cross-β(beta) structure formation (and/or cross-β structure-mediated activity) of the protein present in the circulation. | 07-26-2012 |
20120189616 | ISOSORBIDE NITRATES - The present invention relates to new 3-substituted 6-nitrooxy-hexahydrofuro[3,2-b]furane derivatives possessing a superior pharmacological activity in thrombosis and in coronary ischemia models. | 07-26-2012 |
20120195879 | CARRIER IMMUNOGLOBULINS AND USES THEREOF - Disclosed is an isolated antigen binding protein, such as but not limited to, an antibody or antibody fragment. Also disclosed are pharmaceutical compositions and medicaments comprising the antigen binding protein, isolated nucleic acid encoding it, vectors, host cells, and hybridomas useful in methods of making it. In some embodiments the antigen binding protein comprises one to twenty-four pharmacologically active chemical moieties conjugated thereto, such as a pharmacologically active polypeptide. | 08-02-2012 |
20120195880 | Modulation of Synaptic Maintenance - C1q is shown to be expressed in neurons, where it acts as a signal for synapse elimination. Methods are provided for protecting or treating an individual suffering from adverse effects of synapse loss. These findings have broad implications for a variety of clinical conditions, including Alzheimer's disease. | 08-02-2012 |
20120195881 | PENTAFLUOROSULFUR IMINO HETEROCYCLIC COMPOUNDS AS BACE-1 INHIBITORS, COMPOSITIONS AND THEIR USE - In its many embodiments, the present invention provides certain pentafluorosulfur imino heterocyclic compounds, including compounds Formula (a) and pharmaceutically acceptable salts thereof. Compounds of Formula (a) have the general structure: (a) wherein each variable is selected independently and as defined herein. Pharmaceutical compositions comprising one or more such compounds (alone and in combination with one or more other active agents), and methods for their preparation and use in treating pathologies associated with amyloid beta (Aβ) protein, including Alzheimers Disease, are also disclosed. | 08-02-2012 |
20120195882 | LIPOPARTICLE COMPRISING A PROTEIN AND METHODS OF MAKING AND USING THE SAME - Enveloped virus vectors are described which comprise a cellular virus receptor protein and which are capable of fusing with a cell which comprises a viral envelope protein to which the cellular virus receptor protein is cognate. Enveloped virus vectors comprising a plurality of cellular virus receptor proteins are also described. Methods for making the enveloped virus vectors are described, as are methods of using the enveloped virus vectors. The invention further relates to a lipoparticle comprising a membrane spanning protein, and the lipoparticle can be attached to a sensor surface. The invention relates to methods of producing and using the lipoparticle to, inter alia, assess protein binding interactions. | 08-02-2012 |
20120195883 | MONOCOT SEED PRODUCT COMPRISING A HUMAN BLOOD PROTEIN - The invention is directed to blood proteins produced in monocot seeds and isolated therefrom for use in therapeutic compositions, as well as to methods of making these isolated blood proteins and to therapeutic compositions comprising them. | 08-02-2012 |
20120201806 | LIQUID-RETAINING ELASTOMERIC COMPOSITIONS - Disclosed are compositions-of-matter composed of a continuous elastomeric matrix and a liquid; the matrix entrapping the liquid therein in the form of closed-cell droplets dispersed throughout the matrix. The disclosed compositions-of-matter are characterized by a low tensile/compressive modulus and are capable of retaining the liquid for exceedingly long periods of time. Further disclosed are processes for forming the compositions-of-matter and uses thereof. | 08-09-2012 |
20120201807 | MODULATION OF IMMUNOSTIMULATORY PROPERTIES OF OLIGONUCLEOTIDE-BASED COMPOUNDS BY UTILIZING MODIFIED IMMUNOSTIMULATORY DINUCLEOTIDES - The invention relates to the therapeutic use of oligonucleotides as immunostimulatory agents in immunotherapy applications. More particularly, the invention provides immunomers and immunostimulatory oligonucleotides for use in methods for generating an immune response or for treating a patient in need of immunostimulation. The immunomers and immunostimulatory oligonucleotides of the invention preferably comprise novel purines. The immunomers according to the invention further comprise at least two oligonucleotides linked at their 3′ ends, internucleoside linkages or functionalized nucleobase or sugar to a non-nucleotidic linker, at least one of the oligonucleotides being an immunomodulatory oligonucleotide and having an accessible 5′ end. | 08-09-2012 |
20120201808 | Stem Cell Fusion Model of Carcinogenesis - Methods for modeling cancer cell migration, screening drugs for effects on tumor cell migration, and detecting the potential for tumor cell migration relating to the fusion of a bone marrow derived stem cell with a genetically altered cell. Antibodies against ubiquitin are shown to inhibit tumor cell migration. | 08-09-2012 |
20120207744 | REPROGRAMMING COMPOSITIONS AND METHODS OF USING THE SAME - The present invention provides compositions and methods of using the compositions to alter the developmental potency of a cell. The present invention provides in vivo and ex vivo cell reprogramming and programming methods suitable for autologous cell therapy and regenerative medicine. | 08-16-2012 |
20120207745 | Composition to Induce Specific Immune Tolerance - The invention relates to a composition which induces, in a host, an immune tolerance to a peptidic or proteic active principle, said composition comprising red blood cells containing an active principle selected from the group consisting of a therapeutic peptide, polypeptide or protein, a peptidic or proteic autoantigen, peptide, polypeptide or protein inducing an allergic reaction and a transplantation peptidic or proteic antigen. | 08-16-2012 |
20120213766 | Anticancer Compounds from Vernonia Guineensis - This invention relates to novel compounds with anticancer activity isolated from | 08-23-2012 |
20120213767 | Extended Soluble PH20 Polypeptides and uses thereof - Soluble PH20 polypeptides are provided, including extended soluble PH20 polypeptides, and uses thereof. Also provided are other C-terminally truncated PH20 polypeptides and partially deglycosylated PH20 polypeptides and uses thereof. | 08-23-2012 |
20120213768 | Diagnostic and Therapeutic Uses for B Cell Maturation Antigen - Biomarkers and therapies against autoimmune diseases, including systemic lupus erythematosus (SLE) are described herein. The present invention is based on the discovery of B cell maturation antigen (BCMA) and BCMA variant expression on SLE monocytes that can be directly associated with disease activity. The findings of the present invention enable the design of monoclonal antibodies or recombinant proteins that can block BCMA and BCMA variants as well as BCMA-bound APRIL. | 08-23-2012 |
20120213769 | METHODS OF DIAGNOSING AMYOTROPHIC LATERAL SCLEROSIS (ALS) - A method of diagnosing amyotrophic lateral sclerosis (ALS) in a subject in need thereof is provided. The method comprising determining in cells of the subject at least one alteration in a sequence or expression level of Cytoplasmic FMR Interacting Protein (CyFIP2; Accession AF160973) and/or Retinoblastoma Binding Protein 9 (RbBP9; Accession AF039564), wherein an altered sequence or expression of the sequence or expression level of the CyFIP2; Accession AF160973) or Retinoblastoma Binding Protein 9 (RbBP9; Accession AF039564) as compared to a control reference sample from a non-ALS subject, is indicative of ALS. The present teachings may be implemented in screening for novel anti-ALS medicaments and for treating ALS. | 08-23-2012 |
20120219540 | COMPOSITIONS AND METHODS FOR MODULATING IMMUNE RESPONSES - The present invention provides a newly identified B7 receptor, zB7R1 that functions as lymphocyte inhibitory receptor, which is a PD-1-like molecule and is expressed on T cells. The present invention also provides the discovery of zB7R1's ability to bind to CD155. Methods and compositions for modulating zB7R1-mediated negative signaling and interfering with the interaction of its counter-receptor for therapeutic, diagnostic and research purposes are also provided. | 08-30-2012 |
20120219541 | Therapeutic Compositions Comprising Monoterpenes - This invention provides a compositions for transport of a therapeutic agent. The compositions contain a therapeutic agent and a monoterpene or an analog thereof. In one aspect, the monoterpene is perillyl alcohol (POH) or an analog thereof. In one aspect, the therapeutic agent is provided in an amount effective to treat the disease or subject of choice. | 08-30-2012 |
20120219542 | PODOCYTE PH MODULATION AND USES THEREOF - Compositions are directed to the treatment of kidney diseases in a cell-specific manner. Methods of treating kidney diseases comprise the use of the compositions. Assays for identification of further compounds are provided. Biomarkers for predisposition to kidney diseases and diagnosis are identified. | 08-30-2012 |
20120219543 | METHODS AND PHARMACEUTICAL COMPOSITIONS FOR THE TREATMENT OF DISORDERS OF GLUCOSE HOMEOSTASIS - The invention is in the field of disorders of glucose homeostasis therapy. In particular the invention relates to a CFTR inhibitor or an inhibitor of CFTR gene expression for use in the treatment of disorders of glucose homeostasis. The present invention also relates to an in vitro methods for increasing the pool of Ngn3+ endocrine progenitor cells, pancreatic endocrine cells, or β cell mass obtained from stem cells, wherein said methods comprises the step of contacting stem cells with a CFTR inhibitor or an inhibitor of CFTR gene expression. The present invention also relates to a method of testing a subject thought to have or be predisposed to having disorders of glucose homeostasis, which comprises the step of analyzing a sample of interest from said subject for: (i) detecting the presence of a mutation in the CFTR gene and/or its associated promoter, and/or (ii) analyzing the expression of the CFTR gene. | 08-30-2012 |
20120219544 | ADHESIVE COMPOSITION FOR SOFT TISSUES, ADHESIVE COMPOSITION FOR WOUND DRESSING OR WOUND DRESSING COMPOSITION - The adhesive composition for soft tissues, the adhesive composition for wound dressing or the wound dressing agent composition of the present invention is an adhesive composition for soft tissues, an adhesive composition for wound dressing or a wound dressing agent composition, comprising a monomer (A), a polymer (B) and a polymerization initiator composition (C) containing an organoboron compound, and is characterized by having a viscosity of 0.4 to 75,000 cp within 30 seconds after mixing of the components (A), (B) and (C). The composition of the present invention not only has low toxicity, low harmfulness and high adhesive strength but also is excellent in workability during application and is capable of forming films of excellent properties. | 08-30-2012 |
20120230978 | COMPOSITIONS AND METHODS FOR MODULATING CIRCADIAN SYNCHRONIZATION - The present invention relates to a modulator of glucocorticoid biosynthesis, degradation and/or receptor activation for use in preventing or treating symptoms and/or diseases associated with jet lag. The compositions of the invention may be used as a lead compound for developing a drug for preventing or treating symptoms and/or diseases associated with jet lag. The invention relates to the discovery that administration of the modulator(s) to a subject results in a directional change of the time point of maximum amounts of glucocorticoids in the subject as compared to the time point of maximum amounts of glucocorticoids in a subject not treated with the modulator(s). | 09-13-2012 |
20120237498 | 4-1BB BINDING MOLECULES - The present disclosure provides isolated binding molecules that bind to human 4-1BB, nucleic acid molecules encoding an amino acid sequence of the binding molecules, vectors comprising the nucleic acid molecules, host cells containing the vectors, methods of making the binding molecules, pharmaceutical compositions containing the binding molecules, and methods of using the binding molecules or compositions. | 09-20-2012 |
20120237499 | Modulators of TDP-43 Mediated Toxicity and Methods of Use Thereof for Identifying Agents Having Efficacy for the Treatment and Prevention of Proteinopathies - Compositions and methods are disclosed for identifying agents useful for the treatment of proteinopathies. | 09-20-2012 |
20120237500 | SCD Fingerprints - This invention relates to methods of testing, diagnosing, monitoring, prognostically stratifying and classifying disease, disorders and other medical conditions and physiological states through the detection and analysis of soluble CD antigens in a body fluid sample. | 09-20-2012 |
20120237501 | Anti-HIV Peptides and Methods of Use Thereof - Anti-HIV peptides and methods of use are provided. In particular, these HIV inhibitory peptides are discovered based on the Antimicrobial Peptide Database. | 09-20-2012 |
20120244141 | Stratification of cancer patients for susceptibility to therapy with PTK2 inhibitors - A method for determining whether a cancer patient is susceptible to treatment with a protein tyrosine kinase 2 (PTK2) inhibitor, comprising detecting the expression of the E-cadherin protein in a cancer sample of said cancer patient, wherein an E-cadherin protein immunoreactivity score (IRS) of 0-2 indicates that the cancer patient is susceptible to treatment with a PTK2 inhibitor. The invention further encompasses treatment of a patient with a protein tyrosine kinase 2 (PTK2) inhibitor if it has been so determined that said patient is susceptible to such treatment. | 09-27-2012 |
20120244142 | ANTIBODY CAPABLE OF RECOGNIZING HLA CLASS I - An objective of the present invention is to provide antibodies that recognize HLA class I and have significant cell death-inducing activity. To achieve the above objective, first, the present inventors immunized mice with soluble HLA-A to which a FLAG tag is attached. Four days after the final immunization, spleen cells from the mice were fused with mouse myeloma cells. Then, hybridoma screening was carried out using the cell aggregation-inducing activity and cell death-inducing activity as an index. Thus, the monoclonal antibody F17B1 that has strong cell death-inducing activity was selected. The sequences of the H chain and L chain variable regions of the mouse monoclonal antibody F17B1 were determined to humanize this antibody. Then, the humanized anti-HLA class I antibody H2-G1d_L1-k0 was assessed for cell death induction. The result showed that H2-G1d_L1-k0 suppressed the growth of the IM9 cell line in a concentration dependent manner. | 09-27-2012 |
20120244143 | DRAWN SILK EGEL FIBERS AND METHODS OF MAKING SAME - The present invention relates to compositions and method for drawing egel silk fibroin fibers. The resulting fibers can transmit light and hence can be used as optical fiber. Silk fibroin fiber is produced by a method comprising applying an electric field to a solubilized silk fibroin solution to create a silk fibroin gel; converting the silk fibroin gel to a viscous silk liquid; and drawing a silk fiber from the viscous silk liquid. The silk fiber of the invention can be used in materials such as textile, medical sutures, and tissue materials, as well as conferring optical properties into these materials. | 09-27-2012 |
20120251523 | Methods of Modulating TGFbeta Signaling - The present invention provides methods of identifying the presence of or quantifying the amount of one or more of T helper (Th) cells and iTreg cells present in a sample by identifying the presence of an ADAM or the amount of an ADAM, such as ADAM12, present in a sample. The present invention also provides methods for increasing or decreasing signaling of a TGF such as TGFβ by increasing or decreasing the biological activity or expression of an ADAM. Further, the present invention provides methods for inhibiting or stimulating, downregulating or upregulating, an immune response, and for treating diseases associated with an immune response such as cancer, viral, bacterial and fungal infections, autoimmune diseases and graft versus host diseases. Still further, the invention provides screening methods effective for identifying therapeutic agents, pharmaceutical compositions containing therapeutic agents, and vaccines. | 10-04-2012 |
20120251524 | USE OF CYTOKINE LEVELS IN INTRAVENOUS IMMUNOGLOBULIN TREATMENT OF ALZHEIMER'S DISEASE - The present invention relates to the use of the level of certain cytokines in a patient's blood as an objective measure for the purpose of assessing disease progression in patients suffering from Alzheimer's disease and for the purpose of determining therapeutic effectiveness of a treatment regimen. Methods for treating Alzheimer's disease and monitoring therapeutic effectiveness are provided. | 10-04-2012 |
20120251525 | METHOD OF UTILIZING AZELAIC ACID ESTERS TO MODULATE COMMUNICATIONS MEDIATED BY BIOLOGICAL MOLECULES - The treatment of disease in organisms using Macromolecular interaction modulators and Membrane active immunomodulators, particularly selected azelaic acid esters, individually and in combinations, to modulate communications between biological molecules. | 10-04-2012 |
20120251526 | Methods Related to Wound Healing - The invention is directed to methods for the treatment of wounds. Such methods utilize novel compositions, including but not limited to amnion-derived multipotent cells (herein referred to as AMP cells), conditioned media derived therefrom (herein referred to as amnion-derived cellular cytokine suspension or ACCS), cell lysates derived therefrom, cell products derived therefrom, each alone or in combination. | 10-04-2012 |
20120251527 | PODOCYTE SPECIFIC ASSAYS AND USES THEREOF - Compositions are directed to the treatment of kidney diseases in a cell-specific manner. Methods of treating kidney diseases comprise the use of the compositions. Assays for identification of further compounds are provided. | 10-04-2012 |
20120263706 | ENANTIOMERICALLY PURE AMINOHETEROARYL COMPOUNDS AS PROTEIN KINASE INHIBITORS - Enantiomerically pure compound of formula 1 | 10-18-2012 |
20120269797 | METHOD FOR INHIBITING THE MATURATION OF DENDRITIC CELLS - Proteasome inhibitors (PI) are used for inhibiting the maturation of dendritic cells (DZ) and thus in the treatment or the prophylaxis of allergies, asthma, tissue or transplant rejection or autoimmune diseases. The concentration of the proteasome inhibitors lies preferably in the range of 10 nM to 10 μM, based on the peripheral blood or the cytoplasm. | 10-25-2012 |
20120269798 | ENHANCEMENT OF REGENERATION BY MODULATION OF NOTUM ACTIVITY - The invention provides compositions and methods of use for identifying modulators of NOTUM, e.g., NOTUM inhibitors. In some aspects, identified compounds are useful for modulating Wnt signaling at sites of tissue damage. The invention further provides methods of promoting regeneration by inhibiting NOTUM. | 10-25-2012 |
20120269799 | DIAGNOSTIC AND TREATMENT METHODS USING A LIGAND LIBRARY - The invention relates to diagnostic and treatment methods using a ligand library. Specifically, the invention relates to using a ligand library to diagnose or detect a drug induced response, including drug adverse reaction, side effects, drug resistance, and therapeutic efficacy. The invention further relates to identifying biomarkers associated with a drug induced response and providing a personalized medical treatment. | 10-25-2012 |
20120276082 | TREATMENT OF CANCER - The present invention relates to agents for use in treating cancer. The agent to be used is an antagonist of Dsg2, wherein said antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO:1), or a fragment or variant thereof, of the EC2 domain of Dsg2. Also included in the invention are specific polypeptides and pharmaceutical preparations. Also included in the invention is a method of screening for antagonists of Dsg2, wherein said antagonist modulates the function of the amino acid sequence: TQDVFVGS VEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO: 1), or a fragment or variant thereof, of the EC2 domain of Dsg2. | 11-01-2012 |
20120282245 | BIOMARKERS AND ASSAYS FOR THE TREATMENT OF CANCER - This invention features methods for prognosticating the efficacy of a cancer treatment comprising administration of a lymphotoxin-β receptor (LT-β-R) using TRAF3, TRAF2, and/or p53 markers, as well as combination therapies that include a composition that activates lymphotoxin-beta receptor signaling in combination with one or more other agents. | 11-08-2012 |
20120282246 | Compositions and methods for antibody and ligand identification - Embodiments disclosed herein relate to methodology, and kits thereof for identifying particular disease-associated antibodies partially based on comparative binding to a mimotope array. Isolation of identified disease-associated antibodies and uses thereof are also described. | 11-08-2012 |
20120282247 | METHODS AND COMPOSITIONS INVOLVING PROTECTIVE STAPHYLOCOCCAL ANTIGENS, SUCH AS EBH POLYPEPTIDES - The present invention concerns methods and compositions for treating or preventing a bacterial infection, particularly infection by a | 11-08-2012 |
20120288491 | PHARMACEUTICAL COMPOSITIONS OF ACTIVE AGENTS AND CATIONIC DEXTRAN POLYMER DERIVATIVES - Solid dry powder compositions comprising active agents and dextran polymer derivatives comprising an ester-linked amine-containing substituent and an alkyl ester substituent are disclosed, as are methods for making such compositions. | 11-15-2012 |
20120288492 | NOVEL PYRIMIDINE COMPOUNDS AS mTOR AND PI3K INHIBITORS - The present invention relates to pyrimidine compounds of formula (I): | 11-15-2012 |
20120294845 | METHOD OF MAKING A POLYMER PREFERABLY AN (ALKYL) ACRYLOYL POLYCARBONATE, THE POLYMER AND (ALKYL) ACRYLOYL POLYCARBONATE OBTAINED, AND A BIODEVICE COMPRISING SAME - The invention relates to a method for making a polymer wherein during the polymerisation is incorporated in the polymer chain by ring opening polymerisation a cyclic (alkyl)acryloyl carbonate having the formula (4): wherein R | 11-22-2012 |
20120294846 | Treatment of Pulmonary and Pleural Fibrosis Using HSP27 Inhibitors - Reduction of HSP27 expression is in beneficial in the treatment of pleural and pulmonary fibrosis and in particular subpleural fibrosis and IPF. Pharmaceutical compositions for this purpose contain an inhibitor of HSP27 and a pharmaceutically acceptable carrier. | 11-22-2012 |
