LONZA AG Patent applications |
Patent application number | Title | Published |
20140322105 | Micro-Reactor System Assembly - A micro-reactor system assembly comprises a stack of at least n process modules ( | 10-30-2014 |
20130324699 | SYNTHESIS OF GLUCAGON-LIKE PEPTIDE - A new method of synthesizing GLP-1 peptide is devised. | 12-05-2013 |
20130310574 | Process for the Preparation of N-Monosubstituted beta-Amino Alcohols - A process is disclosed for the preparation of a compound of formula | 11-21-2013 |
20130259768 | Micro-Reactor System Assembly - A micro-reactor system assembly comprises a stack of at least n process modules ( | 10-03-2013 |
20130203114 | Regulation of Inducible Promoters - The present invention relates to the production of heterologous polypeptides in a recombinant bacterial host cell, wherein the bacterial host cell is rendered inable to deactivate the promoter controlling the expression of the heterologous polypeptide in the absence of an inducer. | 08-08-2013 |
20120330023 | Alkyl Pyridinium Dicyanamides and Method For The Production Thereof - Alkylpyridinium dicyanamide of the formula: | 12-27-2012 |
20120316350 | PROCESS FOR THE PREPARATION OF ENANTIOMERICALLY PURE 1-SUBSTITUTED-3-AMINOALCOHOLS - A process for the preparation of N-monosubstituted β-aminoalcohol sulfonates of formula (1a), (1b): | 12-13-2012 |
20120202246 | Vector Comprising Mannose Promoter and Mannose Promoter - The present invention relates to a vector expressible in a prokaryotic host and a nucleic acid sequence comprising a mannose-inducible promoter of the mannose operon of | 08-09-2012 |
20120196323 | Fermentation Process - The present invention relates to a fermentation process for culturing a host cell comprising a vector which comprises an inducible promoter of the mannose operon wherein the inducible promoter of the mannose operon controls expression of a nucleic acid sequence encoding for a polypeptide, in particular the present invention relates to the high cell density fermentation of a prokaryotic host cell comprising the inducible promoter of the mannose operon in the production of a polypeptide. | 08-02-2012 |
20120189511 | Micro-Reactor System Assembly - A micro-reactor system assembly comprises a stack of at least n process modules ( | 07-26-2012 |
20120156706 | PROCESS FOR THE IDENTIFICATION AND PREPARATION OF A (R)-SPECIFIC OMEGA-TRANSAMINASE - The present invention relates to processes for the screening, preparation and characterization of (R)-selective ω-transaminases, to transaminases obtained thereby and their uses in various transamination processes. | 06-21-2012 |
20120022228 | PURIFICATION OF AMPHOTERIC PRODUCTS, OR OF PRODUCTS LIABLE TO BE CONVERTED INTO AMPHOTERIC PRODUCTS - A process for purifying at least one product from a substrate containing at least one product, includes subjecting the substrate to centrifugal partition chromatography in an ion exchange displacement mode to purify the at least one product from the substrate, the at least one product being an amphoteric product. | 01-26-2012 |
20110150727 | Micro-Reactor System Assembly - A micro-reactor system assembly comprises a stack of at least n process modules ( | 06-23-2011 |
20110004007 | PROCESS FOR THE PREPARATION OF N-MONOSUBSTITUTED beta-AMINO ALCOHOLS - A process is disclosed for the preparation of a compound of formula | 01-06-2011 |
20100298567 | NITRATION OF ACTIVATED AROMATICS IN MICROREACTORS - The invention relates to the nitration of aromatic or heteroaromatic compounds, wherein an activated aromatic or heteroaromatic compound and a nitration agent, optionally in the presence of a solvent, are mixed intensely in a microreactor, and wherein the proportion of the nitration agent to the activated aromatic or heteroaromatic compound, the concentration of nitration agent in the reaction mixture, and the temperature are selected at levels such high that the nitration begins autocatalytically, and wherein the nitration product is obtained after leaving the microreactor and, optionally after an after-reaction time outside the microreactor. | 11-25-2010 |
20100249370 | PROCESS FOR THE PRODUCTION OF PRAMLINTIDE - Pramlintide, a peptide having the 37 amino acid sequence KCNTATCATQRLANFLVHSSNNFGPILPPT-NVGSNTY-NH2 is prepared via a convergent three-fragment synthesis strategy from the fragments comprising the amino acid residues 1-12, 13-24 and 25-37, respectively. | 09-30-2010 |
20090325224 | PROCESS FOR PREPARATION OF OPTICALLY ACTIVE N-PROTECTED 3-AMINOPYRROLIDINE OR OPTICALLY ACTIVE N-PROTECTED 3-AMINOPIPERIDINE AND THE CORRESPONDING KETONES BY OPTICAL RESOLUTION OF THE RACEMIC AMINE MIXTURES EMPLOYING A BACTERIAL OMEGA-TRANSAMINASE - The present invention relates to the production of optically active amines, which can be used as intermediate products in a synthesis of for instance pharmaceutical products. | 12-31-2009 |
20090270663 | METHOD FOR GRIGNARD TYPE REACTIONS IN MICROREACTORS - The present invention relates to a process for Grignard type reactions comprising mixing at least two fluids in a microreactor having at least two injection points. | 10-29-2009 |
20090105505 | PROCESS FOR THE PREPARATION OF ASYMMETRICALLY SUBSTITUTED BIARYLDIPHOSPHINES - A process for the preparation of asymmetrically substituted biaryldiphosphine ligands of the formula: | 04-23-2009 |
20080287648 | Method for Solid Phase Peptide Synthesis - A novel method for synthesizing a Hirulog peptide is devised. | 11-20-2008 |
20080200648 | Method of Peptide Synthesis - A novel for amidation of C-terminal carboxyl groups of peptides is devised, which methods avoids undesired epimerisation of the α-carbon of the C-terminal amino acid yielding diastereoisomeric variants of the amidated peptide. | 08-21-2008 |
20080200647 | On-Resin Peptide Cyclization - Method of peptide synthesis, comprising the steps of a. synthesizing a peptide linked to a solid phase which peptide comprises at least one cysteine, homo- or nor-cysteine residue, which cysteine is protected in its side chain by a S-tert.butyl-sulphenyl group b. either coupling N-terminally a further amino acid having a 3,3′-dithio-(1-carboxy-propyl)-propionyl-radical on its Nα or deprotecting the Nα of the N-terminal amino acid and reacting the free Nα with 3,3′-dithio-propionic acid imide to yield the corresponding Nα-3,3′-dithio-(1-carboxy-propyl)-propionamide or deprotecting the Nα of the N-terminal amino acid and reacting the free Nα with a compound of formula IV R7-S—S—[CH | 08-21-2008 |