AFFIRIS AG Patent applications |
Patent application number | Title | Published |
20160106822 | PCSK9 PEPTIDE COMBINATION VACCINE AND METHOD OF USE - The present invention relates to a immunogen comprising at least two fragments of Proprotein convertase subtilisin/kexin type 9 (PCSK9), wherein at least two fragments comprise at least 8 consecutive amino acid residues of amino acid residues 150 to 170 and/or 205 to 225 of PCSK9 (SEQ ID NO:9). | 04-21-2016 |
20160054333 | METHOD FOR DETECTING ASYN-SPECIFIC ANTIBODIES IN A BIOLOGICAL SAMPLE - Disclosed is a method for detecting aSyn-specific antibodies in a biological sample, comprising the following steps: contacting the sample with aSyn-comprising-aggregates and allowing the aSyn-specific antibodies to bind to the aSsyn-comprising-aggregates, and detecting the aSyn-specific antibodies bound to the aSyn-comprising-aggregates by a single particle detection technique, preferably by fluorescence activated cell sorting (FACS). | 02-25-2016 |
20150306194 | METHOD FOR TREATING A SYNUCLEIOPATHY - A method for preventing and/or treating a synucleinopathy, comprising administering a composition containing at least one mimotope of an epitope of alpha-synuclein, wherein said at least one mimotope is coupled or fused to a pharmaceutically acceptable carrier protein selected from the group consisting of a non-toxic diphtheria toxin mutant, keyhole limpet hemocyanin (KLH), diphtheria toxin (DT), tetanus toxid (TT) and | 10-29-2015 |
20150306191 | VACCINE - The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo. | 10-29-2015 |
20150093432 | COMPOSITION - The present invention relates to a composition comprising at least one mimotope of an epitope of alpha-synuclein for use in a method for preventing and/or treating β-amyloidoses including Alzheimer's disease, wherein said at least one mimotope is coupled or fused to a pharmaceutically acceptable carrier protein selected from the group consisting of a non-toxic diphtheria toxin mutant, keyhole limpet hemocyanin (KLH), diphtheria toxin (DT), tetanus toxid (TT) and | 04-02-2015 |
20150093431 | COMPOSITIONS - The present invention relates to a composition comprising at least one mimotope of an epitope of alpha-synuclein for use in a method for preventing and/or treating synucleinopathies, wherein said at least one mimotope is coupled or fused to a pharmaceutically acceptable carrier protein selected from the group consisting of a non-toxic diphtheria toxin mutant, keyhole limpet hemocyanin (KLH), diphtheria toxin (DT), tetanus toxid (TT) and | 04-02-2015 |
20150071951 | VACCINE - The present invention relates to a vaccine comprising at least two fragments of Proprotein convertase subtilisin/kexin type 9 (PCSK9), wherein said at least two fragments comprise at least 8 consecutive amino acid residues of amino acid residues 150 to 170 and/or 205 to 225 of PCSK9 (SEQ ID No. 9). | 03-12-2015 |
20140255435 | Vaccine - Vaccine comprising a peptide bound to a pharmaceutically acceptable carrier, said peptide having the amino acid sequence | 09-11-2014 |
20140242727 | METHOD FOR DIAGNOSING ALZHEIMER'S DISEASE (AD) - Disclosed is a method for diagnosing Alzheimer's disease (AD) wherein Aβ-specific antibodies in a biological sample of a person that is suspected of having AD are detected comprising the following steps: —contacting the sample with Aβ-aggregates or with particles having Aβ-aggregate like surfaces and allowing the Aβ-specific antibodies to bind to the Aβ-aggregates, and —detecting the Aβ-specific antibodies bound to the Aβ-aggregates by a single particle detection technique, preferably by fluorescence activated cell sorting (FACS); and wherein the amount of Aβ-specific antibodies detected is compared with the amount in a sample of known AD status. | 08-28-2014 |