20120294847 | IMMUNOGLOBULIN REDUCED IN THROMBOGENIC AGENTS AND PREPARATION THEREOF - The invention relates to an immunoglobulin composition reduced in thrombogenic agents and to methods for its preparation. One method comprises subjecting an immunoglobulin containing solution to a negative cation exchanger chromatography at a pH in the range of higher than 3.8 to equal to or lower than 5.3. The solution can also be subjected to a negative anion exchanger chromatography at a pH in the range of 7 to 8.2. | 11-22-2012 |
20120294848 | IGE CH3 Peptide Vaccine - The present invention relates to the provision of novel immunogens comprising an antigenic IgE peptide preferably linked to an immunogenic carrier for the prevention, treatment or alleviation of IgE-mediated disorders. The invention further relates to methods for production of these medicaments, immunogenic compositions and pharmaceutical compositing thereof and their use in medicine. | 11-22-2012 |
20120308554 | VEGF-D/VEGFR2/3-MEDIATED REGULATION OF DENDRITES - The present invention relates to methods for modulating, i.e. increasing or decreasing, the length and/or the complexity of the dendrites of a neuronal cell by influencing the amount of vascular endothelial growth factor D (VEGFD)-related signaling. The present invention further relates to methods for treating age- and/or disease-related cognitive dysfunctions, or for impairing the memory of a subject. Finally, the present invention relates to recombinant VEGFD (rVEGFD) for use in the treatment of age- and/or disease-related cognitive dysfunctions. | 12-06-2012 |
20120308555 | METHODS AND REAGENTS FOR CREATING MONOCLONAL ANTIBODIES - In some embodiments, the invention relates to methods for creating a monoclonal antibody that specifically binds to antigen. The method may start from a polyclonal population of antibodies such as a non-specific polyclonal population or a polyclonal population of antibodies that specifically bind to the antigen. The method includes obtaining nucleic acid molecules encoding heavy and light immunoglobulin chains (or variable regions thereof) of multiple immunoglobulins from an animal; obtaining mass spectra information of peptide fragments of a population of polyclonal immunoglobulins that specifically bind to an antigen of choice; comparing and/or correlating the mass spectra information of the peptide fragments of the polyclonal immunoglobulins with predicted mass spectra information of predicted amino acid sequences encoded by the nucleic acid molecules, and then assembling the heavy and light chains to create an antibody (or variable region thereof) that specifically binds to the antigen. | 12-06-2012 |
20120308556 | PROCESSED ECM MATERIALS WITH ENHANCED COMPONENT PROFILES - Described are medical graft materials and devices having improved properties relating to their component profiles. | 12-06-2012 |
20120308557 | Immunoglobulin Preparation - The present invention relates to the use of proline for reducing the viscosity of a protein preparation. | 12-06-2012 |
20120315264 | ZWITTERIONIC IMMUNOMODULATORS FOR THE TEATMENT OF ASTHMA AND ALLERGY - Methods and products for treating and protecting against asthma and allergic conditions are provided. The methods and products are related to certain naturally occurring and synthetic zwitterionic polymers which are found to induce certain T regulatory (Treg) cells and to exert immunosuppressive effects in vitro and in vivo. | 12-13-2012 |
20120315265 | HYDROGEL-FORMING POLYMER, AND PREPARATION PROCESS AND USES THEREOF - Disclosed herein are a hydrogel-forming polymer and a process of making the same. Also disclosed are a sustained-release pharmaceutical composition that contains a therapeutic agent and the aforesaid hydrogel-forming polymer, and a method for treating or preventing an ophthalmic disorder, which includes intraocularly administering into an eye of a mammal in need of such treatment a sustained-release pharmaceutical composition that contains an ophthalmic drug and the aforesaid hydrogel-forming polymer. | 12-13-2012 |
20120315266 | DETECTING COMPLEMENT ACTIVATION - Methods of detecting complement activation including steps of detecting in a sample from a subject a level of iC3b wherein the detecting involves specific interaction between the iC3b and a non-cross-reactive antibody thereto, comparing the detected level with a reference level, which reference level is within a range of about 10 ng/ml to about 5,000 ng/ml, wherein determination that the detected level is above the reference level indicates that the subject is suffering from or susceptible to undesirable and/or pathologic complement activation, and administering treatment to treat undesired complement activation if the detected level is above the reference level. Other methods of detecting complement activation with or without measuring iC3b are also provided. | 12-13-2012 |
20120315267 | NOVEL USES - The present invention relates to antibodies which multiple antigen specificities and their use in treating human diseases | 12-13-2012 |
20120321613 | MOLECULAR TARGETS FOR HEALING OR TREATING WOUNDS - The invention relates to at least one molecular target for healing or treating wounds and, in particular chronic, human wounds. The molecular target is nWASP or a protein 50% homolgous therewith and which retains the same activity as nWASP protein, such as WASP. Further, the invention concerns a novel therapeutic for treating said wounds and a novel gene therapy approach, involving said molecular target, for treating said wounds. | 12-20-2012 |
20120328599 | INHIBITORS OF RECEPTOR TYROSINE KINASES (RTK) AND METHODS OF USE THEREOF - The present invention provides moieties that bind to the asymmetric contact interface of a receptor tyrosine kinase (RTK), wherein the moieties inhibit ligand induced trans autophosphorylation of the RTK. The present invention also provides methods of treating or preventing an RTK-associated disease and methods for identifying moieties that bind to an asymmetric contact interface of an RTK. | 12-27-2012 |
20120328600 | INJECTION OF FIBRIN SEALANT USING RECONSTITUTED COMPONENTS IN SPINAL APPLICATIONS - A method of treating a disc that is leaking nucleus pulposus through at least one defect in the annulus fibrosus. The method includes injecting a fibrin sealant into the disc to reduce at least a portion of the at least one defect, wherein the fibrin sealant injected into the disc comprises fibrinogen and an activating compound, wherein at least a portion of the fibrin forms after injection, wherein the fibrinogen, the activating compound or both has been reconstituted with a solution containing at least one additive, with the proviso that a corticosteroid is absent from the fibrin sealant injected into the disc. | 12-27-2012 |
20120328601 | Modulation of Synaptic Maintenance - C1q is shown to be expressed in neurons, where it acts as a signal for synapse elimination. Methods are provided for protecting or treating an individual suffering from adverse effects of synapse loss. These findings have broad implications for a variety of clinical conditions, including treating and preventing neurodegenerative diseases such as Alzheimer's disease. | 12-27-2012 |
20120328602 | COMPOSITIONS AND METHODS FOR TREATING CONDITIONS ASSOCIATED WITH CERAMIDE BIOSYNTHESIS - Provided are a pharmaceutical composition and a method for reducing, preventing, or delaying the development of a biological condition associated with administration of an opioid drug, in particular, tolerance to and/or physical dependence on an opioid drug. The pharmaceutical composition includes an opioid drug, a ceramide biosynthesis inhibitor and a pharmaceutically acceptable carrier. The method of treatment involves administration of an opioid drug and a ceramide biosynthesis inhibitor. Also provided are a method of screening for an agent that reduces, prevents or delays the development of tolerance to and/or physical dependence on an opioid drug as well as compositions comprising a dsRNA for inhibiting ceramide biosynthesis in a cell and a vector for expressing a shRNA for inhibiting ceramide biosynthesis in a cell. | 12-27-2012 |
20130011385 | TRANSPARENT BACTERIAL CELLULOSE NANOCOMPOSITE HYDROGELS - A transparent polymeric nanocomposite hydrogel is provided, wherein the polymeric nanocomposite hydrogel is made from a water insoluble polymer, i.e. poly(2-hydroxyethyl methacrylate) (PHEMA) or/and crosslinked PHEMA and a water insoluble nanofiber, i.e., bacterial cellulose (BC). Disclosed is a synthetic route for polymeric nanocomposites hydrogels. The preferred polymeric nanocompositions are produced through free radical polymerization of HEMA monomer in the presence of bacterial cellulose with an assistance of ultrasound to enhance the mixing of bacterial cellulose, initiator, and the monomers. The polymeric nanocomposite hydrogel is then formed by immersion of the dry polymeric nanocomposite in water. Disclosed is a high transmittance polymer nanocomposite hydrogel with a preferred BC loading less than 0.1%, water content of about 40% in weight, good mechanical integrity and strength. The disclosed polymer nanocomposite hydrogel and compositions pertain to hydrogel applications, particularly contact lenses and optic components for biosensor. | 01-10-2013 |
20130011386 | ACTIVE PROTEASE-RESISTANT ANTIBODY FC MUTANTS - The present invention relates to modified Fc-containing molecules including modified antibodies characterized by increased resistance to host and pathogen-derived proteases, ability to interact with FcγR receptors except with FcγRI, and lack of induction of IL-10 secretion by macrophages, and methods of using and making them. | 01-10-2013 |
20130011387 | SYSTEMS AND METHODS FOR OBTAINING IMMUNOGLOBULIN FROM BLOOD - The present disclosure relates generally to systems for obtaining a pharmaceutically acceptable immunoglobulin from blood of a donor comprising a first conduit configured to convey blood from the donor to a substrate, wherein said blood includes at least one first component and at least one second component, said first component of the blood including immunoglobulin, and wherein said substrate is adapted to bind immunoglobulin; and a second conduit configured to convey at least a portion of the second component of the blood from the first conduit to the donor. | 01-10-2013 |
20130011388 | INTRAVENOUS IMMUNOGLOBULIN COMPOSITION - A concentrated, immunoglobulin composition for treating subjects vaccinated against or infected with a pathogenic microorganism, is made by (a) selecting a population of individuals previously vaccinated against antigens associated with the pathogenic microorganism; (b) identifying very high titre individuals by determining the level of specific antibodies immunoreactive with the pathogenic microorganism in the blood of the individuals; (c) combining blood from the very high titre individuals; and (d) purifying and/or concentrating the product of step (c). A concentrated immunoglobulin composition can include specific antibodies immunoreactive with a pathogenic microorganism, wherein the titre of specific antibodies is at least 5 times higher than the average titre of specific antibodies of a population of individuals previously vaccinated against antigens associated with the pathogenic microorganism. The composition has a relatively high protein concentration and a low percentage of protein aggregates. The pathogenic microorganism is preferably smallpox virus or vaccinia virus. | 01-10-2013 |
20130017188 | MODULATION OF SGK1 EXPRESSION IN TH17 CELLS TO MODULATE TH17-MEDIATED IMMUNE RESPONSES - The inventors have made the surprising discovery that SGK1, a serine/threonine kinase previously described as being involved in regulation of cellular sodium homeostasis, has a novel and unexpected function in the differentiation and function of a specific subset of CD4 T cells, the TH17 lineage. Described herein are methods and compositions for modulation of TH17 cell differentiation, proliferation, and/or function that rely upon modulating the activity or expression of SGK1. Such methods and compositions are useful in the treatment of disorders including autoimmune diseases, chronic inflammatory conditions, infectious diseases, and cancer. | 01-17-2013 |
20130017189 | Functionalised Triblock Copolymers and Compositions Containing Such PolymersAANM Pierre; Sebastien JeromeAACI MaastrichtAACO NLAAGP Pierre; Sebastien Jerome Maastricht NLAANM De Leeuw; MikeAACI MaastrichtAACO NLAAGP De Leeuw; Mike Maastricht NL - Amphiphilic triblock copolymers B-A-B, wherein A is a linear poly(ethylene glycol) block, having a number average molecular weight (M | 01-17-2013 |
20130017190 | TREATMENT OF INFLAMMATORY DISEASES - The present invention relates generally to the field of inflammatory diseases of the peripheral nervous system. More particularly, it concerns methods for treating inflammatory diseases of the peripheral nervous system by modulating sphingosine-1-phosphate receptor activity. In one embodiment, the present invention provides a method of treating a subject with chronic inflammatory demyelinating polyneuropathy (CIDP) or other autoimmune neuropathies comprising administering to the subject an effective amount of FTY720. | 01-17-2013 |
20130017191 | IMMUNOGLOBULIN PREPARATION AND STORAGE SYSTEM FOR AN IMMUNOGLOBULIN PREPARATION - The present invention relates to an immunoglobulin preparation comprising immunoglobulin in a mass-volume percentage of at least 4%, wherein the concentration of oxygen dissolved in the preparation at room temperature is less than 40 μmol/l. | 01-17-2013 |
20130022593 | METHODS OF DIAGNOSING ENDOMETRIOSIS - The present invention provides biomarkers for the diagnosis and prognosis of endometriosis. Generally, the methods of this invention find use in diagnosing or for providing a prognosis for endometriosis by detecting the expression levels of biomarkers, which are differentially expressed (up- or down-regulated) in endometrial cells from a patient with endometriosis. Similarly, these markers can be used to diagnose reduced fertility in a patient with endometriosis or to provide a prognosis for a fertility trial in a patient suffering from endometriosis. The present invention also provides methods of identifying a compound for treating or preventing endometriosis. Finally, the present invention provides kits for the diagnosis or prognosis of endometriosis. | 01-24-2013 |
20130028885 | METHODS TO PREDICT AND PREVENT RESISTANCE TO TAXOID COMPOUNDS - Embodiments of the invention are directed to methods for predicting the resistance of cancer to members of the taxoid family by measuring the levels of prohibitin. Methods for treating cancer and taxoid family member resistant cancers using inhibitors of prohibitin, as well as therapeutic complexes that target prohibitin are also provided. | 01-31-2013 |
20130028886 | PROTEIN TYROSINE PHOSPHATASE, NON-RECEPTOR TYPE 11 (PTPN11) AND TUMOR INITIATING CELLS - The present invention relates to a method for treating cancer in a subject by killing tumor initiating cells, inducing differentiation of tumor initiating cells into differentiated cells or blocking the conversion of differentiated tumor cells into tumor initiating cells, which method comprises the step of administering to said subject a therapeutically effective amount of a modulator of the protein tyrosine phosphatase, non-receptor type 11 (PTPN11) gene or of its gene product (Shp2). The present invention also provides a siRNA decreasing or silencing the expression of protein tyrosine phosphatase, non-receptor type 11 (PTPN11) and/or an antibody specifically binding to protein tyrosine phosphatase, non-receptor type 11 (PTPN11), for use as a medicament to treat cancer according to the methods described herein. The present invention also provides a peptide comprising an amino acid sequence specifically recognized by protein tyrosine phosphatase, non-receptor type 11 (PTPN11), for use as a medicament to treat cancer according to the methods described herein above. | 01-31-2013 |
20130034538 | REVERSE HEXAGONAL MESOPHASES (HII) AND USES THEREOF - Reverse hexagonal mesophase (H | 02-07-2013 |
20130034539 | SR-BI AS A PREDICTOR OF HUMAN FEMALE INFERTILITY AND RESPONSIVENESS TO TREATMENT - Methods of diagnosis and treatment of diseases and disorders related to de novo synthesis of cholesterol, based on allelic variants of the scavenger receptor class B type I receptor, and kits for use therein. | 02-07-2013 |
20130034540 | Immune Gene Signatures in Cancer - This invention relates to methods for selecting a treatment, treating, and predicting survival time in subjects with cancer, such as colorectal cancer, based on tumor expression levels of chemokines, cytotoxic genes, and/or dendritic cell genes. | 02-07-2013 |
20130034541 | PHARMACEUTICAL COMPOSITIONS - A composition including lactoferrin and immunoglobulin, wherein the composition does not substantially include one or more of the following proteins: lactoperoxidase, lactoglobulin, albumin. | 02-07-2013 |
20130034542 | COLD TREATMENT - A use of a composition including lactoferrin and/or immunoglobulin for minimizing the severity of one or more symptoms associated with common cold and/or influenza. | 02-07-2013 |
20130034543 | MODULATING XRN1 - The present invention relates to a method for modulating miRNA, said method being characterized in that a modulator of XRN1 is used. Also provided are uses of said method for therapeutical purposes, reagents therefore, as well as screening methods. | 02-07-2013 |
20130039903 | ECZEMA TREATMENT - A use of a composition including lactoferrin and/or immunoglobulin for minimizing the severity of one or more symptoms associated with eczema. | 02-14-2013 |
20130045198 | GENETIC POLYMORPHISMS ASSOCIATED WITH VENOUS THROMBOSIS, METHODS OF DETECTION AND USES THEREOF - The present invention is based on the discovery of genetic polymorphisms that are associated with coronary heart disease and in particular VT and response to drug treatment. In particular, the present invention relates to nucleic acid molecules containing the polymorphisms, variant proteins encoded by such nucleic acid molecules, reagents for detecting the polymorphic nucleic acid molecules and proteins, and methods of using the nucleic acid and proteins as well as methods of using reagents for their detection. | 02-21-2013 |
20130045199 | Antibody Preparations - An antibody preparation suitable for intravenous administration in humans includes IgG, IgA and at least 5% IgM antibodies by weight of the total amount of antibodies. The preparation is prepared from human plasma, has specific complement activating activity, and, in an in vitro assay with human serum suitable to determine the ability of the antibody preparation to activate complement unspecifically, the antibody preparation generates substantially no C5 | 02-21-2013 |
20130052186 | Plasma Carboxypeptidase B as a Predictor for Disease Severity and Response - Compositions and methods are provided for prognostic classification of individuals into groups that are informative of the individual's likelihood of developing severe disease associated with undesirable complement activation. Individuals having one or both alleles for a more stable or active carboxypeptidase B variant have a reduced propensity for developing severe disease. The presence of the protective variant may be identified through any suitable method. | 02-28-2013 |
20130052187 | Antibodies Directed Against Hepatitis C Virus E1E2 Complex, Compositions of HCV Particles, and Pharmaceutical Compositions - New conformational antibodies, and more particular conformational monoclonal antibodies and fragments thereof, are directed against HCV. Also provided are compositions of particles that are recognized by such antibodies, and pharmaceutical compositions containing these particles. Also described are HCV enveloped subviral particles and purified HCV enveloped complete viral particles, as well as processes for their preparation. | 02-28-2013 |
20130052188 | SYSTEMS AND METHODS FOR OBTAINING IMMUNOGLOBULIN FROM BLOOD - The present disclosure relates generally to systems for obtaining a pharmaceutically acceptable immunoglobulin from blood of a donor comprising a first conduit configured to convey blood from the donor to a substrate, wherein said blood includes at least one first component and at least one second component, said first component of the blood including immunoglobulin, and wherein said substrate is adapted to bind immunoglobulin; and a second conduit configured to convey at least a portion of the second component of the blood from the first conduit to the donor. | 02-28-2013 |
20130052189 | METHOD OF TREATING PATIENTS UNDERGOING PROTEIN REPLACEMENT THERAPY, GENE REPLACEMENT THERAPY, OR OTHER THERAPEUTIC MODALITIES - The present invention relates, in general, to a method of treating patients undergoing enzyme replacement therapy (ERT) or other therapy involving the administration of a proteinaceous therapeutic agent as well gene replacement therapy with non-viral or viral vectors, or other therapeutic modality or modalities, used alone or in combination, which involve the administration of exogenous substances for potential therapeutic benefit, including, but not limited to DNA vaccines, siRNA, splice-site switching oligomers (SSOs) as well as RNA-based nanoparticles (RNPs) and nanovaccines. The invention further relates to compounds and compositions suitable for use in such methods. | 02-28-2013 |
20130058914 | GENETIC POLYMORPHISMS ASSOCIATED WITH CORONARY EVENTS AND DRUG RESPONSE, METHODS OF DETECTION AND USES THEREOF - The present invention provides compositions and methods based on genetic polymorphisms that are associated with coronary heart disease (particularly myocardial infarction), aneurysm/dissection, and/or response to drug treatment, particularly statin treatment. For example, the present invention relates to nucleic acid molecules containing the polymorphisms, variant proteins encoded by these nucleic acid molecules, reagents for detecting the polymorphic nucleic acid molecules and variant proteins, and methods of using the nucleic acid molecules and proteins as well as methods of using reagents for their detection. | 03-07-2013 |
