Patent application title: BINDING MOLECULE SPECIFIC FOR CD73 AND USE OF BINDING MOLECULE
Inventors:
IPC8 Class: AC07K1628FI
USPC Class:
Class name:
Publication date: 2022-03-03
Patent application number: 20220064322
Abstract:
A binding molecule specific for CD73 and a use of the binding molecule.
Specifically, provided are a separate antibody binding CD73 and
inhibiting the activity of CD73 or an antigen binding part of the
separate antibody, and a use of the separate antibody or the antigen
binding part thereof in treatment of diseases; also provided are a
nucleic acid molecule encoding the separate antibody or the antigen
binding part thereof, an expression vector for expressing the separate
antibody or the antigen binding part thereof, a host cell, and a
preparation method.Claims:
1-71. (canceled)
72. An isolated antibody or antigen-binding fragment thereof comprising a heavy chain variable region that comprises HCDR1, HCDR2, HCDR3; and a light chain variable region that comprises LCDR1, LCDR2, LCDR3, wherein: (a) HCDR1 comprises the amino acid sequence of SEQ ID NO: 18; (b) HCDR2 comprises the amino acid sequence of SEQ ID NO:19; (c) HCDR3 comprises the amino acid sequence of SEQ ID NO:20; (d) LCDR1 comprises the amino acid sequence of SEQ ID NO:23; (e) LCDR2 comprises the amino acid sequence of SEQ ID NO:24; and (f) LCDR3 comprises the amino acid sequence of SEQ ID NO: 25.
73. The isolated antibody or antigen-binding fragment thereof of claim 72, which comprises: (i) a heavy chain variable region (VH) comprising an amino acid sequence which has at least 85% identity to the amino acid sequence of any one of SEQ ID NOs: 16, and 66-67, and comprises HCDR1 comprising SEQ ID NO: 18, HCDR2 comprising SEQ ID NO: 19, and HCDR3 comprising SEQ ID NO: 20; and (ii) a light chain variable region (VL) comprising an amino acid sequence which has at least 85% identity to the amino acid sequence of any one of SEQ ID NO: 21, and 68-70, and comprises LCDR1 comprising SEQ ID NO: 23, LCDR2 comprising SEQ ID NO: 24, and LCDR3 comprising SEQ ID NO: 25.
74. The isolated antibody or antigen-binding fragment thereof of claim 72, which comprises: 1) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 16 and comprises HCDR1 comprising SEQ ID NO: 18, HCDR2 comprising SEQ ID NO: 19, and HCDR3 comprising SEQ ID NO: 20, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO:21 and comprises LCDR1 comprising SEQ ID NO: 23, LCDR2 comprising SEQ ID NO: 24, and LCDR3 comprising SEQ ID NO: 25; 2) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 66 and comprises HCDR1 comprising SEQ ID NO: 18, HCDR2 comprising SEQ ID NO: 19, and HCDR3 comprising SEQ ID NO: 20, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 68 and comprises LCDR1 comprising SEQ ID NO: 23, LCDR2 comprising SEQ ID NO: 24, and LCDR3 comprising SEQ ID NO: 25; 3) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 66 and comprises HCDR1 comprising SEQ ID NO: 18, HCDR2 comprising SEQ ID NO: 19, and HCDR3 comprising SEQ ID NO: 20, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 69 and comprises LCDR1 comprising SEQ ID NO: 23, LCDR2 comprising SEQ ID NO: 24, and LCDR3 comprising SEQ ID NO: 25; 4) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 66 and comprises HCDR1 comprising SEQ ID NO: 18, HCDR2 comprising SEQ ID NO: 19, and HCDR3 comprising SEQ ID NO: 20, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 70 and comprises LCDR1 comprising SEQ ID NO: 23, LCDR2 comprising SEQ ID NO: 24, and LCDR3 comprising SEQ ID NO: 25; 5) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 67 and comprises HCDR1 comprising SEQ ID NO: 18, HCDR2 comprising SEQ ID NO: 19, and HCDR3 comprising SEQ ID NO: 20, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 68 and comprises LCDR1 comprising SEQ ID NO: 23, LCDR2 comprising SEQ ID NO: 24, and LCDR3 comprising SEQ ID NO: 25; 6) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 67 and comprises HCDR1 comprising SEQ ID NO: 18, HCDR2 comprising SEQ ID NO: 19, and HCDR3 comprising SEQ ID NO: 20, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 69 and comprises LCDR1 comprising SEQ ID NO: 23, LCDR2 comprising SEQ ID NO: 24, and LCDR3 comprising SEQ ID NO: 25; or 7) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 67 and comprises HCDR1 comprising SEQ ID NO: 18, HCDR2 comprising SEQ ID NO: 19, and HCDR3 comprising SEQ ID NO: 20, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 70 and comprises LCDR1 comprising SEQ ID NO: 23, LCDR2 comprising SEQ ID NO: 24, and LCDR3 comprising SEQ ID NO: 25.