20140234877 | METHOD FOR DETECTING A BETA-SPECIFIC ANTIBODIES IN A BIOLOGICAL SAMPLE - Disclosed is a method for detecting Aβ-specific antibodies in a biological sample comprising the following steps:—contacting the sample with Aβ-aggregates or with particles comprising Aβ-aggregate like surfaces and allowing the Aβ-specific antibodies to bind to the Aβ-aggregates, and -detecting the Aβ-specific antibodies bound to the Aβ-aggregates by a single particle detection technique, preferably by fluorescence activated cell sorting FACS. | 08-21-2014 |
20140179900 | TREATMENT OF ATHEROSCLEROSIS WITH CHOLESTEROL ESTER TRANSPORT PROTEIN MIMOTOPES - The present invention relates to the use of compounds for producing a medicament for preventing and/or treating atherosclerosis, atherosclerosis risk diseases and atherosclerosis sequelae. | 06-26-2014 |
20140147456 | CETP FRAGMENTS - The present invention relates to a peptide consisting of 6 to 20 amino acid residues and being derived from amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23), wherein said peptide comprises amino acid sequence WWLGID (SEQ ID No. 24) and antibodies binding to these peptides. | 05-29-2014 |
20130216565 | VACCINES BASED ON PEPTIDES OF THE COMPLEMENT PROTEIN C5A - The present invention relates to a vaccine comprising at least one peptide consisting of amino acid sequence LRAN-ISHKDMQLGR (SEQ ID No. 1) or a peptide fragment thereof (SEQ ID No. 2-13) coupled or fused to a carrier protein comprising at least one T cell epitope, wherein said peptide fragment comprises at least 7 amino acid residues and the amino acid sequence KDMQLGR (SEQ ID No: 7) or KDMQLG (SEQ ID No: 23) under the provision that the peptide fragment does not consist of amino acid sequences HKDMQLGR (SEQ ID No: 16) and HKDMQLG (SEQ ID No: 22). | 08-22-2013 |
20120269836 | Vaccine - Vaccine comprising a peptide bound to a pharmaceutically acceptable carrier, said peptide having the amino acid sequence | 10-25-2012 |
20120156234 | MEANS FOR TREATING SYNUCLEINOPATHIES - The present invention relates to peptides or polypeptides for producing medicaments for preventing and/or treating synucleinopathies. | 06-21-2012 |
20110275556 | TREATMENT OF ATHEROSCLEROSIS - The present invention relates to the use of compounds for producing a medicament for preventing and/or treating atherosclerosis, atherosclerosis risk diseases and atherosclerosis sequelae. | 11-10-2011 |
20110171243 | COMPOUNDS FOR TREATING AMYLOIDOSES - The present invention relates to the use of mimotopes in the treatment of β-Amyloidoses including but not limited to Alzheimer's disease, whereby said mimotopes are able to induce the in vivo formation of antibodies directed to non truncated Aβ1-40/42, and N-terminally truncated forms AβpE3-40/42, Aβ3-40/42, Aβ11-40/42, AβpE11-40/42 and Aβ14-40/42 without interfering with physiological functions of APP signalling. | 07-14-2011 |
20110097351 | COMPOUNDS FOR TREATING BETA-AMYLOIDOSES - The present invention relates to the use of mimotopes in the treatment of diseases associated with β-amyloid formation and/or aggregation (β-Amyloidoses) including Alzheimer's disease, whereby said mimotopes are able to induce the in vivo formation of antibodies directed to Aβ1-40/42, AβpE3-40/42, Aβ3-40/42 and Aβ11-40/42. | 04-28-2011 |
20110092436 | COMPOUNDS FOR TREATING SYMPTOMS ASSOCIATED WITH PARKINSON'S DISEASE - The present invention relates to a compound comprising a peptide for treating, preventing and/or ameliorating motor symptoms of Parkinson's disease, said peptide having a binding capacity to an antibody which is specific for an epitope of the amyloid-beta-peptide (Aβ). | 04-21-2011 |
20110092434 | MIMOTOPES OF ALPHA-SYNUCLEIN AND VACCINES THEREOF FOR THE TREATMENT OF NEURODEGENERATIVE DISORDERS - The present invention relates to the use of at least one compound comprising the amino acid sequence: (X | 04-21-2011 |