20130058915 | METHODS AND COMPOSITIONS FOR TREATMENT OF ANGELMAN SYNDROME AND AUTISM SPECTRUM DISORDERS - Methods for the treatment of Angelman Syndrome autism spectrum disorders are provided. The methods comprise administrating to a subject an agent that increases the expression of or increases activity of, ?-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor (AMPAR) at neuronal synapses. | 03-07-2013 |
20130058916 | PROANGIOGENIC COMPOSITIONS, METHOD FOR PREPARING SAME, AND USES THEREOF - The disclosure relates to an electrodynamic-transducer magnetic motor device ( | 03-07-2013 |
20130058917 | ANTIBODY COMPOSITION OBTAINED BY FRACTIONATION OF PLASMA IMMUNOGLOBULINS AFFINITY CHROMATOGRAPHY ON A SAMBUCUS NIGRA AFFINITY COLUMN - The invention relates to populations of antibodies obtainable by fractionation of plasma immunoglobulins, in particular plasma IgG, by affinity chromatography on a | 03-07-2013 |
20130058918 | ISOLATION AND USE OF A NEW TYPE OF GLIAL CELL WITH NEUROTOXIC POTENTIAL - The present invention provides for an isolated population of aberrant astrocytes, methods of isolating the aberrant astrocytes, methods of diagnosing neurodegenerative diseases, methods of drug screening using the aberrant astrocytes, and treatment methods targeting function, activity, and signaling associated with aberrant astrocytes. | 03-07-2013 |
20130064809 | Antimicrobial Composition and Uses Thereof - A composition for prophylactic and/or therapeutic medicinal applications, or plant protection applications, in particular for the control of microorganisms, either planktonic or organized in biofilms. The composition includes at least one ion selected from hypohalite, at least one compound selected from lactoferrin, lactoferrin peptide, lysozyme, immunoglobulins or a combination thereof, optionally hypothiocyanite, and optionally at least one growth factor. | 03-14-2013 |
20130064810 | Methods and Compositions for the Detection and Treatment of Cancer involving miRNAs and miRNA Inhibitors and Targets - The present invention relates to microRNAs (miRNAs) which are associated with cancer, particularly including hematologic malignancies, and particularly T-cell acute lymphoblastic leukemia (T-ALL), and to the assessment and modulation thereof in the treatment and management of cancer. The present invention is directed to methods and compositions for diagnosing and treating cancer, particularly T-ALL, by modulating miRNAs, and the use of miRNAs and antagonists thereof, particularly antagomirs, for predicting and assessing response to treatment, in assays for isolating and selecting antagists, and as compositions for the treatment and management of cancer. Methods and compositions are provided for treatment or alleviation of cancer, particularly T-ALL, with antagonists/antagomirs of miRNAs, particularly one or more of miR-19b, miR-20a, miR26, miR92, miR148 and miR223. | 03-14-2013 |
20130071378 | SIR2 ACTIVITY - Methods for screening a compound, by providing a test mixture comprising a transcription factor, Sir2, and a Sir2 cofactor with the compound, and evaluating an activity of a component of the test mixture in the presence of the compound are described. | 03-21-2013 |
20130078232 | COMPOSITIONS AND METHODS USEFUL FOR STABILIZING PROTEIN-CONTAINING FORMULATIONS - The invention relates to use of non-surfactant compounds including, for example, polyoxyethylene (POE) sorbitans and polyethylene glycols (PEGs), for stabilizing protein-containing formulations and for the prevention of aggregation of proteins in such formulations. | 03-28-2013 |
20130078233 | COMPOSITIONS AND METHODS USING SAME FOR TREATING AMYLOID-ASSOCIATED DISEASES - Compounds having one or more phenol moieties, derivatives thereof, compositions containing same and uses thereof for the treatment of amyloid-associated diseases are provided. | 03-28-2013 |
20130089537 | METHOD FOR TREATING A DISEASE ASSOCIATED WITH SOLUBLE, OLIGOMERIC SPECIES OF AMYLOID BETA 1-42 - This invention is a method and kit for treating a disease associated with, or resulting from, the accumulation of soluble oligomer amyloid beta 1-42 using an antibody, or antibody fragment thereof, that has a higher affinity for amyloid beta 1-42 oligomers than for amyloid beta 1-42 monomer, amyloid beta 1-40 monomer, plaques and amyloid beta fibrils and, optionally, a tau therapeutic or an inhibitor of amyloid beta production or aggregation. | 04-11-2013 |
20130089538 | TREATING CANCER BY MODULATING MAMMALIAN STERILE 20-LIKE KINASE 3 - The present invention relates to a method for modulating miRNA, said method being characterized in that a modulator of XRN1 is used. Also provided are uses of said method for therapeutical purposes, reagents therefore, as well as screening methods. | 04-11-2013 |
20130095093 | METHODS AND COMPOSITIONS FOR TREATMENT OF IMMUNE DYSFUNCTION DISORDERS - Methods and compositions are disclosed for modulating the immune system of animals. Applicant has identified that oral administration of immunoglubulin or plasma fractions purified from animal serum can modulate serum IgG and/or TNF-α levels for treatment of autoimmune disorders, potentiation of vaccination protocols, and improvement of overall health and weight gain in animals, including humans. | 04-18-2013 |
20130095094 | ASSAY - The invention provides assays and apparatuses for assessing the ability of certain orally-ingestible samples, such as saliva or foodstuffs to cause inflammation, and thus the health risk such samples can cause upon ingestion by a subject. The invention also provides an assay to monitor an individual's diet with regards to inflammation risk. The invention also extends to methods of preventing inflammatory diseases. | 04-18-2013 |
20130101577 | Extended Soluble PH20 Polypeptides and uses thereof - Soluble PH20 polypeptides are provided, including extended soluble PH20 polypeptides, and uses thereof. Also provided are other C-terminally truncated PH20 polypeptides and partially deglycosylated PH20 polypeptides and uses thereof. | 04-25-2013 |
20130101578 | BIOMARKER FOR RENAL FUNCTION IN PATIENTS WITH TYPE 2 DIABETES - The invention provides kits and methods for the diagnosis, prognosis, and treatment of reduced kidney function in patients, such as diabetic patients. The methods include a step of detecting one or more nephrin degradation products in a sample from the subject, such as a urine sample. | 04-25-2013 |
20130101579 | METHOD TO PRODUCE AN IMMUNOGLOBULIN PREPARATION WITH IMPROVED YIELD - The present invention provides improved methods for the manufacturing of IVIG products. These methods offer various advantages such as reduced loss of IgG during purification and improved quality of final products. In other aspects, the present invention provides aqueous and pharmaceutical compositions suitable for intravenous, subcutaneous, and/or intramuscular administration. In yet other embodiments, the present invention provides methods of treating a disease or condition comprising administration of an IgG composition provided herein. | 04-25-2013 |
20130101580 | COMPOSITIONS AND METHODS FOR PROLONGING LIFESPAN - The present invention relates to therapeutic targets for aging. In particular, the present invention relates to the inhibition of the kynurenine pathway of tryptophan metabolism to extend lifespan or provide anti-aging benefits. | 04-25-2013 |
20130108616 | DETECTION AND TREATMENT OF LRP4-ASSOCIATED NEUROTRANSMISSION DISORDERS | 05-02-2013 |
20130108617 | PLASMA-DERIVED IMMUNOGLOBULIN FOR USE IN THE TREATMENT AND PREVENTION OF IMMUNE RECONSTITUTION INFLAMMATORY SYNDROME (IRIS) | 05-02-2013 |
20130108618 | METHODS AND COMPOSITIONS RELATED TO INTRACELLULAR NEUTRALIZATION BY IgG | 05-02-2013 |
20130108619 | INTRAVENOUS IMMUNOGLOBULIN PROCESSING, DIAGNOSTIC, AND TREATMENT SYSTEMS AND METHODS | 05-02-2013 |
20130121988 | Nucleic Acid of Formula (I): GlXmGn, or (II): ClXmCn, in Particular as an Immune-Stimulating Agent/Adjuvant - The present invention relates to a nucleic acid of the general formula (I): G | 05-16-2013 |
20130121989 | ALPHA-TUBULIN ACETYLTRANSFERASE - Polypeptides with tubulin acetyltransferase activity are described, as are nucleic acids encoding said polypeptides, and methods of use. The invention further provides enhancers and inhibitors of tubulin acetyltransferase activity, as well as cells having altered tubulin transferase activity. | 05-16-2013 |
20130121990 | PHARMACEUTICAL FORMULATIONS - A stable pharmaceutical formulation is provided that comprises a biologically active protein and an excipient selected from carnitine, creatine or creatinine. | 05-16-2013 |
20130121991 | CONCENTRATED HUMAN IMMUNOGLOBULIN COMPOSITION - The invention relates to a human immunoglobulin G composition characterized in that the human immunoglobulin G concentration is at least 230 g/l, which is of use in particular for subcutaneous administration. | 05-16-2013 |
20130129712 | SELF-ASSEMBLING HYDROGELS BASED ON DICEPHALIC PEPTIDE AMPHIPHILES - We have disclosed dicephalic amphiphiles having peptide sequences as the head groups. We have also disclosed self-assembly hydrogels prepared from the dicephalic peptide amphiphiles. These hydrogels are useful for the encapsulation and delivery of bioactives to a patient. | 05-23-2013 |
20130129713 | METHOD OF ANTIGEN LOADING FOR IMMUNOTHERAPY - It is disclosed a method for obtaining a specific tumor antigen peptide repertoire loaded and/or activated dendritic cell comprising the steps of: a) exposing in suitable conditions a tumor cell expressing said specific tumor antigen peptide repertoire to at least one Pattern Recognition Receptor (PRR) agonist and/or to an inflammatory cytokine to obtain a tumor cell with an increased activity of at least one protein belonging to the group of connexins; b) co-culturing said tumor cell with an increased activity of at least one protein belonging to the group of connexins with dendritic cells, to get specific tumor antigen peptide repertoire loaded and/or activated dendritic cells; Step a) and b) are performed simultaneously or in sequence. The group of connexins preferably consists of connexin 43, connexin 40, connexin 45, connexin 47, connexin 50. | 05-23-2013 |
20130136733 | Stable Multi-Dose Compositions Comprising an Antibody and a Preservative - The invention relates to stable, multi-dose liquid compositions containing proteins, in particular, but not exclusively stable antibodies, and to the use of said compositions in therapy, in particular for the subcutaneous delivery of said stable protein. | 05-30-2013 |
20130142778 | COMPOSITIONS FOR INHIBITING GENE EXPRESSION AND USES THEREOF - The inventors have examined the means for providing more efficacious miRNA blocking compounds. The inventors have discovered new structural features that surprisingly improve the efficacy of miRNA blocking molecules. These features include the presence of multiple 3′ ends and a linker at the 5′ ends. Surprisingly, these features improve the efficacy of the gene expression blocking compounds in a manner that decreases the compound's biologic instability. Even more surprisingly, this effect has been found to be applicable to both DNA and RNA oligonucleotide-based compounds and to have application in traditional antisense and RNAi technology. | 06-06-2013 |
20130142779 | Treatment of Hi-Virus infections with oxidised blood proteins - The invention relates to the field of medicaments for combating an infection of a host cell by HI viruses and/or for inhibiting binding of an Env protein to a CD4 protein. For these purposes, the invention provides medicaments which comprise oxidized proteins, oxidized peptides and/or peptidomimetics of such oxidized proteins and/or oxidized peptides, as well as preparation processes for such medicaments and therapeutic and non-therapeutic possible uses of these medicaments. | 06-06-2013 |
20130142780 | METHOD FOR ISOLATION OF SOLUBLE POLYPEPTIDES - Polypeptides with desirable biophysical properties such as solubility, stability, high expression, monomericity, binding specificity or non-aggregation, including monomeric human V | 06-06-2013 |
20130142781 | PEG BASED HYDROGEL FOR PERIPHERAL NERVE INJURY APPLICATIONS AND COMPOSITIONS AND METHOD OF USE OF SYNTHETIC HYDROGEL SEALANTS - Hydrogels that may be used for treating peripheral nerves and related methods are provided. Synthetic hydrogel sealants, methods of forming synthetic hydrogel sealants, and the use of synthetic hydrogel sealants are provided. | 06-06-2013 |
20130142782 | HUMIDIFIED PARTICLES COMPRISING A THERAPEUTICALLY ACTIVE SUBSTANCE - The invention relates to aerosolized and humidified particles comprising a therapeutically active substance which can be obtained by suspending dry inhalable particles in a carrier gas, adding water vapor and causing condensation of water on the particles. The invention further relates to methods to generate these particles, and apparatus useful to carry out such methods. | 06-06-2013 |
20130149296 | Salts of Isophosphoramide Mustard and Analogs Thereof As Anti-Tumor Agents - The present disclosure relates to salts and compositions of isophosphoramide mustard and isophosphoramide mustard analogs. In one embodiment the salts can be represented by the formula I: | 06-13-2013 |
20130149297 | ROLE OF FRAGILE X MENTAL RETARDATION GENE AND PROTEIN IN CANCER METASTASIS - The present application relates to the field of cancer. Surprisingly, it was shown that the Fragile X mental retardation gene (Fmr1) products such as the FMRP protein, primarily implicated in mental retardation, are upregulated in metastasizing tumours. It is shown how Fmr1 gene products can be used as a marker for cancer metastasis and how inhibition of these gene products may help prevent or reduce metastasis. | 06-13-2013 |
20130156751 | TREATMENT OF DISEASES - Methods of treatment of various non-demyelinating and demyelinating neural disorders are provided, comprising administering a serum composition obtained from a goat after challenge with an immunogen. Also provided are methods of treatment of certain autoimmune disorders using such a composition. | 06-20-2013 |
20130156752 | MEDICAL ORGANOGEL PROCESSES AND COMPOSITIONS - Serial-solvent biomaterials are described. Embodiments include materials made in an organic solvent that are stripped of the solvent and used in a patient, where they imbibe water and form a hydrogel. These materials are useful for, among other things, delivering therapeutic agents, tissue augmentation, and radiological marking. | 06-20-2013 |
20130156753 | THE cAMP/PKA/HDAC5 PATHWAY AND USES THEREOF - The present invention provides novel uses of the cAMP/PKA/HDAC5 pathway for the treatment and prevention of myopathies. | 06-20-2013 |
20130164277 | Compositions and methods including B lymphocyte cell line expressing membrane immunoglobulin different from secreted immunoglobulin - Compositions and methods are disclosed herein for producing one or more immunoglobulins in an isolated B lymphocyte cell line. An isolated recombinant cell line includes an isolated B lymphocyte cell line capable of expressing at least one endogenous membrane immunoglobulin reactive to a first antigen and at least one exogenously incorporated nucleic acid encoding at least one secreted immunoglobulin reactive to a second antigen. | 06-27-2013 |
20130171128 | REDUCING VISCOSITY OF PHARMACEUTICAL FORMULATIONS - A stable pharmaceutical formulation is provided that comprises a biologically active protein and an excipient selected from taurine, theanine, sarcosine, citrulline and betaine. | 07-04-2013 |
20130171129 | CONSTRAINED IMMUNOGENIC COMPOSITIONS AND USES THEREFOR - A stable immunogenic or vaccine composition comprising a complex or polyhedra comprising same comprising an antigen of a pathogen or other antigen against which a immune response is sought in a human or non-human animal subject and a polyhedrin protein derived from a cytoplasmic polyhedrosis virus (CPV), Delivery of the complex to a subject in substantially polyhedral form induces an immune response thereto. Methods of using same to elicit an immune response. | 07-04-2013 |
20130177549 | Treatment of Synucleinopathies - This invention relates generally to treating synucleinopathies in subjects that are not clinically diagnosed with a lysosomal storage disease, as well as associated methods of making medicaments and screening methods. | 07-11-2013 |
20130183285 | Methods for accelerating the healing of connective tissues injuries and disorders - The invention is directed to methods for accelerating the healing of connective tissue injuries and disorders. In particular, the invention is directed to accelerating the healing of injuries and disorders of tendons and ligaments. Such methods utilize novel compositions including, but not limited to, extraembryonic cytokine-secreting cells (herein referred to as ECS cells), including, but not limited to, Amnion-derived Multipotent Progenitor cells (herein referred to as AMP cells) and conditioned media derived therefrom (herein referred to as Amnion-derived Cellular Cytokine Solution or ACCS), including pooled ACCS, and Physiologic Cytokine Solution (PCS). | 07-18-2013 |
20130183286 | Composition and method for preventing/decreasing respiratory illness - A microbial adherence inhibitor in the form of fowl egg antibodies is disclosed, along with the method of making it and methods of using it. The inhibitor functions by substantially preventing the attachment of adherence of colony-forming immunogens in the respiratory tracts of host animals and humans. The inhibitor is made by inoculating female birds with the immunogen, harvesting the eggs which contain antibodies to the immunogen, and separating the yolk and albumin from the shells of the eggs. The yolk and albumin contents are administered to animals or human by distributing the contents directly or introducing the contents entrained in air. The adherence inhibiting material can be formulated for use in a variety of ways such as an oral spray or a nasal spray. These formulations can be effective to prevent or reduce respiratory illnesses in animals and humans. | 07-18-2013 |
20130183287 | PROTEIN BINDING DOMAINS STABILIZING FUNCTIONAL CONFORMATIONAL STATES OF GPCRS AND USES THEREOF - The disclosure relates to the field of GPCR structure biology and signaling. In particular, it relates to protein binding domains directed against or capable of specifically binding to a functional conformational state of a G-protein-coupled receptor (GPCR). More specifically, it provides protein binding domains that are capable of increasing the stability of a functional conformational state of a GPCR, in particular, increasing the stability of a GPCR in its active conformational state. The protein binding domains hereof can be used as a tool for the structural and functional characterization of G-protein-coupled receptors bound to various natural and synthetic ligands, as well as for screening and drug discovery efforts targeting GPCRs. Moreover, also encompassed are the diagnostic, prognostic and therapeutic usefulness of these protein binding domains for GPCR-related diseases. | 07-18-2013 |
20130189245 | METHOD FOR PRODUCING TOXOIDS USING ALPHA-DICARBONYL COMPOUNDS - The present invention relates to the use of toxoids prepared using a-dicarbonyl toxoiding reagents such as glyoxal, butanedione and phenylglyoxal. The toxoids may be prepared with low concentrations of toxoiding reagent and in short periods of time, often in as few as 24 hours, making the toxoiding reagents particularly advantageous when compared with traditional formaldehyde toxoiding. Toxoids prepared using dicarbonyl reagents such as phenylglyoxal are described and claimed as are pharmaceutical and vaccine compositions comprising the toxoids, methods of treatment using such compositions and antibodies generated by immunisation with the toxoid and methods of treatment using the antibodies so prepared or fragments of such antibodies. | 07-25-2013 |
20130195840 | THERAPEUTICS AND PROCESSES FOR TREATMENT OF IMMUNE DISORDERS - Processes of diagnosing or treating an autoimmune abnormality are provided whereby the presence of IgA anti-neutrophil cytoplasmic antibodies (ANCA) in a subject are detected correlating with both presence and severity of disease such as Wegener's granulomatosis (WG). The FCAR genotype predicts whether IgA ANCA will be stimulatory or inhibitory of neutrophil activation such that in subjects with an inhibitory genotype, IgA ANCA will act as an inhibitor of disease severity, and in subjects with a proinflammatory genotype, IgA ANCA will increase disease severity as observed by increased prevalence of renal disease in WG. Thus, individualized medical treatment is possible based on determination of the presence of IgA ANCA and FCAR genotype. | 08-01-2013 |
20130195841 | BIOFILM RESISTANT MATERIALS - This invention provides a biofilm resistant material comprising an active agent, which active agent consists essentially of an insoluble copper oxide at a concentration of between 3 and 10% w/w of said biofilm resistant material and uses thereof. | 08-01-2013 |
20130195842 | Methods for treating disorders of amino acid metabolism - The invention is directed to methods for treating disorders of amino acid metabolism, in particular, phenylketonuria (PKU). Such methods utilize novel compositions including Amnion-derived Multipotent Progenitor cells (herein referred to as AMP cells) alone or in combination with other agents or treatment modalities. | 08-01-2013 |
20130195843 | Biomarkers for Non-Hodgkin Lymphomas and Uses Thereof - The disclosure provides a method of identifying a subject as having B-cell non-Hodgkin lymphoma (NHL) such as testing a sample from a subject for a mutation in one or more biomarkers. Also described are methods for classifying or monitoring a subject having, or suspected of having, B-cell non-Hodgkin lymphoma comprising testing the sample for a mutation in one or more biomarkers. | 08-01-2013 |
20130202584 | STABILIZED IMMUNE MODULATORY RNA (SIMRA) COMPOUNDS FOR TLR7 AND TLR8 - The invention relates to the therapeutic use of stabilized oligoribonucleotides as immune modulatory agents for immune therapy applications. Specifically, the invention provides RNA based oligoribonucleotides with improved nuclease and RNase stability and that have immune modulatory activity through TLR7 and/or TLR8. | 08-08-2013 |