75. The isolated antibody or antigen-binding fragment thereof of claim 72, wherein the isolated antibody is an IgG.
76. The isolated antibody or antigen-binding fragment thereof of claim 72, wherein the isolated antibody is an IgG1, IgG2 or IgG4.
77. The isolated antibody or antigen-binding fragment thereof of claim 72, wherein the isolated antibody is a monoclonal antibody, a chimeric antibody, a humanized antibody, a human engineered antibody, a human antibody, Fv, a single chain antibody (scFv), Fab, Fab', Fab'-SH or F(ab').sub.2.
78. The isolated antibody or antigen-binding fragment thereof of claim 72, comprising a heavy chain and a light chain, wherein: (I) the heavy chain comprising an amino acid sequence which has at least 85% identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 26, 27, 71 and 72, and comprises HCDR1 comprising SEQ ID NO: 18, HCDR2 comprising SEQ ID NO: 19, and HCDR3 comprising SEQ ID NO: 20; and (II) the light chain comprising an amino acid sequence which has at least 85% identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 28, 73, 74 and 75, and comprises LCDR1 comprising SEQ ID NO: 23, LCDR2 comprising SEQ ID NO: 24, and LCDR3 comprising SEQ ID NO: 25.
79. The isolated antibody or antigen-binding fragment thereof of claim 72, which comprises: 1) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 26 and comprises HCDR1 comprising SEQ ID NO: 18, HCDR2 comprising SEQ ID NO: 19, and HCDR3 comprising SEQ ID NO: 20, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 28 and comprises LCDR1 comprising SEQ ID NO: 23, LCDR2 comprising SEQ ID NO: 24, and LCDR3 comprising SEQ ID NO: 25; 2) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 27 and comprises HCDR1 comprising SEQ ID NO: 18, HCDR2 comprising SEQ ID NO: 19, and HCDR3 comprising SEQ ID NO: 20, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 28 and comprises LCDR1 comprising SEQ ID NO: 23, LCDR2 comprising SEQ ID NO: 24, and LCDR3 comprising SEQ ID NO: 25; 3) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 71 and comprises HCDR1 comprising SEQ ID NO: 18, HCDR2 comprising SEQ ID NO: 19, and HCDR3 comprising SEQ ID NO: 20, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 73 and comprises LCDR1 comprising SEQ ID NO: 23, LCDR2 comprising SEQ ID NO: 24, and LCDR3 comprising SEQ ID NO: 25; 4) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 71 and comprises HCDR1 comprising SEQ ID NO: 18, HCDR2 comprising SEQ ID NO: 19, and HCDR3 comprising SEQ ID NO: 20, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 74 and comprises LCDR1 comprising SEQ ID NO: 23, LCDR2 comprising SEQ ID NO: 24, and LCDR3 comprising SEQ ID NO: 25; 5) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 71 and comprises HCDR1 comprising SEQ ID NO: 18, HCDR2 comprising SEQ ID NO: 19, and HCDR3 comprising SEQ ID NO: 20, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 75 and comprises LCDR1 comprising SEQ ID NO: 23, LCDR2 comprising SEQ ID NO: 24, and LCDR3 comprising SEQ ID NO: 25; 6) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 72 and comprises HCDR1 comprising SEQ ID NO: 18, HCDR2 comprising SEQ ID NO: 19, and HCDR3 comprising SEQ ID NO: 20, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 73 and comprises LCDR1 comprising SEQ ID NO: 23, LCDR2 comprising SEQ ID NO: 24, and LCDR3 comprising SEQ ID NO: 25; 7) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 72 and comprises HCDR1 comprising SEQ ID NO: 18, HCDR2 comprising SEQ ID NO: 19, and HCDR3 comprising SEQ ID NO: 20, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 74 and comprises LCDR1 comprising SEQ ID NO: 23, LCDR2 comprising SEQ ID NO: 24, and LCDR3 comprising SEQ ID NO: 25; or 8) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 72 and comprises HCDR1 comprising SEQ ID NO: 18, HCDR2 comprising SEQ ID NO: 19, and HCDR3 comprising SEQ ID NO: 20, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 75 and comprises LCDR1 comprising SEQ ID NO: 23, LCDR2 comprising SEQ ID NO: 24, and LCDR3 comprising SEQ ID NO: 25.