20130202585 | STABILISING FORMULATION FOR IMMUNOGLOBULIN G COMPOSITIONS IN LIQUID FORM AND IN LYOPHILISED FORM - This invention is related to a stabilising formulation for immunoglobulins G compositions comprising a sugar alcohol, glycine and a non-ionic detergent, which is suitable for the stabilisation of immunoglobulins G compositions in liquid form and in lyophilised form. The invention also relates to an immunoglobulins G composition in liquid form or in lyophilised form comprising said stabilising formulation. | 08-08-2013 |
20130209443 | Method for Treating Oncological Diseases - A method to treat solid tumors and other oncological diseases consists of parenterally injecting an agent which destroy's blood's extracellular DNA into the systemic blood circulation of a cancer patient to slow down malignant. The agent is embodied in the form of a DNAse enzyme and, more particularly, as a bovine pancreatic DNAse. Doses from 50,000-250,000,000 Kunz units/day are injected for 5-360 days. A binding agent or an agent that modifies the chemical composition of the blood extracellular DNA is additionally injected into the blood. This modifying agent is preferably an enzyme-ribonuclease. | 08-15-2013 |
20130209444 | NON-ANTICOAGULANT SULFATED OR SULFONATED POLYSACCHARIDES - The present invention provides non-anticoagulant sulfated or sulfonated polysaccharides (NASPs), which accelerate the blood clotting process. Also provided are pharmaceutical formulations comprising a NASP of the invention in conjunction with a pharmaceutically acceptable excipient and, in various embodiments, these formulations are unit dosage formulations. The invention provides a NASP formulation, which is orally bioavailable. Also provided are methods for utilizing the compounds and formulations of the invention to promote blood clotting in vivo as therapeutic and prophylactic agents and in vitro as an aid to studies of the blood clotting process. | 08-15-2013 |
20130209445 | Optimized Fc Variants - The present invention relates to Fc variants having decreased affinity for FcγRIIb, methods for their generation, Fc polypeptides comprising optimized Fc variants, and methods for using optimized Fc variants. | 08-15-2013 |
20130209446 | Copy Number Variant-Dependent Genes As Diagnostic Tools, Predictive Biomarkers And Therapeutic Targets - Provided herein are methods of diagnosing and/or treating malignant or pre-malignant conditions in a subject. Overexpression of copy number variant-dependent genes, e.g., genes encoding a cell surface receptor, resulting from copy number changes compared to control is diagnostic of the condition, such as multiple myeloma or monoclonal gammopathy of undetermined significance. Also provided are methods for treating malignant conditions, such as multiple myeloma or a hyperdiploid subtype, with therapeutic agents, with or without other anti-cancer drugs, to downrregulate the overexpressed CNV genes and/or up-regulate the underexpressed genes. Furthermore, methods for lowering drug resistance in multiple myeloma cells via inhibition of platelet activation or thrombin release and for increasing survivability of a multiple myeloma subject via lithibition of PSMD4 gene to increase b-catenin protein expression are provided. | 08-15-2013 |
20130209447 | METHODS AND KITS FOR PREDICTING THE RISK OF DIABETES ASSOCIATED COMPLICATIONS USING GENETIC MARKERS AND ARRAYS - A method for diagnosing a genetic predisposition in a subject for diseases, disorders or conditions including a diabetic kidney complication such as kidney disease of type 2 diabetes or type 1 diabetes, end stage renal disease (ESRD) due to type 2 diabetes, ESRD due to hypertension in type 2 diabetes, ESRD due to type 1 diabetes; cardiovascular diseases due to type 2 diabetes or type 1 diabetes such as atherosclerotic peripheral vascular disease, hypertension, ischemic cardiomyopathy, and myocardial infarction due to type 2 diabetes or type 1 diabetes; and cerebrovascular accident due to type 2 diabetes. At least one polynucleotide is analyzed to detect a single nucleotide polymorphism (SNP), in which the presence of the single nucleotide polymorphism indicates that the subject is suffering from, at risk for, or suspected of suffering from the diseases, disorders or conditions. Also provided is an array or kit for diagnosing the genetic predisposition. | 08-15-2013 |
20130209448 | Carrier Nanoparticles and Related Compositions, Methods and Systems - Carrier nanoparticles comprising a polymer containing a polyol coupled to a polymer containing a boronic acid, configured to present the polymer containing a boronic acid to an environment external to the nanoparticle and related compositions, methods and systems. | 08-15-2013 |
20130216521 | DIETARY SUPPLEMENT FOR ENHANCING ANIMAL HEALTH - A dietary supplement system including three general components is provided. The first component is the fatty acid component and this includes sunflower seeds (containing omega 6 fatty acids), flax seed (containing omega 3 fatty acids) and powdered oils (containing omega 3 or omega 6 fatty acids and generally produced from sunflower oils). The weight ratio of omega 6 fatty acids to omega 3 fatty acids is 10:1 to 1:1, with 10:1 to 5:1 being preferred for normal animals and 2:1 to 1:1 being preferred for animals which have fatty acid responsive conditions. The second component is the GI component, which is used for facilitating animal gut health. This component includes prebiotics, probiotics and immunoglobulin (typically from albumin concentrate). The third component is the breed specific component and can include vitamins, minerals, additional fatty acids, antioxidants, amino acids, palatants, and nutraceutical additives. | 08-22-2013 |
20130216522 | STABILIZED HUMAN IMMUNOGLOBULIN COMPOSITION - The invention relates to a liquid pharmaceutical composition comprising human immunoglobulins G (IgGs), comprising at least 200 mM, preferably 250 mM±50 mM, of glycine and between 20 and 100 mg/l of a non-ionic detergent, and having a pH of less than or equal to 4.8. | 08-22-2013 |
20130224182 | BCL-G POLYPEPTIDES, ENCODING NUCLEIC ACIDS AND METHODS OF USE - The invention provides Bcl-G polypeptides and encoding nucleic acids. Bcl-G polypeptides include Bcl-G | 08-29-2013 |
20130224183 | FRACTION I-IV-1 PRECIPITATION OF IMMUNOGLOBINS FROM PLASMA - Among other aspects, the present invention provides methods for the manufacture of blood protein compositions from pooled plasma. In one embodiment, the invention provides an alcohol fractionation scheme that allows for significant increases in the yield of blood proteins purified from the starting plasma sample. In a specific embodiment, a method for fractionating pooled plasma is provided, the method comprising an initial low pH, high alcohol precipitation step. The present invention also provides pharmaceutical compositions of therapeutic blood proteins. | 08-29-2013 |
20130224184 | METHOD TO PRODUCE AN IMMUNOGLOBULIN PREPARATION WITH IMPROVED YIELD - The present invention provides improved methods for the manufacturing of IVIG products. These methods offer various advantages such as reduced loss of IgG during purification and improved quality of final products. In other aspects, the present invention provides aqueous and pharmaceutical compositions suitable for intravenous, subcutaneous, and/or intramuscular administration. In yet other embodiments, the present invention provides methods of treating a disease or condition comprising administration of an IgG composition provided herein. | 08-29-2013 |
20130236447 | COGNITIVE FUNCTION - Inhibition of eIF-2α phosphorylation can be used to improve cognitive function and/or to treat dementia, including Alzheimer's Disease. In particular, this can be achieved by inhibiting the kinase activity of PKR in a non-toxic manner. | 09-12-2013 |
20130251702 | METHOD FOR SCREENING COMPOUNDS FOR TREATING SEPSIS TARGETING NOD2 SIGNALLING PATHWAY AND COMPOSITION FOR TREATING SEPSIS COMPRISING NOD2 SIGNALLING PATHWAY INHIBITORS - Methods for screening compounds for treating sepsis are disclosed. The present methods and compositions are targeting NOD2 mediated signaling pathway and the agents identified by the present methods are qualified as drug candidates for clinical development. Further Methods and composition for treating sepsis are disclosed. | 09-26-2013 |
20130259856 | TREATMENT OF MULTIPLE SCLEROSIS WITH COMBINATION OF LAQUINIMOD AND DIMETHYL FUMARATE - This invention provides a method of treating a subject afflicted with multiple sclerosis or presenting a clinically isolated syndrome comprising administering to the subject laquinimod as an add-on therapy to or in combination with DMF. This invention also provides a package comprising laquinimod and DMF for treating a subject afflicted with multiple sclerosis or presenting a clinically isolated syndrome. This invention also provides laquinimod for use as an add-on therapy or in combination with DMF in treating a subject afflicted with multiple sclerosis or presenting a clinically isolated syndrome. This invention also provides a pharmaceutical composition comprising laquinimod and DMF for use in treating a subject afflicted with multiple sclerosis or presenting a clinically isolated syndrome. This invention further provides use of laquinimod and DMF in the preparation of a combination for treating a subject afflicted with multiple sclerosis or presenting a clinically isolated syndrome. | 10-03-2013 |
20130259857 | METHODS FOR INHIBITING FASCIN - The invention relates to compositions and methods useful for inhibiting fascin. These compositions and methods can be used to inhibit fascin-related diseases. For example, according to the invention inhibition of fascin inhibits metastasis of tumor cells in mammals. | 10-03-2013 |
20130266557 | METHODS FOR TREATMENT OF A SARCOMA USING AN EPIMETABOLIC SHIFTER (COENZYME Q10) - Methods and formulations for treating a sarcoma in humans using an epimetabolic shifter, such as Coenzyme Q10, a building block of CoQ10, a derivative of CoQ10, an analog of CoQ10, a metabolite of CoQ10, or an intermediate of the coenzyme biosynthesis pathway, are described. Methods for assessing the efficacy of treatment of, diagnosing, and prognosing sarcoma are also provided. | 10-10-2013 |
20130280237 | PROTEIN TRANSDUCTION DOMAINS MIMICS - The invention generally relates to synthetic mimics of cell penetrating peptides. More particularly, the invention relates to certain novel monomers, oligomers and polymers (e.g., co-polymers) that are useful for the preparation of synthetic mimics of cell penetrating peptides, their compositions, preparations and use. | 10-24-2013 |
20130280238 | Methods and Systems for Identification of a Protein Binding Site - Processes for identification of binding sites on protein molecules such as epitopes are provided. The disclosed methods in some embodiments use a combination of protein sequence data, structural information, experimental data on binding affinity, and computational modeling in order to identify binding sites on protein molecules. Systems and computer readable media for implementing the disclosed methods are provided. Also provided are compositions comprising a binding site or antibody that interacts with the binding site as an active ingredient and methods of using such compositions. | 10-24-2013 |
20130280239 | ARRAY OF COMPLEMENTARY INFANT/YOUNG CHILD NUTRITIONAL COMPOSITIONS - The present invention relates to infant/young child nutrition. A set of nutritional compositions having beneficial effects to infants/young children is disclosed. The set of nutritional compositions comprises at least two compositions with varying amounts of components which impart a beneficial effect to the infants young/children. A nutrition kit for infants/young children comprising the set of nutritional compositions is also disclosed as well as a method for manufacturing the set of nutritional components. A dosage regimen is also disclosed. | 10-24-2013 |
20130280240 | Materials and Methods for Improved Immunoglycoproteins - Immunoglycoproteins, including antibodies, with improved ADCC and altered glycosylation patterns arc provided. Also provided are cell culturing methods and media for producing such immunoglycoproteins, and therapeutic uses of such immunoglycoproteins. | 10-24-2013 |
20130280241 | 15-PGDH IN COLON CANCER - The disclosure provides, among other things, a method of decreasing resistance to the chemopreventive properties of non-steroidal anti-inflammatory agents, e.g., celecoxib, particularly in the prevention of cancer, e.g., colon cancer, by increasing the levels or activity of 15-hydroxyprostaglandin dehydrogenase (15-PGDH). The disclosure also provides a method of identifying compounds that upregulate or reactivate 15-PGDH. The disclosure also provides a method of identifying an individual suitable for treatment with a non-steroidal anti-inflammatory agent in the treatment or prevention of colon cancer. | 10-24-2013 |
20130295081 | Polyurethane Composite for Wound Healing and Methods Thereof - The presently-disclosed subject matter includes polyurethane composites that include tissue component(s), as well as methods of making such composites and uses thereof. The polyurethane component can comprise a polyisocyanate prepolymer and a polyol. The tissue component can be a polysaccharide. Exemplary composites can be moldable and/or injectable, and can cure into a porous composite that provides mechanical strength and/or supports the in-growth of cells. Inventive composites have the advantage of being able to fill irregularly shaped areas, voids, or the like. Exemplary composites can be used for treating wounds. | 11-07-2013 |
20130302312 | METHOD OF TREATING A PATHOLOGICAL SYNDROME AND A PHARMACEUTICAL AGENT - A method of treating a pathological syndrome includes administration of an activated form of ultra-low doses of antibodies to an antigen, wherein said activated form is obtained by repeated consecutive dilution combined with external impact, and the antigen is a substance or a pharmaceutical agent exerting influence upon the mechanisms of formation of this particular pathological syndrome. | 11-14-2013 |
20130302313 | HEXON TAT-PTD MODIFIED ADENOVIRUS AND USES THEREOF - The invention provides a hexon Tat-PTD modified adenovirus, a gene delivery vector based on the modified adenovirus that enhances gene delivery efficiency, and an oncolytic agent based on the modified adenovirus that enhances tumor cell killing efficiency and improves therapeutic outcome. | 11-14-2013 |
20130323229 | METABOLIC THERAPY FOR OXIDATIVE STRESS IN THE BRAIN THROUGH TARGETED NEURONAL CATABOLISM OF N-ACETYL-ASPARTIC ACID - The present invention provides a novel method of treatment for treating brain disorders that manifest oxidative stress by providing targeted populations of neurons with the ability to catabolize the acetylated amino acid derivative, N-acetylaspatic acid (NAA) and further supply extraphysiological levels of ATP to neurons via the targeted expression of the NAA catabolic enzyme aspartoacylase (ASPA) in neurons and astrocytes. | 12-05-2013 |
20130323230 | TREATMENT OF MYELOSUPPRESSION - Methods are presented for attenuating myelosuppressive side effects of treatment regimens, promoting thrombopoiesis and neutrophil production, and increasing efficacy of treatment regimens, by administering PF4-interacting heparinoids. | 12-05-2013 |
20130323231 | TREATMENT AND PROGNOSIS OF SOLID TUMOUR CANCERS - The invention is based on the finding that the human RPT4 protein/gene can function as a therapeutic target for solid tumour type cancers, especially solid tumours of the colon, and that reducing the abundance of RPT4 in tumour cells causes a significant increase in cancer cell death, and potently decreases the survival and proliferation of cancer cells in tumour growth assays (FIGS. | 12-05-2013 |
20130336957 | NOVEL PURIFICATION OF HUMAN, HUMANIZED, OR CHIMERIC ANTIBODIES USING PROTEIN A AFFINITY CHROMATOGRAPHY - Disclosed herein are compositions and methods for the isolation and purification of antibodies from a sample matrix. In particular, the present invention relates to compositions and methods for isolating and purifying antibodies exhibiting low or high binding capacity for Protein A resin. In certain embodiments, the methods herein employ a kosmotropic salt solution, an affinity chromatographic step, and may include one or more additional chromatography and/or filtration steps to achieve the desired degree of purification. The present invention is also directed toward pharmaceutical compositions comprising one or more antibodies purified by a method described herein. | 12-19-2013 |
20130336958 | NOTCH Inhibition In The Treatment Of Cardiovascular Disease - The present invention is directed to methods of treating or preventing atherosclerosis and other cardiovascular diseases by administering agents that inhibit or modulate the NOTCH signaling pathway. In addition, the invention encompasses methods for assaying compounds for their ability to treat atherosclerosis based upon their effects on NOTCH signaling, and for measuring levels of amount, function, or activity of NOTCH pathway components in biological samples. | 12-19-2013 |
20140004100 | IMMUNE REGULATORY OLIGONUCLEOTIDE (IRO) COMPOUNDS TO MODULATE TOLL-LIKE RECEPTOR BASED IMMUNE RESPONSE | 01-02-2014 |
20140004101 | SMAC PEPTIDOMETICS USEFUL AS IAP INHIBITORS | 01-02-2014 |
20140004102 | Methods for treating and/or limiting development of diabetes | 01-02-2014 |
20140017226 | TREATMENT OF MULTIPLE SCLEROSIS WITH COMBINATION OF LAQUINIMOD AND FAMPRIDINE - This invention provides a method of treating a subject afflicted with multiple sclerosis or presenting a clinically isolated syndrome comprising administering to the subject fampridine as an add-on therapy to or in combination with laquinimod. This invention also provides a package comprising laquinimod and fampridine for treating a subject afflicted with multiple sclerosis or presenting a clinically isolated syndrome. This invention also provides fampridine for use as an add-on therapy or in combination with laquinimod in treating a subject afflicted with multiple sclerosis or presenting a clinically isolated syndrome. This invention also provides a pharmaceutical composition comprising laquinimod and fampridine for use in treating a subject afflicted with multiple sclerosis or presenting a clinically isolated syndrome. This invention further provides use of laquinimod and fampridine in the preparation of a combination for treating a subject afflicted with multiple sclerosis or presenting a clinically isolated syndrome. | 01-16-2014 |
20140017227 | GENE SIGNATURES FOR USE WITH HEPATOCELLULAR CARCINOMA - The present invention provides a method for predicting prognosis of hepatocellular carcinoma patients based on measurement of the relative level of expression of a combination of 15 immune genes of interest, or a subset thereof, in the tumors of such patients. Tumor material can come from surgical resection or biopsy. The relative gene expression information may be combined in an algorithm. The signature can be used by itself or in combination with other information such as stage information. | 01-16-2014 |
20140023635 | SINGLE NUCLEOTIDE POLYMORPHISMS AND GENES ASSOCIATED WITH T2D-RELATED COMPLICATIONS - The invention provides with means to predict, in subjects affected by type-2-diabetes (T2D), the probability of developing complications related to the disease. The invention involves (1) identification of genetic features such as single nucleotide polymorphisms (SNPs) for the establishment of a patient profile that can be used for prediction of complications associated with T2D. Signature profiles comprising a combination of SNPs which have greater predictive value for prognosticating particular types of complications, such as, stroke, myocardial infarction and kidney complications associated with T2D are further described. Compositions and kits that can be used with a set of complementary phenotypic markers to evaluate the risk for an individual affected by T2D to develop complications related to the disease and to evaluate the likelihood that an individual affected by type 2 diabetes type will benefit from treatments that collectively aim to reduce the risk of developing such complications. | 01-23-2014 |
20140023636 | AMINOCARBOXYLIC ACID DERIVATIVE AND MEDICINAL USE THEREOF - The present invention relates to a compound represented by the formula (I), a salt thereof, an N-oxide form thereof, a solvate thereof, or a prodrug thereof, and a medicament containing the same. The compound represented by the formula (I) has an ability to bind to an S1P receptor (particularly, EDG-1, EDG-6, and/or EDG-8) and is useful for preventing and/or treating for rejection to transplantation, graft-versus-host disease, autoimmune diseases, allergic diseases, neurodegenerating diseases, and the like. | 01-23-2014 |
20140030251 | COMPOSITION AND METHOD FOR REDUCING TISSUE DAMAGE FROM INFLAMMATORY DISORDER OR PATHOGENIC INFECTION - Compositions and methods for preventing or ameliorating tissue damage caused by an inflammatory disorder or pathogenic infections are described. In one aspect, a method for preventing or ameliorating tissue damage caused by an inflammatory disorder or pathogenic infection comprises administering to a subject a therapeutically effective amount of a neuregulin. In another aspect, the composition comprises one or more active agents that: (a) increase expression or activity of a neuregulin; (b) inhibit the expression or activity of CXCL10, STAT3 or HEME; or (c) both (a) and (b). | 01-30-2014 |
20140030252 | METHOD TO PRODUCE A HIGHLY CONCENTRATED IMMUNOGLOBULIN PREPARATION FOR SUBCUTANEOUS USE - The present invention relates to a new and improved method for preparing a highly concentrated immunoglobulin composition from pooled plasma for subcutaneous injection. A composition comprising 20% or more immunoglobulin suitable for subcutaneous use is also described. | 01-30-2014 |
20140050718 | Methods and Compositions for Enhancing Intranasal Delivery of Therapeutic Agents - A method for treating a patient suffering from a condition with an active compound comprising the steps of (a) treating the patient intranasally with an effective amount of MMP-9 or a functionally equivalent fragment, wherein the tight junctions of the patient's nasal epithelial cells are modulated or wherein the basal lamina of the patient is partially digested and type IV collagen of the patient is degraded or wherein access to the patient's perineural, perivascular, or lymphatic compartment spaces is facilitated and (b) treating the patient intranasally with an active compound is disclosed. | 02-20-2014 |
20140056871 | ANTI-INFLAMMATORY ANTIBODIES AND USES THEREFOR - The invention provides antibodies that inhibit activation of complement, which may be used to treat various inflammatory diseases or disorders. | 02-27-2014 |
20140065132 | DIAGNOSIS AND TREATMENT OF AUTISM SPECTRUM DISORDER - Disclosed herein are compositions, systems, and methods for diagnosing and treatment of subjects suffering from anxiety, autism spectrum disorder (ASD), or a pathological condition with one or more of the symptoms of ASD. | 03-06-2014 |
20140065133 | JAK/STAT INHIBITORS AND MAPK/ERK INHIBITORS FOR RSV INFECTION - The present invention concerns a method for treating or reducing the likelihood of developing a respiratory syncytial virus (RSV) infection in a subject by administering an effective amount of an inhibitor of the janus kinase (JAK)/signal transducer and activator of transcription (STAT) signaling pathway or the mitogen-activated kinase (MAPK)/extracellular signal-regulated kinase (ERK1/2) signaling pathway to the subject. Another aspect of the invention concerns a pharmaceutical composition that includes an inhibitor of JAK/STAT or MAPK/ERK signaling to the subject; and a pharmaceutically acceptable carrier. Another aspect of the invention concerns a method for identifying agents useful for treating or reducing the likelihood of developing an RSV infection | 03-06-2014 |
20140072550 | GENETIC POLYMORPHISMS ASSOCIATED WITH CORONARY EVENTS AND DRUG RESPONSE, METHODS OF DETECTION AND USES THEREOF - The present invention provides compositions and methods based on genetic polymorphisms that are associated with coronary heart disease (particularly myocardial infarction), aneurysm/dissection, and/or response to drug treatment, particularly statin treatment. For example, the present invention relates to nucleic acid molecules containing the polymorphisms, variant proteins encoded by these nucleic acid molecules, reagents for detecting the polymorphic nucleic acid molecules and variant proteins, and methods of using the nucleic acid molecules and proteins as well as methods of using reagents for their detection. | 03-13-2014 |
20140079688 | Methods for treating ophthalmic disorders, diseases and injuries - The invention is directed to methods for treating ophthalmic disorders, diseases and injuries. In particular, the invention is directed to treating disorders, diseases and injuries of the cornea and ocular surface. Such methods utilize novel compositions including, but not limited to, trophic factor secreting extraembryonic cells (herein referred to as TSE cells), including, but not limited to, Amnion-derived Multipotent Progenitor cells (herein referred to as AMP cells) and conditioned media derived therefrom (herein referred to as Amnion-derived Cellular Cytokine Solution or ACCS), and Physiologic Cytokine Solution (herein referred to as PCS), each alone or in combination with each other and/or other agents. | 03-20-2014 |
20140086901 | Inhibition of Post-Radiation Tumor Growth - Compositions and methods for inhibiting the growth of solid tumors following radiation treatment are described. The compositions and methods target matrix metalloproteinases and bone marrow-derived cells expressing matrix metalloproteinases. | 03-27-2014 |
20140086902 | DETERMINING IMMUNOGLOBULINS IN NON-BLOOD BODY FLUIDS OF NEONATAL UNGULATES - Provided is a method for determining immunoglobulins in a neonatal ungulate. The method entails obtaining a sample of oral secretions from the neonatal ungulate and measuring an amount of immunoglobulins in the sample of oral secretions. The method is faster and more convenient than previously available methods for determining immunglobulins in neonatal ungulates, such as neonatal horses and cattle. | 03-27-2014 |
20140112909 | METHODS AND FORMULATIONS PROMOTING TISSUE/ORGAN REGENERATION, LONGEVITY AND HEALTHSPAN - A method includes a step of identifying a subject in need of diet modification; and administering a first diet to the subject for a first time period. The first diet provides 4.5 to 7 kilocalories per pound of subject for a first day and 3 to 5 kilocalories per pound of subject per day for a second to fifth day of the first diet. The first diet includes less than 30 g of sugar on the first day; less than 20 g of sugar on the second to fifth days; less than 28 g of proteins on the first day; less than 18 g of proteins on days the second to fifth days; 20 to 30 grams of monounsaturated fats on the first day; 10 to 15 grams of monounsaturated fats on the second to fifth days; and between 6 and 10 grams of polyunsaturated fats on the first day. | 04-24-2014 |
20140112910 | MODIFIED GLYCOPROTEINS - Sulfated glycoproteins, and methods of making and using such sulfated glycoproteins, are described. | 04-24-2014 |
20140120079 | Compositions and Methods for Diagnosing and Treating Diabetic Micro Vascular Complications - Disclosed herein are compositions and methods for the identification of a subject at risk for developing microvascular complications associated with diabetes such as diabetic nephropathy and diabetic retinopathy. Also disclosed is a therapeutic target for the prevention and treatment of microvascular complications associated with diabetes. | 05-01-2014 |
20140120080 | Method for Treating or Preventing an Inflammatory Disease and/or an Autoimmune Disease - The present invention relates to a method for treating or preventing either one or both of an inflammatory disease and an autoimmune disease in a patient, wherein the method comprises providing a pharmaceutical composition containing a therapeutically effective amount of soluble FcγR; administering said composition to a patient, followed by a safety period of several weeks, followed by a subsequent treatment cycle of at least two weekly administrations, wherein said therapeutically effective amount is effective to treat or prevent said disease in said patient. The present invention also provides a pharmaceutical composition in the form of a multiple-dosage-kit which contains sufficient amounts of administration doses of soluble FcγR for effectively treating or preventing inflammatory diseases and/or autoimmune diseases in a patient. | 05-01-2014 |
20140120081 | USE OF CARBON NANOMATERIALS WITH ANTIOXIDANT PROPERTIES TO TREAT OXIDATIVE STRESS - In some embodiments, the present invention provides methods of treating oxidative stress in a subject by administering a therapeutic composition to the subject. In some embodiments, the therapeutic composition comprises a carbon nanomaterial with anti-oxidant activity. In some embodiments, the anti-oxidant activity of the carbon nanomaterial corresponds to ORAC values between about 200 to about 15,000. In some embodiments, the administered carbon nanomaterials include at least one of single-walled nanotubes, double-walled nanotubes, triple-walled nanotubes, multi-walled nanotubes, ultra-short nanotubes, graphene, graphene nanoribbons, graphite, graphite oxide nanoribbons, carbon black, oxidized carbon black, hydrophilic carbon clusters, and combinations thereof. In some embodiments, the carbon nanomaterial is an ultra-short single-walled nanotube that is functionalized with a plurality of solubilizing groups. In some embodiments, the carbon nanomaterial is a polyethylene glycol functionalized hydrophilic carbon cluster (PEG-HCC). In some embodiments, the administered therapeutic compositions of the present invention may also include an active agent or targeting agent associated with the carbon nanomaterial. Additional embodiments of the present invention pertain to the aforementioned carbon nanomaterial compositions for treating oxidative stress. | 05-01-2014 |
20140140986 | MATERIALS AND METHODS FOR DIRECTING AN IMMUNE RESPONSE TO AN EPITOPE - The present invention relates to compositions, kits, and methods useful for directing an immune response to an epitope of an antigen in a subject, by sensitizing the subject to the epitope and/or by tolerizing the subject to the epitope. The sensitizing method comprises co-administering to the subject the epitope and an immunoglobulin M (IgM) constant region (IgM Fc region). The tolerizing method comprises co-administering to the subject the epitope and an immunoglobulin G (IgG) constant region (IgG Fc region) to the subject. | 05-22-2014 |
20140140987 | Manufacturing and Purification Processes of Complex Protein found in Fraction IV to make a separated Apo, Transferrin, and Alpha 1 Anti strepsin (A1AT) or A combined Transferrin/Apo/Human Albumin/A1AT and all new found proteins - A method of introducing healthy good human cells to eat up bad damaged cells, comprising administering an effective amount of a healthy good protein containing transferrin, alpha 1-antitrypsin, apolipoprotein A and human albumin. The method further comprises administering an effective amount of a protein containing ApoA1/2/4, or administering an effective amount of a protein containing Factor II, Factor VII, Factor IX and Factor X in prothrombin complex concentrate. The method can further comprise administering an effective amount of fibrinogen, Factor VIII, high concentrate fibrinogen, thrombin. hepatitis B immune globulin (HBIG), anti-thrombin III (AT-III), protein C, fibronectin, protein S and protein M. | 05-22-2014 |
20140147434 | NCoR1 is a Physiological Modulator of Muscle Mass and Oxidative Function - The present invention provides methods of increasing muscle mass and muscle mitochondrial oxidative metabolism. Additionally, the invention provides treating various disorders associated with mitochondrial dysfunction, including but not limited to metabolic disorders, muscular dystrophy disorders, neurodegenerative diseases, chronic inflammatory diseases, and diseases of aging. | 05-29-2014 |
20140154238 | Compositions And Methods For Treating, Diagnosing And Monitoring Disease - Compositions and methods which inhibit the expression of the TMEM92 gene or which inhibits the function of die TMEM92 protein can be used for treating, diagnosing and monitoring disease, for example cancer. | 06-05-2014 |
20140161790 | ENGINEERED IMMUNOGLOBULINS WITH EXTENDED IN VIVO HALF-LIFE - The present application relates to immunoglobulin compositions with improved half-life, and their application, particularly for therapeutic purposes. | 06-12-2014 |
20140161791 | DIAGNOSTIC MARKERS AND THERAPEUTIC TARGETS OF KAWASAKI DISEASE - The present invention provides for compositions and methods for diagnosing and treating Kawasaki disease. More specifically, the proteomes of patients with KD are enriched for the meprin A, filamin B, and filamin C, which serve as biomarkers (and potential therapeutic targets) for KD. Accordingly, detection of these biomarkers, using compositions and methods provided for herein, can inform the therapy delivered to the subject. | 06-12-2014 |
20140178360 | NOVEL PYRIMIDINE COMPOUNDS AS mTOR AND PI3K INHIBITORS - The present invention relates to pyrimidine compounds of formula (I): | 06-26-2014 |
20140178361 | METHOD FOR POLYCLONAL IMMUNOGLOBULIN G PRODUCTION BY HUMAN B CELLS - This application relates to an in vitro method of producing a polyclonal IgG preparation. The method comprises (i) placing a polyclonal B-cell population enriched in IgG-secreting B cells in a culture medium; and (ii) culturing the polyclonal B-cell population under conditions enabling the production of the polyclonal IgG preparation from the polyclonal B-cell population. This improved method enables the production of antibodies (preferably IgG) and facilitates long-term culture of polyclonal B-cell populations. | 06-26-2014 |
20140186332 | BIOMARKERS OF PRETERM BIRTH - The present disclosure relates to biomarkers of preterm birth, biomarkers of term birth, and methods of use thereof. In particular, the present disclosure provides methods of determining whether a pregnant woman is at an increased risk for premature delivery. The present disclosure further provides methods for decreasing a pregnant woman's risk for premature delivery. | 07-03-2014 |
20140186333 | GENETIC POLYMORPHISMS ASSOCIATED WITH VENOUS THROMBOSIS, METHODS OF DETECTION AND USES THEREOF - The present invention is based on the discovery of genetic polymorphisms that are associated with coronary heart disease and in particular VT and response to drug treatment. In particular, the present invention relates to nucleic acid molecules containing the polymorphisms, variant proteins encoded by such nucleic acid molecules, reagents for detecting the polymorphic nucleic acid molecules and proteins, and methods of using the nucleic acid and proteins as well as methods of using reagents for their detection. | 07-03-2014 |
20140186334 | SURFACE, ANCHORED FC-BAIT ANTIBODY DISPLAY SYSTEM - The present invention provides, in part, an antibody display system that simultaneously uses a secretion and a display mode. A bait complexed with a monovalent antibody fragment can be expressed on the surface of the host cell wherein the fragment may be assayed for antigen binding while full antibody is simultaneously secreted from the host cell. Methods of using the system for identifying antibodies that bind specifically to an antigen of interest are also provided. Polypeptides, polynucleotides and host cells useful for making the antibody display system are also provided along with methods of use thereof. | 07-03-2014 |
20140186335 | Certain Compounds, Compositions and Methods - The present invention provides certain tetrahydrouridine derivative compounds, pharmaceutical compositions and kits comprising such compounds, and methods of making and using such compounds. | 07-03-2014 |
20140193395 | SECRETORY IGA COMPOSITIONS, METHODS OF MAKING AND METHODS OF USE THEREOF - Described herein is secretory IgA isolated from the intestinal luminal fluid and intestinal mucosal of animals such as pigs and cows. Also included are methods of isolating secretory IgA. The secretory IgA is useful in food compositions such as animal and human food compositions as well as pharmaceutical compositions to increase growth rate, improve feed efficiency, reduce gastrointestinal inflammation, reduce a risk of gastrointestinal infection in the animal, or a combination thereof. | 07-10-2014 |
20140193396 | IMMUNE REGULATORY OLIGONUCLEOTIDE (IRO) COMPOUNDS TO MODULATE TOLL-LIKE RECEPTOR BASED IMMUNE RESPONSE - The invention provides immune regulatory oligonucleotides (IRO) as antagonist of TLRs and methods of use thereof. These IROs have unique sequences that inhibit TLR-mediated signaling in response to a TLR ligand or TLR agonist. The methods may have use in the prevention and treatment of cancer, an autoimmune disorder, airway inflammation, inflammatory disorders, infectious disease, skin disorders, allergy, asthma or a disease caused by a pathogen. | 07-10-2014 |
20140199289 | USE OF MATRIX METALLOPROTEINASE INHIBITORS TO TREAT TUBERCULOSIS - The present invention provides a method for treating a subject suffering from tuberculosis which comprises administering to the subject a composition comprising an amount of an inhibitor of a matrix metalloproteinase (MMP) in an amount effective to treat the subject, such that the therapeutic effect of said composition is different than the therapeutic effect attributable to the antibiotic properties of said composition. The present invention also provides a method for reducing or inhibiting destruction of lung extracellular matrix in a subject comprising administering to the subject at risk for such destruction a composition comprising an amount of an inhibitor of a matrix metalloproteinase (MMP) in an amount effective to reduce or inhibit destruction of lung extracellular matrix in the subject. | 07-17-2014 |
20140199290 | GENETIC POLYMORPHISMS ASSOCIATED WITH ALZHEIMER'S DISEASE, METHODS OF DETECTION AND USES THEREOF - The present invention is based on the discovery of genetic polymorphisms that are associated with Alzheimer's disease. In particular, the present invention relates to nucleic acid molecules containing the polymorphisms, variant proteins encoded by such nucleic acid molecules, reagents for detecting the polymorphic nucleic acid molecules and proteins, and methods of using the nucleic acid and proteins as well as methods of using reagents for their detection. | 07-17-2014 |
20140205591 | Metabolite Biomarkers for Diagnosis and Prognosis of Pediatric Septic Shock - The present invention provides methods for differentiating a pediatric subject with pediatric septic shock from a healthy pediatric subject or one having sudden inflammatory response syndrome (SIRS). Also provided is a method of predicting pediatric septic shock mortality in a pediatric septic shock patient. | 07-24-2014 |
20140205592 | Stratification of cancer patients for susceptibility to therapy with PTK2 inhibitors - The present invention relates to a method for determining whether a cancer patient is susceptible to treatment with a protein tyrosine kinase 2 (PTK2) inhibitor, comprising detecting the expression of the E-cadherin protein in a cancer sample of said cancer patient, wherein an E-cadherin protein immunoreactivity score (IRS) of 0-2 indicates that the cancer patient is susceptible to treatment with a PTK2 inhibitor. Said detection of the expression of the E-cadherin protein in a cancer sample of a cancer patient is preferably conducted by way of an immunohistochemistry (IHC) method. Said IHC method preferably employs a primary antibody which is specific for E-cadherin and a secondary antibody which specifically reacts with the primary antibody. The present invention also relates to a method of treating a cancer patient whose cancer is characterized by an E-cadherin protein immunoreactivity score (IRS) of 0-2, comprising administering to the patient a therapeutically effective amount of a PTK2 inhibitor. In a further aspect, the present invention relates to a PTK2 inhibitor for use in the treatment of a cancer patient whose cancer is characterized by an E-cadherin protein immunoreactivity score (IRS) of 0-2. The present invention also provides a method of screening for a therapeutically effective PTK2 inhibitor comprising the steps of (a) providing cancer cells or a cancer cell line which are characterized by an E-cadherin protein immunoreactivity score of 2, 1, or 0 (1 being preferred and 0 being even more preferred); (b) contacting the cancer cell or the cancer cell line of (a) with a PTK2 inhibitor; and (c) evaluating whether the PTK2 inhibitor negatively affects the cancer cell/cancer cell lines. In a further aspect, the present invention relates to a method for stratifying cancer patients that are susceptible to treatment with a PTK2 inhibitor, comprising determining the E-cadherin IRS score in a cancer sample of said patient, wherein an E-cadherin protein immunoreactivity score (IRS) of 0-2 (i.e. 2, 1, or 0) indicates that the cancer patient is susceptible to treatment with a PTK2 inhibitor. The present invention also relates to a pharmaceutical package comprising a PTK2 inhibitor, and (a) instructions and/or an imprint indicating that said PTK2 inhibitor is to be used for the treatment of patients which suffer from a cancer which is characterized by an E-cadherin protein immunoreactivity score of 2, 1, or 0 (1 being preferred and 0 being more preferred); and/or (b) instructions and/or an imprint indicating that said patient is to be stratified by a method of the present invention; and/or (c) means to carry out a method as defined herein. | 07-24-2014 |
20140212407 | TREATMENT OF OBESITY - The present disclosure relates to the treatment, e.g. reduction, of body fat mass levels for example in overweight and obese subjects. The present disclosure also relates to weight control in a subject where obesity should be avoided. Disclosed herein are methods of reducing body fat mass e.g. reducing obesity or preventing weight gain and agents used in such methods whereby the agents inhibit a sulphur containing amino acid. Also included in the present disclosure include, without being limited to, methods for determining regimes for the treatment of obesity as well as other subject matter. | 07-31-2014 |
20140219995 | INHIBITORS OF BACTERIAL TYPE III SECRETION SYSTEM - Organic compounds showing the ability to inhibit effector toxin secretion or translocation mediated by bacterial type III secretion systems are disclosed. The disclosed type III secretion system inhibitor compounds are useful for combating infections by Gram-negative bacteria such as | 08-07-2014 |
20140219996 | RUTHENIUM CARBON MONOXIDE RELEASING MOLECULES AND USES THEREOF - The present invention provides novel ruthenium compounds of Formula (I): or salts, isomers, hydrates, or solvates thereof, or combinations thereof; wherein E, R | 08-07-2014 |
20140219997 | Templated Islet Cells and Small Islet Cell Clusters for Diabetes Treatment - A population of small reaggregated islets or clusters engineered from individual islet cells and having improved characteristics as compared to native isolated islets. | 08-07-2014 |
20140219998 | ARMET AS A MARKER FOR CANCER - Disclosed is a method aiding in the assessment of cancer. More specifically disclosed is the use of the arginine-rich metastasized in early tumors protein (=ARMET) as a universal marker of different cancer types. ARMET aids in the assessment of pulmonary or lung cancer (LC) or of colon cancer, e.g., of non-small cell lung carcinoma (NSCLC) or colorectal cancer (CRC), but also likely of other specific types of cancer. Such specific cancer types are, e.g., breast, ovary, cervix, head and neck, endometrium, melanoma, bladder, kidney, pancreas, prostate, esophagus, stomach or bile duct cancer. Further disclosed is a method for assessing cancer from a liquid sample, derived from an individual by measuring ARMET in the sample. Measurement of ARMET can, e.g., be used in the early detection of cancer or in the surveillance of patients who undergo surgery. | 08-07-2014 |
20140234291 | GENETIC POLYMORPHISMS ASSOCIATED WITH RHEUMATOID ARTHRITIS, METHODS OF DETECTION AND USES THEREOF - The present invention is based on the discovery of genetic polymorphisms that are associated with rheumatoid arthritis. In particular, the present invention relates to nucleic acid molecules containing the polymorphisms, variant proteins encoded by such nucleic acid molecules, reagents for detecting the polymorphic nucleic acid molecules and proteins, and methods of using the nucleic acid and proteins as well as methods of using reagents for their detection. | 08-21-2014 |
20140234292 | Process for Producing a Plasma Protein-Containing Medicament - There is disclosed a method of preparing a plasma protein-containing medicament from citrated plasma or from a citrate-containing plasma fraction, the medicament being substantially free from undesired metals, which method comprises the following steps
| 08-21-2014 |
20140234293 | Combination Therapy Using Immunoglobulin and C1-Inhibitor - Methods are disclosed for treating cerebral ischemia using a combination of C1-INH and immunoglobulin, such as human plasma derived immunoglobulin (IVIG). | 08-21-2014 |
20140242067 | TREATMENT OF CENTRAL NERVOUS SYSTEM DISORDERS BY INTRANASAL ADMINISTRATION OF IMMUNOGLOBULIN G - The present invention provides, among other aspects, methods and compositions for treating a central nervous system (CNS) disorder by delivering a therapeutically effective amount of a composition of pooled human immunoglobulin G (IgG) to the brain via intranasal administration of the composition directly to the olfactory epithelium of the nasal cavity. In particular, methods and compositions for treating Alzheimer's disease are provided. | 08-28-2014 |
20140248260 | USE OF TOLL-LIKE RECEPTOR AGONIST FOR TREATING CANCER - The present invention is directed to methods and agents used for treating cancer in Toll-Like Receptor 5-expressing tissues by providing a Toll-Like Receptor agonist such as flagellin. The present invention also relates to protecting the liver from a liver toxicity using a Toll-like receptor agonist. | 09-04-2014 |
20140255386 | MICRORNA MODULATORS AND METHOD FOR IDENTIFYING AND USING THE SAME - The present invention is a method for identifying agents which modulate microRNA activity. The invention involves contacting a cell harboring a microRNA and a microRNA binding sequence, which is operably linked to a nucleic acid molecule encoding a reporter protein, with a test agent and determining whether the test agent increases or decreases the expression of the reporter protein thereby identifying a microRNA modulator. Antagonists identified by this screening assay are provided, as are methods for using the same to inhibit microRNA activity and prevent or treat disease. | 09-11-2014 |
20140255387 | Genetic Alterations and Methods of Use Thereof for the Diagnosis and Treatment of Type 1 Diabetes - Compositions and methods for the diagnosis and treatment of T1D are disclosed. More specifically, the invention provides gene targets containing single nucleotide polymorphisms associated with this disease. Methods and kits for using the sequences so identified for diagnostic and therapeutic purposes are also provided. | 09-11-2014 |
20140271613 | Surgical Compositions - The present disclosure relates to multi-component hydrogels. The hydrogels may include a natural component having nucleophilic functional groups as well as an electrophilic component. In embodiments, at least one of the components may be branched, having drugs, antibodies, enzymes, and the like incorporated therein, which may react with at least one of the other components of the hydrogel. Hydrogels of the present disclosure may be used to deliver bioactive agents and/or cells to a patient. | 09-18-2014 |
20140271614 | DIRECTED SEQUENCE POLYMER COMPOSITIONS AND ANTIBODIES THEREOF FOR THE TREATMENT OF PROTEIN CONFORMATIONAL DISORDERS - The instant invention comprises a process for the solid phase synthesis of directed epitope peptide mixtures useful in the treatment and diagnosis of protein conformational disorders, such process defined by a set of rules regarding the identity and the frequency of occurrence of amino acids that substitute a base or native amino acid of a known epitope. The resulting composition is a mixture of related peptides for therapeutic use. The invention also pertains to the process of generating antibodies using the directed epitope peptide mixtures as the antigens, and antibodies generated by such process, useful in the treatment and diagnostics of the said protein conformational disorder. | 09-18-2014 |
20140271615 | HYPOSIALYLATION DISORDERS - Methods are disclosed for diagnosing a hyposialylation disorder. Methods are also disclosed for determining the effectiveness of a therapeutic agent for treatment of a hyposialylation disorder in a subject. These methods include measuring an amount of monosialylated Thomsen-Friedenreich (ST) antigen and measuring an amount of non-sialylated Thomsen-Friedenreich antigen (T) in a biological sample, such as a serum or plasma sample from the subject and determining the ratio of T to ST. A ratio of T to monosialylated ST of about 0.06 or higher diagnoses the hyposialylation disorder or indicates that the therapeutic agent is not effective for the treatment of the hyposialylation disorder. In other embodiments, a ratio of T to ST less than about 0.06 indicates that the therapeutic agent is effective for the treatment of the hyposialylation disorder, or the subject does not have the hyposialylation disorder. In additional embodiments, these methods can be used to determine the lowest effective dosage of the therapeutic agent of use to treat the subject. | 09-18-2014 |
20140271616 | Compositions And Methods For Mesenchymal And/Or Chondrogenic Differentiation Of Stem Cells - Chondrocytes and compositions including chondrocytes produced via methods that do not require the formation of embryoid bodies are disclosed herein. The cells and compositions disclosed herein are suitable for use in treating osteoarthritis and other cartilage disorders or injury, as well as for tissue regeneration, particularly cartilage regeneration. | 09-18-2014 |
20140271617 | ION CONCENTRATION-DEPENDENT BINDING MOLECULE LIBRARY - Disclosed is a library consisting essentially of a plurality of antigen-binding molecules differing in sequence from each other, wherein an antigen-binding domain in each of the antigen-binding molecules comprises at least one amino acid residue that changes the antigen-binding activity of the antigen-binding molecule depending on ion concentration conditions. Also disclosed are a composition comprising a plurality of polynucleotide molecules each encoding the antigen-binding molecules, a composition comprising a plurality of vectors each comprising the polynucleotide molecules, a method for selecting the antigen-binding molecules, a method for isolating the polynucleotide molecules, a method for producing the antigen-binding molecules, and a pharmaceutical composition comprising any of the antigen-binding molecules. | 09-18-2014 |
20140286932 | Giant Obscurins and Uses Thereof in Cancer Prognosis and Therapy - Provided herein are methods and kits for evaluating potential for invasiveness, metastasis, or recurrence of an epithelial cell cancer. In the methods the expression profile of giant obscurins is detected in a tissue sample of tumor cells or suspected tumor cells and assessed for giant obscuring expression level and distribution therein. Decreased levels or altered distribution of giant obscurins in the cells compared to a control non-invasive standard or to a sample taken at a different point in time is indicative of increased potential of at least one of the invasiveness, metastasis, or recurrence of the epithelial cell cancer. The kit comprises a detection reagent suitable for detecting the presence and distribution of giant obscurins or an amount of the gene product(s) encoding giant obscurins in cells of a tissue sample and instructions for using the detection reagent. | 09-25-2014 |
20140294804 | METHODS OF TREATING PAIN - The invention relates to methods for treating pain disorders including neuropathic and inflammatory pain and to methods to reduce or eliminate nociceptive tolerance induced by opiate analgesic use by administering an agent that suppresses or blocks S1P biological activity. | 10-02-2014 |
20140314739 | Vaccine adjuvant composition comprising inulin particles - The present invention provides a composition comprising or consisting of inulin particles for use in the reduction or inhibition of inflammation, and/or for treating or preventing inflammatory disease, in a subject. Also provided is a pharmaceutically acceptable composition comprising: particles of inulin; and a substance comprising or consisting of one or more pathogen-associated molecular patterns (PAMPs), or an equivalent kit of parts, and methods and uses of the composition and kit for inducing or modulating an immune response in a subject, such as modulating an immune response to an antigen or allergen and/or as a vaccine. Also provided is a single-dose vaccine composition comprising inulin particles, an antigen and, optionally, an antigen-binding carrier material, and methods and uses of the vaccine. | 10-23-2014 |
20140314740 | COMPOSITIONS AND METHODS FOR THE PREVENTION OR TREATMENT OF DIABETIC COMPLICATIONS - The invention provides compositions and methods for the prevention, amelioration, and/or treatment of diabetes complications, including ocular diseases associated with increased glucose transport and/or oxidative stress. | 10-23-2014 |
20140322198 | COMPOSITION COMPRISING VICENIN-2 HAVING A BENEFICIAL EFFECT ON NEUROLOGICAL AND/OR COGNITIVE FUNCTION - The invention relates to an active ingredient and/or to a composition having beneficial effect on neurological and cognitive functions. | 10-30-2014 |
20140335074 | METHODS FOR IMPROVING MEDICAL THERAPIES - Methods are provided herein for enhancing the effectiveness of medical therapies by administering agents that suppress a biological damage response that is inducible by the medical therapy administered to a subject. In certain embodiments, a method is provided for administering an anti-senescent cell agent that suppresses a biological response comprising cellular senescence that is induced by the medical therapy. | 11-13-2014 |
20140341883 | DELAMINATION RESISTANT PHARMACEUTICAL GLASS CONTAINERS CONTAINING ACTIVE PHARMACEUTICAL INGREDIENTS - The present invention is based, at least in part, on the identification of a pharmaceutical container formed, at least in part, of a glass composition which exhibits a reduced propensity to delaminate, i.e., a reduced propensity to shed glass particulates. As a result, the presently claimed containers are particularly suited for storage of pharmaceutical compositions and, specifically, a pharmaceutical solution comprising a pharmaceutically active ingredient, for example, GAMMAGARD LIQUID (an immune globulin infusion (human)); ADVATE (Antihemophilic Factor (Recombinant), Plasma/Albumin-Free Method, (rAHF)); BAX 111 (vonicog alfa, or [618-threonine,709-aspartic acid] von Willebrand factor | 11-20-2014 |
20140348818 | BIOMARKERS OF KAWASAKI DISEASE - Biomarkers of Kawasaki Disease (KD) are provided. In certain aspects, methods are provided for detecting KD biomarkers, such as elevated PDGFC expression. Likewise, methods of treating a subject having a biomarker of KD are described. | 11-27-2014 |
20140356348 | METHODS OF PREDICTING AND DECREASING THE RISK OF PREGNANCY LOSS - Described are methods for diagnosing and predicting the risk of pregnancy loss in a subject based on the presence of an aberrant humoral response to three proteins, Apolipoprotein B-100, alpha2macrogloblin (alpha2M), and fibronectin. The presence or a detectable level of maternal IgG antibodies to trophoblast-derived fibronectin and/or ApoB-100, and/or the absence or a non-detectable level of antibodies specifically binding to alpha2M is associated with a history of RPL and an increased risk of pregnancy loss. Also described are methods for identifying subjects at risk of pregnancy loss, selecting subjects for participation in a clinical study, and methods of decreasing the risk of pregnancy loss in a subject which include detecting the presence or absence of antibodies to one or more of trophoblast-derived ApoB-100, alpha2M, and fibronectin. Also provided are kits that contain ApoB-100, alpha2M, and fibronectin. | 12-04-2014 |
20140363421 | BIO-ACTIVE PEPTIDE SUPPLEMENT - A colostrum derived bioactive supplement derived of a number of cleaved protein fragments. The colostrum supplement is utilized with milk protein and Leucine to provide improved muscular function and exercise recovery. | 12-11-2014 |
20140369997 | Pharmaceutical composition for a foaming eye drop - The present application describes a method of creating a foaming ophthalmic formulation. The described formulation includes the addition of a foaming agent. The resulting solution is designed to be distributed by a non-aerosol foaming bottle/or aerosol. | 12-18-2014 |
20140369998 | Biomarkers for Tuberculosis and HIV/AIDS - Described herein is a diagnostic test that identifies circulating biomarkers for the differentiation and classification of the pathogenesis of TB and/or HIV in a population. | 12-18-2014 |
20140369999 | SCREENING METHOD - This invention relates to a novel screening method that identifies simple molecular markers that are predictive of whether a particular disease condition is responsive to a specific treatment. Also, a method of diagnosing the susceptibility of an individual suffering from a disease to treatment with an HDAC inhibitor is provided. Also provided is a method of treating a proliferative disease or a condition which involves a change in cell differentiation or growth rate in a patient. | 12-18-2014 |
20140370000 | STABILIZATION OF IMMUNOGLOBULINS THROUGH AQUEOUS FORMULATION WITH HISTIDINE AT WEAK ACIDIC TO NEUTRAL PH - The present invention provides, among other aspects, storage stabile aqueous formulations of immunoglobulins with histidine at a mildly acidic to neutral pH. The present invention also provides methods for stabilizing immunoglobulin compositions by formulating with histidine at a mildly acidic to neutral pH. Advantageously, the methods and formulations provided herein allow stabile aqueous compositions of immunoglobulins at mildly acidic to neutral pH useful for parenteral administration. | 12-18-2014 |
20140377250 | COMPOSITIONS AND METHODS FOR POTENTIATING IMMUNE RESPONSE, ENHANCING IMMUNOTHERAPY, AND INCREASING VACCINE POTENCY - Compositions including at least one PNP inhibitor or at least one PNP inhibitor in combination with one or more agents identified as endogenous adjuvants useful for enhancing the potency of vaccine and cancer immunotherapies being administered for the prevention or treatment of infectious diseases or cancer. The compositions may be formulated as pharmaceutical dosage forms and components may be assembled as kits. Methods for increasing the levels of endogenous adjuvants to enhance the immunogenicity of an antigen as well as to augment the potency of vaccine and cancer immunotherapies are also disclosed. | 12-25-2014 |
20150010534 | Methods and Compositions for Treatment and Prevention of Major Depressive Disorder - The present invention relates to methods of diagnosing, prognosing or treating diseases or disorders in which elevated levels of Abeta protein, including abeta | 01-08-2015 |
20150023949 | COMPOSITIONS AND METHODS FOR DIAGNOSIS AND TREATMENT OF PERVASIVE DEVELOPMENTAL DISORDER - Methods for treatment and diagnosis of pervasive developmental disorders in humans are described. | 01-22-2015 |
20150023950 | 2,6-Diaminopyridine Compounds Suitable for Treating Diseases Associated with Amyloid or Amyloid-Like Proteins or for Treating or Preventing Ocular Diseases or Conditions Associated with a Pathological Abnormality/Change in the Tissue of the Visual System - The present invention relates to 2,6-diaminopyridine compounds that can be employed in the treatment of a group of disorders and abnormalities associated with amyloid protein and of diseases or conditions associated with amyloid-like proteins. The compounds of the present invention can also be used in the treatment of ocular diseases associated with pathological abnormalities/changes in the tissues of the visual system. | 01-22-2015 |
20150037316 | Placental Stem Cell Populations - The present invention provides placental stem cells and placental stem cell populations, and methods of culturing, proliferating and expanding the same. The invention also provides methods of differentiating the placental stem cells. The invention further provides methods of using the placental stem cells in assays and for transplanting. | 02-05-2015 |
20150037317 | METHOD FOR SELECTING A POOL OF MOLECULES - The present disclosure relates to a method for selecting a pool of molecules comprising detecting if the pool of molecules has binding specificity to an agent. A method for selecting a pool of biological markers in or on a cell, a composition comprising a pool of molecules, a method for delivering a therapeutic agent, and a method for diagnosing a condition in a subject are also provided. | 02-05-2015 |
20150037318 | TREATMENT OF MULTIPLE SCLEROSIS WITH COMBINATION OF LAQUINIMOD AND FLUPIRTINE - This invention provides a method of treating a subject afflicted with multiple sclerosis or presenting a clinically isolated syndrome comprising administering to the subject laquinimod as an add-on therapy to or in combination with flupirtine. This invention also provides a package and a pharmaceutical composition comprising laquinimod and flupirtine for treating a subject afflicted with multiple sclerosis or presenting a clinically isolated syndrome. This invention also provides laquinimod for use as an add-on therapy or in combination with flupirtine in treating a subject afflicted with multiple sclerosis or presenting a clinically isolated syndrome. This invention further provides use of laquinimod and flupirtine in the preparation of a combination for treating a subject afflicted with multiple sclerosis or presenting a clinically isolated syndrome. | 02-05-2015 |
20150044196 | Compositions for Inhibiting Gene Expression and Uses Thereof - The inventors have examined the means for providing more efficacious miRNA blocking compounds. The inventors have discovered new structural features that surprisingly improve the efficacy of miRNA blocking molecules. These features include the presence of multiple 3′ ends and a linker at the 5′ ends. Surprisingly, these features improve the efficacy of the gene expression blocking compounds in a manner that decreases the compound's biologic instability. Even more surprisingly, this effect has been found to be applicable to both DNA and RNA oligonucleotide-based compounds and to have application in traditional antisense and RNAi technology. | 02-12-2015 |
20150050265 | ANTI-MCPIP THERAPIES FOR OCULAR NEOVASCULARIZATION - There is provided a method of treating a condition in a subject in need characterized at least in part by abnormal, uncontrolled, undesirable or pathological ocular neovascularization. The method includes administering to the patient an effective amount of an interfering agent that inhibits the expression of MCPIP. | 02-19-2015 |
20150056180 | COMPOSITIONS COMPRISING SECRETORY - LIKE IMUNOGLOBULINS - The invention relates to methods for preparing compositions comprising secretory-like immunoglobulin, in particular secretory-like IgA and/or secretory-like IgM, and compositions obtainable by the methods. | 02-26-2015 |
20150056181 | NANOCARRIERS WITH MULTI-PHOTON RESPONSE ELEMENTS - Compositions are provided in which dendrimers and/or nanoparticles are synthesized with multi-photon responsive elements and self-immolative oligomers. The compositions may be utilized to selectively deliver Payloads within tissue by irradiating the compositions. The compositions may also be used to amplify sensitivity to irradiation. | 02-26-2015 |
20150064168 | Cadherin-11 Inhibitors and Methods of Use Thereof - Cadherin-11 inhibitors and methods for the prevention and treatment of cadherin-11 related diseases are described herein. Cadherin-11 related diseases include cancer and rheumatoid arthritis. | 03-05-2015 |
20150064169 | PROTEASE-REGULATED ANTIBODIES - This disclosure provides protease-regulated antibodies which specifically bind to tissue factor pathway inhibitor (TFPI). The antibodies are useful for treating bleeding disorders such as hemophilia. | 03-05-2015 |
20150064170 | Antibody Preparations - An antibody preparation suitable for intravenous administration in humans includes IgG, IgA and at least 5% IgM antibodies by weight of the total amount of antibodies. The preparation is prepared from human plasma, has specific complement activating activity, and, in an in vitro assay with human serum suitable to determine the ability of the antibody preparation to activate complement unspecifically, the antibody preparation generates substantially no C5a and/or substantially no C3a. The antibody preparation can have medical uses. | 03-05-2015 |
20150079070 | HYPERGLYCOSYLATED BINDING POLYPEPTIDES - Provided are binding polypeptides (e.g., antibodies), and effector moiety conjugates thereof, comprising a CH1 domain (e.g., a human IgG1 CH1 domain), wherein the CH1 domain has an engineered N-linked glycosylation site at amino acid position 114, according to Kabat numbering. Also provided are nucleic acids encoding the antigen-binding polypeptides, recombinant expression vectors and host cells for making such antigen-binding polypeptides. Methods of using the antigen-binding polypeptides disclosed herein to treat disease are also provided. | 03-19-2015 |
20150086534 | METHODS OF USE OF SECRETORY IgA - Described herein are methods of preventing and/or treating inflammation in a barrier surface structure in an individual in need thereof by orally administering to the individual an anti-inflammatory amount of secretory IgA. | 03-26-2015 |
20150086535 | Use of Survivin Antagonists in Polyomavirus-Related Disease - A method of treating a polyomavirus (+) cancer in which survivin is upregulated in a patient is provided, comprising administering to the patient a therapeutically effective amount of a composition that downregulates survivin expression or function in cells of the polyomavirus (+) cancer. A method of reducing growth of polyomavirus (+) cancer cells in which survivin is up-regulated is provided, comprising contacting the cells with an amount of a composition that downregulates survivin expression or function effective to reduce growth of the cells. Also provided is sepantronium salt, for use in treating a polyomavirus (+) cancer in which survivin is up-regulated. | 03-26-2015 |
20150086536 | Methods of Predicting Acute Rejection Outcomes - A method for assessing risk of losing a transplanted organ by a patient having an episode of acute rejection of the transplanted organ is described. The method includes obtaining from the patient a cell sample from the transplanted organ or peripheral blood, determining a level of FOXP3 in the cell sample, and correlating the level with the risk of loss of the transplanted organ, wherein, compared to a control level, a significantly greater level of FOXP3 in the cell sample from the transplanted organ or a significantly lower level of FOXP3 in the cell sample from the peripheral blood correlates with a decreased risk of loss of the transplanted organ. | 03-26-2015 |
20150093374 | NOVEL METHODS - The invention provides methods of inhalation treatment of a respiratory disease or condition in a patient in need to such treatment without producing in said patient systemic antimuscarinic effects, comprising administering to said patient an effective amount of aclidinium. | 04-02-2015 |
20150098935 | Induction of highly specific antibodies to a hapten but not to a carrier peptide by immunization - In this application Is described a composition and method for Inducing In a subject anti-hapten antibodies without Inducing antibodies to the carrier protein. Kits for designing and making compositions with desired haptens are also described. In this application Is disclosed a synthetic liposome composition comprising liposomes (L) containing monophosphoryl lipid A (MPLA) [L(MPLA)] and an immunoconjugate comprising a carrier and a hapten. In one embodiment, the carrier is a 23 amino acid hydrophobic membrane proximal external region peptide (MPER) derived from the gp41 transmembrane protein of HIV-1 that spontaneously associates with the outer surface of bilayers of liposomes containing MPLA during liposome formation. | 04-09-2015 |
20150098936 | REIMMUNIZATION AND ANTIBODY DESIGN - The present invention relates to methods for harvesting of antibodies from an antibody library. The antibodies are harvested by utilising a certain epitope that is analogous to the epitope of the antigen used for immunization but that may differ in global physical and biochemical properties allowing the production of antibodies against antigens that normally cannot be utilised as immunizing agents. The present invention furthermore relate to fields of use for harvested antigens in industry, agriculture and healthcare. | 04-09-2015 |
20150104440 | MiRNA-31 AS A DIAGNOSTIC, PROGNOSTIC AND THERAPEUTIC AGENT IN CANCER - The current disclosure reveals a complex regulatory pattern between miR-31 and AR, indicating that miR-31 plays a key role in prostate cancer development and progression. Another aspect of the current disclosure shows that miR-31 directly targets and destabilizes AR mRNA through interaction with the AR mRNA coding sequence showing that miR-31, or a fragment thereof has the ability to act as a novel therapeutic agent in treating cancer. The current disclosure also shows that AR indirectly represses miR-31 expression by binding to the miR-31 promoter region and modulating methyltransferase activity. Another aspect of the current disclosure shows that miR-31 indirectly modulates AR activity by modulating regulators of cell cycle progression. The disclosure further provides an isolated nucleic acid that modulates the activity of the androgen receptor in a cell. The disclosure further provides a method of treating a prostate cancer in a subject, by administering to the subject an effective amount of an agent that modulates the activity or levels of miR-31. | 04-16-2015 |
20150104441 | IDENTIFICATION OF DISEASE-DRIVING ANTIGENS - Provided herein is technology relating to treating disease and particularly, but not exclusively, to methods for identifying disease-related antigens by assessing T cell receptor gene frequencies in diseased subjects. | 04-16-2015 |
20150110773 | TARGETING THE GLUTAMINE TO PYRUVATE PATHWAY FOR TREATMENT OF ONCOGENIC KRAS-ASSOCIATED CANCER - Methods and kits for GPP-targeting, e.g., for the treatment of oncogenic Kras-associated cancers, and methods for determining the efficacy of those methods are provided. | 04-23-2015 |
20150110774 | S100 PROTEIN INHIBITORS FOR TREATING LEUKEMIA - The present invention relates to a compound, composition and method for reducing or inhibiting the differentiation or development of progenitor blood cells into malignant cells, leukemia cells or physiologically pathological cells. Particularly, the invention describes the use of inhibitors of S100 proteins, including myeloid related proteins. Inhibition of the activity or synthesis of S100 proteins results into reduction or inhibition of the production or proliferation of aberrant and cancer blood cells. | 04-23-2015 |
20150118221 | COMPOSITIONS AND METHODS FOR TREATING CARDIAC HYPERTROPHY - The present invention relates to the field of cardiology. More specifically, the present invention provides methods and compositions useful for treating cardiac hypertrophy. In a specific embodiment, a method for treating or preventing cardiac hypertrophy in a patient comprises the step of administering a therapeutically effective amount of a glycolipid synthesis inhibitor. | 04-30-2015 |
20150118222 | TREATMENT USING BRUTON'S TYROSINE KINASE INHIBITORS AND IMMUNOTHERAPY - Combinations of Bruton's tyrosine kinase (Btk) inhibitors, e.g., 1-((R)-3-(4-amino-3-(4-phenoxyphenyl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidin-1-yl)prop-2-en-1-one, with immunotherapy are provided. Also provided are methods of treating cancers, and autoimmune disorders by administering combinations of Bruton's tyrosine kinase (Btk) inhibitors, e.g., 1-((R)-3-(4-amino-3-(4-phenoxyphenyl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidin-1-yl)prop-2-en-1-one, and an immune checkpoint inhibitor. | 04-30-2015 |
20150125441 | METHODS OF TREATING DEPRESSION AND PAIN - The present invention provides methods of treating and pharmaceutical compositions useful for treating a mood disorder or depressive symptoms associated with pain, inducing analgesia and treating pain in a subject by administering a pharmaceutically effective amount of an agent capable of one or more of increasing GluA1 level, expression, concentration, or biological activity, increasing calcium permeable AMPA (α amino-3-hydroxy-5-methylisoxazole-4-propionic acid) receptor (CPAR) level, expression, concentration, or biological activity or potentiating a CPAR current. The agent may be an AMPA potentiator or ampakine. The agent may increase AMPA receptor currents by slowing the deactivation of open channels and may be, for instance, 2-pyrrolidinone, 4-[2-(phenylsulfonylamino)ethylthio]-2,6-difluorophenoxyacetamide (PEPA) or LY451646. The agent may also be a protein, RNA or DNA product. | 05-07-2015 |
20150132284 | METHOD OF TREATING ULCERATIVE COLITIS - Provided herein are methods of treating and inducing ulcerative colitis in a subject. Also provided are methods of treating subjects with mild to moderate active ulcerative colitis, including ulcerative proctitis and proctosigmoiditis. Also provided are methods of administering budesonide to a subject to treat ulcerative colitis, including ulcerative proctitis and proctosigmoiditis. | 05-14-2015 |
20150132285 | Proteinase-engineered Cancer Vaccine Induces Immune Responses to Prevent Cancer and to Systemically Kill Cancer Cells - The present invention provides a method of making a proteinase-engineered cancer vaccine for treating a cancer patient, especially for cancer patient at advanced/metastatic stage. The cancer vaccine comprises dead cancer cells with unbroken plasma membrane wherein the extracellular proteins and extracellular portion of membrane proteins are cleaved by proteinase digestion. The cancer vaccine may be derived from cancer cell lines or patients' cancer cells. The present invention provides a method of treating a cancer patient by administrating an effective amount of the cancer vaccine to the patient. In a clinical trial with 35 cancer patients, the cancer vaccine therapy brings cancer-free lives (no detectable tumor, micro tumor or cancer cells after treatment) back to 40% of these patients. The cancer vaccine therapy for the first time brings the promise of cure to this deadly disease. The present invention further provides a method of obtaining cancer-specific immune components from blood of individuals treated with the cancer vaccine. | 05-14-2015 |
20150290145 | Compositions and Methods for the Treatment of Parkinson's Disease - The present invention provides a method for treating, alleviating, reversing or delaying progression of at least one symptom of Parkinson's Disease in a subject in need thereof by administering to the subject an effective amount of a 2-amino-2[2-(4-octylphenyl)ethyl]propane-1,3-diol composition or a derivative thereof to treat at least one symptom of Parkinson's Disease. | 10-15-2015 |
20150299252 | COMPOSITIONS AND METHODS FOR MODULATING INNATE AND ADAPTIVE IMMUNE SYSTEMS - Compositions and methods useful in modulating the innate and adaptive immune systems in a subject, including activation of natural killer (NK) cells and/or CD8+ cytotoxic T lymphocytes. The method typically comprises: administering to the subject a composition comprising a therapeutic peptide or a multivalent structured polypeptide comprising multiple copies of the therapeutic peptide described herein in an amount sufficient to increase activity of NK cells and/or CD8+ cytotoxic T lymphocytes in the subject. Preferred therapeutic compositions comprise a carrier; at least one agent selected from the group consisting of: an anti-inflammatory agent, a cytotoxic T cell proliferation agent, or a NK cell proliferation agent; and a therapeutic peptide or a multivalent structured polypeptides of the invention. In certain embodiments, the composition further comprises an immunoglobulin admixed therewith in an amount sufficient to enhance passive immunoprotection in the subject. In other embodiments, the compositions are administered in a therapeutically effective amount to a subject in need thereof to treat rheumatoid arthritis. | 10-22-2015 |
20150299302 | Adult Stem Cells/Progenitor Cells and Stem Cell Proteins for Treatment of Eye Injuries and Diseases - The present invention encompasses methods and compositions for treating an ocular disease, disorder or condition in a mammal. The invention includes a population of mesenchymal stromal cells that possess anti-inflammatory, anti-apoptotic, immune modulatory and anti-tumorigenic properties. The invention includes administration of TSG-6, STC-1, or a combination thereof to the ocular as a treatment for an ocular disease, disorder or condition in a mammal. | 10-22-2015 |
20150299306 | METHODS AND COMPOSITIONS FOR MODULATION OF OLFML3 MEDIATED ANGIOGENESIS - The present invention relates to antibodies against specific domains of Olfml3 and the use of such in angiogenesis. In particular aspects, angiogenesis-related conditions, such as cancer, can be treated by the composition comprising the Olfml3 antagonists. | 10-22-2015 |
20150306231 | STABILIZED PROTEIN GEL PREPARATION - To provide a protein preparation which enables reduction of aggregation and a stable long-time preservation, in a protein preparation having a high concentration or a protein preparation susceptible to aggregation. The protein preparation is a gel preparation which is thixotropic and in which an included protein is protected from a physical or chemical stress, is inhibited from aggregation, and thereby stably exists. | 10-29-2015 |
20150307624 | USE OF ADCC-OPTIMIZED ANTIBODIES FOR TREATING WEAK PATIENTS - The invention concerns the use of human or humanized chimeric monoclonal antibodies which are produced in selected cell lines, said antibodies bringing about a high ADCC activity as well as a high secretion of cytokines and interleukins, for treating underpopulations of so-called weak-response patients exhibiting CD16 FCGR3A-158F homozygote or FCGR3A-158V/F heterozygote polymorphism. | 10-29-2015 |
20150307887 | FLT3 RECEPTOR ANTAGONISTS FOR THE TREATMENT OR THE PREVENTION OF PAIN DISORDERS - The present invention relates to FLT3 receptor antagonists or inhibitors of FLT3 receptor gene expression for the treatment or the prevention of pain disorders. | 10-29-2015 |
20150313536 | Demonstrable Efficacy Across or Within Patient Populations - The present invention provides methods for improving observed or determined efficacy by administration of agents to more severely diseased subjects, as contrasted with less severely diseased subjects. The present disclosure specifically demonstrates that, with respect to treatment of certain skin conditions, and particularly conditions associated with dysregulated and/or diseased skin cells, administration to more severely diseased subjects improves observed or determined efficacy. | 11-05-2015 |
20150313911 | INDOLIZINE COMPOUNDS, A PROCESS FOR THEIR PREPARATION AND PHARMACEUTICAL COMPOSITIONS CONTAINING THEM - Compounds of formula (I): | 11-05-2015 |
20150313923 | PHOSPHATE COMPOUNDS, A PROCESS FOR THEIR PREPARATION AND PHARMACEUTICAL COMPOSITIONS CONTAINING THEM - Compounds of formula (I): | 11-05-2015 |
20150316535 | CARDIAC STEM CELLS AND METHODS OF IDENTIFYING AND USING THE SAME - Methods of isolating cardiac cells, including cardiac cells capable of regenerating cardiac tissue are provided. Compositions comprising cardiac cells, including cardiac cells capable of regenerating cardiac tissue are also provided. Methods of using cardiac cells, cardiac progenitor cells, including cardiac cells capable of regenerating cardiac tissue, are provided. Methods of identifying the prognosis of patients treated for heart disease and/or methods of predicting the regeneration of cardiac cells in a subject are also provided. | 11-05-2015 |
20150323528 | PHARMACEUTICAL COMPOSITIONS COMPRISING INHIBITORS OF ZINC-ZIP8-MTF1 AS ACTIVE INGREDIENTS FOR PREVENTING OR TREATING A JOINT DISEASE - The present invention relates to identification of Zinc-ZIP8-MTF1 axis that plays an important role to OA (osteoarthritis) pathogenesis process and a novel use thereof. According to the present invention, ZIP8 and MTF1 of the present invention increase in the expression in joint disease induced cells or cartilage tissue, and induce the expression of various matrix-degrading enzymes (e.g., MMP-3, MMP-9, MMP-12, MMP-13 and ADAMTS-5 etc.). In addition, when the expression of ZIP8 or MTF1 is inhibited in cells or tissues of animals (e.g., human, mouse), OA pathogenesis is inhibited. Therefore, the ZIP8 and MTF1 of the present invention may be applied to the diagnosis or prognosis of joint diseases, and may be used for the development of therapeutics for joint diseases using these. | 11-12-2015 |
20150328199 | METHODS AND COMPOSITIONS USING 4-AMINO-2-(2,6-DIOXO-PIPERIDINE-3-YL)-ISOINDOLINE-1,3-DIONE FOR TREATMENT OF CANCERS - Methods and compositions for treating, preventing or managing cancers are disclosed. The methods encompass the administration of 4-amino-2-(2,6-dioxo-piperidine-3-yl)-isoindoline-1,3-dione, also known as Pomalidomide. Furthermore, provided herein are methods of treatment using this compound with chemotherapy, radiation therapy, hormonal therapy, biological therapy or immunotherapy. Pharmaceutical compositions and single unit dosage forms suitable for use in the methods provided herein are also disclosed. | 11-19-2015 |
20150328204 | METHODS FOR TREATMENT OF MELANOMA - Embodiments of the present invention are directed to methods for treatment of melanoma using an inhibitor of dihydroorotate dehydrogenase (DHODH) and to combination therapies that involve administering to a subject an inhibitor of oncogenic BRAF (e.g. BRAF(V600E)), as well as an inhibitor of dihydroorotate dehydrogenase (DHODH). Assays for identifying compounds useful for the treatment of melanoma are also provided. The methods comprise screening for compounds or agents that inhibit neural crest progenitor formation in a zebra fish model of melanoma. | 11-19-2015 |
20150330984 | METABOLOMIC PROFILING DEFINES ONCOGENES DRIVING PROSTATE TUMORS - The invention provides methods and products to identify metabolic status of Akt1 and Myc in tumors, and to treat cancer. The method comprises performing an assay to measure a profile of metabolites in a prostate tumor sample obtained from a subject, wherein the metabolites are differentially produced in prostate tumors with high Akt1 expression versus prostate tumors with high Myc expression; and comparing, with at least one processor, the profile of metabolites with an appropriate reference profile of the metabolites to assign an Akt1 and Myc metabolic status to the sample based on results of the comparison. | 11-19-2015 |
20150335666 | TREATMENT OF INFLAMMATORY DISEASES - The present invention relates generally to the field of inflammatory diseases of the peripheral nervous system. More particularly, it concerns methods for treating inflammatory diseases of the peripheral nervous system by modulating sphingosine-1-phosphate receptor activity. In one embodiment, the present invention provides a method of treating a subject with chronic inflammatory demyelinating polyneuropathy (CIDP) or other autoimmune neuropathies comprising administering to the subject an effective amount of FTY720. | 11-26-2015 |
20150335738 | SECRETORY IMMUNOGLOBULIN DEFICIENCY TREATMENT AND PROPHLAXIS - Slg preparation comprising SIgA and/or SIgM and a Vitamin A supplement, for use in the therapy or prophylaxis of mucosal immunoglobulin deficiency, as well as an oral immunoglobulin preparation comprising—a single-dose of 10 mg to 10 g SIgA and/or SIgM, and—a single-dose of 100 to 5000 micrograms retinol activity equivalents (RAE) Vitamin A, preferably retinylpalmitate, and optionally further components selected from the group consisting of vitamins and minerals. | 11-26-2015 |
20150336925 | SUBSTITUTED BENZOFURAN, BENZOTHIOPHENE AND INDOLE MCL-1 INHIBITORS - The present invention provides for compounds that inhibit the activity of an anti-apoptotic Bcl-2 family member Myeloid cell leukemia-1 (Mcl-1) protein. The present invention also provides for pharmaceutical compositions as well as methods for using compounds for treatment of diseases and conditions (e.g., cancer) characterized by the over-expression or dysregulation of Mcl-1 protein. | 11-26-2015 |
20150353514 | AMPHIPHILIC DERIVATIVES OF TRIAZAMACROCYCLIC COMPOUNDS, PRODUCTS AND COMPOSITIONS INCLUDING SAME, AND SYNTHESIS METHODS AND USES THEREOF - The invention relates to amphiphilic derivatives of a triazamacrocyclic compound, as well as to said derivatives as active molecule transporters. The invention also relates to a nanodrug including at least one amphiphilic derivative of a triazamacrocyclic compound and at least one active molecule of a protein such as an antibody, in particular for the treatment of autoimmune diseases or for the treatment of cancer. | 12-10-2015 |
20150354012 | DIAGNOSING IDH1 RELATED SUBGROUPS AND TREATMENT OF CANCER - The invention relates to classification, diagnosis and treatment of cancers. In one embodiment, the present invention provides methods and kits that classify cancers into various subtypes based on expression patterns of AKT pathway components. In another embodiment, the present invention provides methods and kits that diagnose cancer subtypes by evaluating expression patterns of AKT pathway components. In still another embodiment, the present invention provides methods and kits that treat a cancer subtype by administering an alkylating agent or a PI3K/AKT/mTOR inhibitor to a patient. Cancers suitable with various embodiments of the invention include but are not limited to brain tumors, gliomas and GBM. | 12-10-2015 |
20150355188 | BIOMARKERS OF PRETERM BIRTH - The present disclosure relates to biomarkers of preterm birth, biomarkers of term birth, and methods of use thereof. In particular, the present disclosure provides methods of determining whether a pregnant woman is at an increased risk for premature delivery. The present disclosure further provides methods for decreasing a pregnant woman's risk for premature delivery. | 12-10-2015 |
20150359882 | Methods and Compositions For Treating Clostridium Difficile Associated Disease - The present invention provides methods for treating and preventing the reoccurrence of | 12-17-2015 |
20150368324 | MODULATION OF SYNAPTIC MAINTENANCE - C1q is shown to be expressed in neurons, where it acts as a signal for synapse elimination. Methods are provided for protecting or treating an individual suffering from adverse effects of synapse loss. These findings have broad implications for a variety of clinical conditions, including Alzheimer's disease. | 12-24-2015 |
20150368326 | MODULATION OF SYNAPTIC MAINTENANCE - C1q is shown to be expressed in neurons, where it acts as a signal for synapse elimination. Methods are provided for protecting or treating an individual suffering from adverse effects of synapse loss. These findings have broad implications for a variety of clinical conditions, including Alzheimer's disease. | 12-24-2015 |
20150368339 | MUSCARINIC ACETYLCHOLINE RECEPTOR BINDING AGENTS AND USES THEREOF - Agents that specifically bind to a muscarinic acetylcholine receptor in a conformationally-specific way can be used to induce a conformational change in the receptor. Such agents have therapeutic applications and can be used in X-ray crystallography studies of the receptor. Such agents can also be used to improve drug discovery via compound screening and/or structure based drug design. | 12-24-2015 |
20150374817 | PHARMACEUTICAL COMPOSITION FOR THE TREATMENT OF BURNOUT SYNDROME - The present invention is directed to a pharmaceutical composition or a kit-of-parts and its use in the treatment of burnout syndrome and longevity therapy. | 12-31-2015 |
20150376274 | TREATMENT OF PERIPHERAL T CELL LYMPHOMA - The present disclosure relates to methods for the treatment, prevention and diagnostic of peripheral T cell lymphoma using compounds that specifically bind NKp46. Included in particular are compounds that bind NKp46 and deplete tumor cells that express at their surface NKp46, and pharmaceutical compositions comprising the same. The disclosure also relates to use of antibodies that specifically bind NKp46 in diagnostic and theranostic assays in the detection and treatment of peripheral T cell lymphoma. | 12-31-2015 |
20150377905 | METHODS FOR DIAGNOSIS OF KAWASAKI DISEASE - Methods for diagnosis of Kawasaki disease (KD) are disclosed. In particular, the invention relates to the use of biomarkers for aiding diagnosis, prognosis, and treatment of KD, and to a panel of biomarkers that can be used to distinguish KD from febrile illness. | 12-31-2015 |
20160000774 | TREATMENT OF MULTIPLE SCLEROSIS WITH COMBINATION OF LAQUINIMOD AND DIMETHYL FUMARATE - This invention provides a method of treating a subject afflicted with multiple sclerosis or presenting a clinically isolated syndrome comprising administering to the subject laquinimod as an add-on therapy to or in combination with DMF. This invention also provides a package comprising laquinimod and DMF for treating a subject afflicted with multiple sclerosis or presenting a clinically isolated syndrome. This invention also provides laquinimod for use as an add-on therapy or in combination with DMF in treating a subject afflicted with multiple sclerosis or presenting a clinically isolated syndrome. This invention also provides a pharmaceutical composition comprising laquinimod and DMF for use in treating a subject afflicted with multiple sclerosis or presenting a clinically isolated syndrome. This invention further provides use of laquinimod and DMF in the preparation of a combination for treating a subject afflicted with multiple sclerosis or presenting a clinically isolated syndrome. | 01-07-2016 |
20160002317 | Cytoplasmic Expression of Fab Proteins - The present invention relates generally to antigen binding polypeptides, such as Fab fragments and derivatives thereof, that demonstrate high stability and solubility. The present invention also relates to polynucleotides encoding such polypeptides, to libraries of such polypeptides or polynucleotides, and to methods of using such polypeptides in research, diagnostic and therapeutic applications. For example, the polypeptides can be used in screening methods to identify a polypeptide that binds to a particular target molecule. | 01-07-2016 |
20160002345 | A COMPOUND THAT SPECIFICALLY BINDS TO KIR3DL2 FOR USE IN THE TREATMENT OF PERIPHERAL T CELL LYMPHOMA - The present disclosure relates to methods for the treatment, prevention and diagnostic of peripheral T cell lymphoma using compounds that specifically bind KIR3DL2. The disclosure also relates to use of antibodies that specifically bind KIR3DL2 in diagnostic and theranostic assays in the detection and treatment of peripheral T cell lymphoma. | 01-07-2016 |
20160008461 | METHODS OF GENERATING ROBUST PASSIVE AND ACTIVE IMMUNE RESPONSES | 01-14-2016 |
20160025733 | METHODS OF DETECTING PROSTATE CANCER - The invention described herein provides biological markers for the diagnosis, prognosis, and monitoring of prostate cancer. | 01-28-2016 |
20160030563 | CONCENTRATED HUMAN IMMUNOGLOBULIN COMPOSITION - A liquid pharmaceutical composition containing human immunoglobulin G, preferably at 230 g/l or higher. The composition, suitable for subcutaneous or intramuscular administration, can be used to treat various diseases, e.g., an antibody production defect and Kawasaki disease. | 02-04-2016 |
20160041162 | Novel Immunotherapy Libraries - Following a novel immunotherapy process the archived aliquots of biologic material from each successive process is used to form a library in which further novel therapy can be developed. The patients essentially serve as the biologic assay for successful antigen processing response in the form of clinical response (i.e. tumor shrinkage, improvement in clinical status of disease). Only archived biologic material of clinically successful patients are then further used for further drug development. These patients are also evaluated for a positive MCH I or MHC II response. In the case of MHC II or antibody response: antibody producing cells (B-cells) are harvested or biopsied from various B-cell containing tissues and fused with multiple myeloma cells to form a further antibody production library, which may be further screened for antibodies to relevant antigens. In the case of MHC I or cell-mediated cytotoxic T or NK cell immune response, the archived electroporated immune cells can propagated and expanded in culture and transplanted back to the original patient or other patients in an allogeneic fashion. | 02-11-2016 |
20160045157 | SYSTEMS, METHODS, AND DEVICES TO INCENTIVIZE INHALER USE - The present disclosure relates to systems, methods, and devices that may be used to incentivize inhaler use. | 02-18-2016 |
20160045602 | MEDICAL ORGANOGEL PROCESSES AND COMPOSITIONS - Serial-solvent biomaterials are described. Embodiments include materials made in an organic solvent that are stripped of the solvent and used in a patient, where they imbibe water and form a hydrogel. These materials are useful for, among other things, delivering therapeutic agents, tissue augmentation, and radiological marking. | 02-18-2016 |
20160046705 | HETERODIMERIC IMMUNOGLOBULINS - The present application is directed to heterodimeric antibodies and methods of use. | 02-18-2016 |
20160051592 | Methods of treating diseases with human trophoblast stem cells - Existence of human trophoblast stem (hTS) cells has been suspected but unproved. The isolation of hTS cells is reported in the early stage of chorionic villi by expressions of FGF4, FGFR-2, Oct4, Thy-1, and stage-specific embryonic antigens distributed in different compartments of the cell. hTS cells are able to derive into specific cell phenotypes of the three primitive embryonic layers, produce chimeric reactions in mice, and retain a normal karyotype and telomere length. In hTS cells, Oct4 and fgfr-2 expressions can be knockdown by bFGF. These facts suggest that differentiation of the hTS cells play an important role in implantation and placentation. hTS cells could apply to human cell differentiation and for gene and cell-based therapies. | 02-25-2016 |
20160051640 | SOLUBLE GLYCOSAMINOGLYCANASES AND METHODS OF PREPARING AND USING SOLUBLE GLYCOSAMINOGLYCANASES - The invention relates to the discovery of novel soluble neutral active Hyaluronidase Glycoproteins (sHASEGPs), methods of manufacture, and their use to facilitate administration of other molecules or to alleviate glycosaminoglycan associated pathologies. Minimally active polypeptide domains of the soluble, neutral active sHASEGP domains are described that include asparagine-linked sugar moieties required for a functional neutral active hyaluronidase domain. Included are modified amino-terminal leader peptides that enhance secretion of sHASEGP. The invention further comprises sialated and pegylated form of a recombinant sHASEGP to enhance stability and serum pharmacokinetics over naturally occurring slaughterhouse enzymes. Further described are suitable formulations of a substantially purified recombinant sHASEGP glycoprotein derived from a eukaryotic cell that generate the proper glycosylation required for its optimal activity. | 02-25-2016 |
20160051726 | Collagenous Foam Materials - Provided is a foam material, comprising a plurality of substantially collagenous beads, wherein the foam material is a bead foam, and wherein adjacent collagenous beads are fused together by a network of collagen fibres. Also provided are methods for preparation of foam materials comprising a plurality of substantially collagenous beads. The foam materials may be used in applications such as bioscaffolds for wound healing, soft tissue regeneration and augmentation, for localized cell delivery, or as cell culture substrates for research. The foam materials include natural collagen fibrils that provide a stable scaffold and enhance integration of the implanted scaffold and regeneration of cells and tissue. | 02-25-2016 |
20160058783 | NUCLEOSIDE AND NUCLEOTIDE DERIVATIVES - The present invention discloses compounds of formula (I), or a pharmaceutically acceptable salt thereof: | 03-03-2016 |
20160058849 | TREATMENT OF SYNUCLEINOPATHIES - This invention relates generally to treating synucleinopathies in subjects that are not clinically diagnosed with a lysosomal storage disease, as well as associated methods of making medicaments and screening methods. | 03-03-2016 |
20160058880 | MINIMALLY TOXIC PRODRUGS - The present invention relates to the field of oligopeptide prodrugs that are intended for the treatment of cancer. The selectivity of these prodrugs requires the presence of an (oligo)peptidic moiety and/or a protective capping group to ensure the prodrug stability in blood. It further in particular relates to the exemplary oligopeptidic moiety ALGP and to prodrugs comprising it. In particular it also relates to the capping group phosphonoacetyl and to prodrugs comprising this capping group. | 03-03-2016 |
20160060357 | ANTI-FAP ANTIBODIES AND METHODS OF USE - The invention provides antibodies against Fibroblast Activation Protein (FAP) and methods of using the same. | 03-03-2016 |
20160060700 | COPY NUMBER VARIATIONS AND AUTOIMMUNE DISEASES - This disclosure describes methods of determining the copy number of FCGR3A and/or FCGR3B in the genome of an individual, which is shown herein to be statistically significantly associated with an increased risk of the individual developing an autoimmune disease. | 03-03-2016 |
20160074422 | MUCUS STRENGTHENING FORMULATIONS TO ALTER MUCUS BARRIER PROPERTIES - The present technology relates to compositions and methods that strengthen mucus barriers, e.g., reduce the permeability of the mucus barriers. In some embodiments, the compositions include a model bile and a lipid mixture, wherein the model bile includes at least one salt and a lecithin. In some embodiments, the composition is useful to treat necrotizing enterocolitis. | 03-17-2016 |
20160074484 | NUCLEOTIDE PHOSPHATE DISSIPATION AS A TREATMENT FOR VASCULAR DISORDERS - The present invention provides a method of treating or preventing immunoinflammatory, vascular, thrombotic or ischemic disorders in a subject, the method comprises administering to the subject an agent which dissipates nucleotide phosphates or generates a product which stimulates adenosine receptors. The present invention also provides a method of treating or preventing immunoinflammatory, thrombotic or ischemic disorders in a subject by inhibiting leukocyte infiltration into a site which comprises administering to the subject an effective amount a described agent. Agents described for use in the methods of the invention include CD73, a fragment a mutant, or a modified form thereof. | 03-17-2016 |
20160074505 | Method and System for Targeting the Microbiome to Promote Health and Treat Allergic and Inflammatory Diseases - A method and system for targeting the microbiome to promote health involves exposing an expectant mother to a mixture of farm derived manure-containing soil to reduce the chances her baby will suffer allergies and autoimmune diseases. City dwelling expectant mothers are exposed to immunologic agents and allergens in a fashion (e.g., via exposure to farm animal manure-containing soils) that charges their immune system and that of their fetus(es) so that their babies, once born, are provided with immunity against a variety of autoimmune diseases, including allergies commonly and increasingly experienced in modern urban environments. | 03-17-2016 |
20160074515 | VISCOSITY-REDUCING EXCIPIENT COMPOUNDS FOR PROTEIN FORMULATIONS - The invention encompasses formulations and methods for the production thereof that permit the delivery of concentrated protein solutions. The inventive methods can yield a lower viscosity liquid formulation or a higher concentration of therapeutic or nontherapeutic proteins in the liquid formulation, as compared to traditional protein solutions. | 03-17-2016 |
20160082038 | TREATMENT OF ARTHRITIS AND OTHER MUSCULOSKELETAL DISORDERS WITH CROSSLINKED HYALURONIC ACID - A method of treating a subject having a musculoskeletal disorder includes administering to a subject's articular site in need thereof an effective amount of a hyaluronic acid (HA) composition. In one embodiment, the HA composition includes an HA derivative, wherein carboxyl functionalities of the hyaluronic acid derivative are each independently derivatized to include an N-acylurea or O-acyl isourea, or both N-acylurea and O-acyl isourea. In another embodiment, the HA composition includes a crosslinked HA gel that is prepared by reacting an uncrosslinked HA with a biscarbodiimide in the presence of pH buffer in a range of between about 4 and about 8. The composite can optionally include at least one second bioactive agent other than the HA derivative, such as a steroid. | 03-24-2016 |
20160082097 | NEISSERIAL VACCINE COMPOSITIONS COMPRISING A COMBINATION OF ANTIGENS - The present invention relates to immunogenic compositions and vaccines for the treatment and prevention of Neisserial disease. Immunogenic compositions of the invention contain combinations of antigens selected from at least two different classes of antigens including adhesins, autotransporter proteins, toxins, iron acquisitions proteins and membrane-associated protein (preferably integral outer membrane protein)s. Such combinations of antigens are able to target the immune response against different aspects of the neisserial life cycle, resulting in a more effective immune response. | 03-24-2016 |
20160082152 | Birth Tissue Material and Method of Preparation - A method of treating a soft tissue defect in or on the body of a patient is provided. A placental construct for treatment of a disease or condition is also provided. The placental construct includes a therapeutically effective amount of a birth tissue material. | 03-24-2016 |
20160090387 | CALCIUM CHANNEL AGONISTS - Embodiments of calcium channel agonists, as well as methods of making and using the calcium channel agonists, are disclosed. The disclosed calcium channel agonists and corresponding salt forms have a structure according to general formula I: | 03-31-2016 |
20160095875 | SDF-1 binding nucleic acids and the use thereof in cancer treatment - The present invention is related to a nucleic acid molecule capable of binding to SDF-1, preferably capable of inhibiting SDF-1, whereby the nucleic acid molecule is for use in a method for the treatment and/or prevention of a disease or disorder, for use in a method for the treatment of a subject suffering from a disease or disorder or being at risk of developing a disease or disorder as an adjunct therapy, or for use as a medicament for the treatment and/or prevention of a disease or disorder, whereby the disease or disorder is cancer. | 04-07-2016 |
20160096879 | Viscosity-Reducing Excipient Compounds for Protein Formulations - The invention encompasses formulations and methods for the production thereof that permit the delivery of concentrated protein solutions. The inventive methods can yield a lower viscosity liquid formulation or a higher concentration of therapeutic or nontherapeutic proteins in the liquid formulation, as compared to traditional protein solutions. | 04-07-2016 |
20160096885 | DISTINCT EFFECTS OF IFN-GAMMA AND IL-17 ON TL1A MODULATED INFLAMMATION AND FIBROSIS - Described herein are methods and compositions related to Inflammatory Bowel Disease. Specifically TL1A drives regional intestinal inflammation and fibrosis and is differentially modulated by IFN gamma and IL-17a. In one embodiment, the present invention is a method of diagnosing a condition in a subject by determining the presence or absence of IFN gamma and/or IL-17 and diagnosing the subject. | 04-07-2016 |
20160114010 | METHODS FOR TREATING BLEEDING DISORDERS USING A PLATELET SUBPOPULATION - The present invention relates to a platelet subpopulation with high binding capacity to recombinant activated factor VII (rFVIIa), and its use for the treatment of bleeding disorders and for determining whether a subject is a candidate for treatment with rFVIIa. | 04-28-2016 |
20160120824 | COMPOSITION FOR TOPICAL APPLICATION COMPRISING GLYCEROL AND TANNINS - A preparation for topical application comprising glycerol and plant tannins, wherein the plant tannins have the capacity to bind to glycerol so that the glycerol has filmogen quality. | 05-05-2016 |
20160129079 | SEMAPHORIN 3A FOR TREATMENT AND PROGNOSIS OF SYSTEMIC LUPUS ERYTHEMATOSUS - The subject matter relates to Semaphorin 3A (Sema3A) and its use in treatment and prognosis of Systemic Lupus Erythematosus (SLE). Provided are, inter-alia, methods of treating a subject afflicted with SLE, comprising administering to the subject a pharmaceutical composition comprising isolated Sema3A. Further provided are methods for prognosis of SLE, comprising measuring Sema3A serum concentration in a subject in need thereof. | 05-12-2016 |
20160129112 | Pharmaceutical Compositions Comprising Pyrophosphate - Described herein are therapeutic compositions comprising a therapeutic agent and pyrophosphate. | 05-12-2016 |
20160136176 | NOVEL PYRIMIDINE COMPOUNDS AS mTOR AND PI3K INHIBITORS - The present invention relates to pyrimidine compounds of formula (I): | 05-19-2016 |
20160136251 | CD4 T Cell Vaccine and Use Thereof - The present invention relates to a CD4 T cell vaccine and a use thereof, and provides a CD4 T cell vaccine which can increase intracellular viability and effectively induce an antigen-specific cytotoxic T lymphocyte (CTL) response. | 05-19-2016 |
20160138022 | IMMUNE REGULATORY OLIGONUCLEOTIDE (IRO) COMPOUNDS TO MODULATE TOLL-LIKE RECEPTOR BASED IMMUNE RESPONSE - The invention provides novel immune regulatory oligonucleotides (IRO) as antagonist of TLRs and methods of use thereof. These IROs have unique sequences that inhibit or suppress TLR-mediated signaling in response to a TLR ligand or TLR agonist. The methods may have use in the prevention and treatment of cancer, an autoimmune disorder, airway inflammation, inflammatory disorders, infectious disease, skin disorders, allergy, asthma or a disease caused by a pathogen. | 05-19-2016 |
20160151495 | IMMUNOGLOBULIN PREPARATION | 06-02-2016 |
20160158162 | PHARMACEUTICAL COMPOSITIONS COMPRISING MONOTERPENES - The present invention provides a process for purifying a monoterpene or sesquiterpene having a purity greater than about 98.5% (w/w). The process comprises the steps of derivatizing the monoterpene (or sesquiterpene) to produce a monoterpene (or sesquiterpene) derivative, separating the monoterpene (or sesquiterpene) derivative, and releasing the monoterpene (or sesquiterpene) from the derivative. Also encompassed by the scope of the present invention is a pharmaceutical composition comprising a monoterpene (or sesquiterpene) having a purity greater than about 98.5% (w/w). The purified monoterpene can be used to treat a disease such as cancer. The present monoterpene (or sesquiterpene) may be administered alone, or may be co-administered with radiation or other therapeutic agents, such as chemotherapeutic agents. | 06-09-2016 |
20160161498 | DIAGNOSTIC METHOD FOR PEDIATRIC ACUTE-ONSET NEUROPSYCHIATRIC SYNDROME (PANS) AND PEDIATRIC AUTOIMMUNE NEUROPSYCHIATRIC DISORDER ASSOCIATED WITH STREPTOCOCCI INFECTION (PANDAS) - The present invention provides a panel of at least five clinical analyses or tests (using serum samples) to determine the risk of pediatric acute-onset neuropsychiatric syndrome (PANS) and/or pediatric autoimmune neuropsychiatric disorder associated with streptococcal infection (PANDAS) in an individual. These include enzyme linked immunosorbent assays (ELISAs) to measure antibody titers against neuronal antigens present in the brain; the neuronal antigens include lysoganglioside, tubulin, dopamine receptor D1, dopamine receptor D2, serotonin receptor 5HT2A, and serotonin receptor 5HT2C. Antibody titers against at least four of these neuronal antigens are required in the present methods; preferably antibody tiers against all of these neuronal antigens are measured. A final assay is used to quantify calcium/calmodulin-dependent protein kinase activity using a neuronal cell line. The results of these analyses or tests are then combined using an algorithm to determine whether a PANS or PANDAS diagnosis is appropriate for the individual. Depending on the diagnosis, an appropriate treatment can be determined. | 06-09-2016 |
20160165922 | METHOD TO INCREASE MILK PRODUCTION BY MAMMALS | 06-16-2016 |
20160166641 | METHOD OF TREATING PERIPHERAL NERVE DISORDERS | 06-16-2016 |
20160168190 | C-20 STEROID COMPOUNDS, COMPOSITIONS AND USES THEREOF TO TREAT TRAUMATIC BRAIN INJURY (TBI), INCLUDING CONCUSSIONS | 06-16-2016 |
20160184274 | Methods for inhibiting mesenchymal phenotype after epithelial-to-mesenchymal transition - Methods of using inhibitors of Goodpasture Antigen Binding Protein for inhibiting mesenchymal phenotype after epithelial-to-mesenchymal transition (EMT), treating an invasive tumor, and detecting EMT in a tissue are described. | 06-30-2016 |
20160185843 | TREATING ALCOHOL-MEDIATED DISORDERS BY INHIBITION OF RGS6 - The invention provides RGS6 antagonists and methods for their use in treating the effects of alcohol consumption. | 06-30-2016 |
20160194304 | ISOINDOLINE OR ISOQUINOLINE COMPOUNDS, A PROCESS FOR THEIR PREPARATION AND PHARMACEUTICAL COMPOSITIONS CONTAINING THEM | 07-07-2016 |
20160199437 | THERAPEUTIC COMPOSITIONS INCLUDING IRON CHELATORS AND USES THEREOF | 07-14-2016 |
20160199461 | Treatment of Synucleinopathies | 07-14-2016 |
20160199498 | PEPTIDES FOR ENHANCING TRANSDERMAL DELIVERY | 07-14-2016 |
20160201060 | IMMUNE REGULATORY OLIGONUCLEOTIDE (IRO) COMPOUNDS TO MODULATE TOLL-LIKE RECEPTOR BASED IMMUNE RESPONSE | 07-14-2016 |
20160251652 | COMPOSITIONS FOR INHIBITING CHECKPOINT GENE EXPRESSION AND USES THEREOF | 09-01-2016 |
20160376333 | Polypeptides to Inhibit Epstein Barr Viral Protein BHRF1 and B Cell Lymphoma Family Proteins - The present invention provides designed polypeptides that selectively bind to and inhibit Epstein Barr protein BHFR1, and B cell lymphoma family proteins, and are thus useful for treating Epstein Barr-related diseases and cancer. | 12-29-2016 |
20170233741 | IMMUNE REGULATORY OLIGONUCLEOTIDE (IRO) COMPOUNDS TO MODULATE TOLL-LIKE RECEPTOR BASED IMMUNE RESPONSE | 08-17-2017 |
20180021376 | Naming of KH1 through KH55 good healthy cells synthesizes the KH1 through KH55 proteins | 01-25-2018 |
20180023077 | COMPOSITIONS FOR MODULATING EXPRESSION OF C9ORF72 ANTISENSE TRANSCRIPT | 01-25-2018 |
20180023085 | IMMUNE REGULATORY OLIGONUCLEOTIDE (IRO) COMPOUNDS TO MODULATE TOLL-LIKE RECEPTOR BASED IMMUNE RESPONSE | 01-25-2018 |
20190142934 | Method and System for Protecting Honey Bees, Bats and Butterflies From Neonicotinoid Pesticides | 05-16-2019 |
20190144531 | METHODS FOR PURIFICATION OF SINGLE DOMAIN ANTIGEN BINDING MOLECULES | 05-16-2019 |