80. The isolated antibody or antigen-binding fragment thereof of claim 79, wherein the antibody comprises: 1) a heavy chain consisting of SEQ ID NO: 26 and a light chain consisting of SEQ ID NO: 28; 2) a heavy chain consisting of SEQ ID NO: 27 and a light chain consisting of SEQ ID NO: 28; 3) a heavy chain consisting of SEQ ID NO: 71 and a light chain consisting of SEQ ID NO: 73; 4) a heavy chain consisting of SEQ ID NO: 71 and a light chain consisting of SEQ ID NO: 74; 5) a heavy chain consisting of SEQ ID NO: 71 and a light chain consisting of SEQ ID NO: 75; 6) a heavy chain consisting of SEQ ID NO: 72 and a light chain consisting of SEQ ID NO: 73; 7) a heavy chain consisting of SEQ ID NO: 72 and a light chain consisting of SEQ ID NO: 74; or 8) a heavy chain consisting of SEQ ID NO: 72 and a light chain consisting of SEQ ID NO: 75.
81. The isolated antibody or antigen-binding fragment thereof of claim 72, which is an antagonist of CD73 or an antagonist of 5'-nucleotidase of CD73.
82. The isolated antibody or antigen-binding fragment thereof of claim 81, wherein the CD73 is human CD73.
83. A method of decreasing adenosine levels in a subject with tumor, improving a T cell response in a subject with tumor, stimulating an immune response in a subject, or inhibiting the growth of tumor cells in a subject, said method comprises administering a therapeutically effective amount of the isolated antibody or antigen-binding fragment thereof of claim 72 to the subject.
84. The method of claim 83, wherein the subject is a subject with tumor.
85. The method of claim 83, wherein the subject has a tumor cell expressing CD73 and/or a tumor microenvironment containing CD73.
86. A pharmaceutical composition comprising the isolated antibody or antigen-binding fragment thereof of claim 72, and a pharmaceutically acceptable excipient.
87. A method of treating tumor comprising administering a therapeutically effective amount of the isolated antibody or antigen-binding fragment thereof of claim 72 to a subject in need thereof.
88. The method of claim 87, wherein the tumor is a solid tumor or hematological tumor.
89. The method of claim 87, wherein the tumor is selected from bladder cancer, breast cancer, cervical cancer, ovarian cancer, prostate cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, pancreatic cancer, colorectal cancer, colon cancer, renal cancer, head and neck cancer, lung cancer (small cell lung cancer or non-small cell lung cancer), stomach cancer, bone cancer, liver cancer, thyroid cancer, skin cancer, central nervous system tumor, lymphoma, leukemia, myeloma, sarcoma, and virus-associated cancer.
Description:
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a divisional of U.S. application Ser. No. 17/240,141, filed Apr. 26, 2021, now U.S. Pat. No. 11,174,319, which is a continuation application of Int'l Appl. No. PCT/CN2020/094489, filed Jun. 5, 2020, which claims priority to PCT/CN2019/090366, filed Jun. 6, 2019, each and all of which are incorporated herein by reference in their entirety.
SEQUENCE DISCLOSURE
[0002] This application includes as part of its disclosure an electronic sequence listing text file named "1158498o003602.txt", having a size of 196,332 and created Sep. 15, 2021, which is hereby incorporated by reference in its entirety.
TECHNICAL FIELD
[0003] This invention relates to the isolated antibody or antigen-binding fragment thereof specifically binding to CD73, this invention also relates to the use of the isolated antibody or antigen-binding fragment thereof in treatment of diseases, and this invention relates to the therapeutic method of the isolated antibody or antigen-binding fragment thereof.
BACKGROUND ART
[0004] CD73 (ecto-5'-nucleotidase) is membrane-bound/free protein with a size of about 70 kDa and consists of N-terminal and C-terminal subunits and a flexible link. The C-terminus is anchored to the cell membrane through glycosyl-phosphatidylinositol (GPI). CD73 exerts an enzymatic activity through switching between open and closed conformational states (Knapp, K. et al. (2012), Structure, 20(12), 2161-2173). In the adenosine pathway, CD73 can continue to hydrolyze AMP produced by CD39 to adenosine. Adenosine exerts various immunosuppressive effects, such as inhibiting the proliferation of CD4+ T and CD8+ T, inhibiting NK cell activity, promoting Treg proliferation, and the like.
[0005] It has been widely reported that CD73 was highly expressed in various tumor such as gastric cancer, triple negative breast cancer, non-small-cell adenocarcinoma, rectal adenocarcinoma, colorectal cancer, renal cell carcinoma, ovarian cancer, prostate cancer, oral squamous cell carcinoma, head and neck squamous cell carcinoma and so on, and high CD73 expression was associated with poor prognosis (Vijayan, D. et al., (2017), Nature reviews Cancer, 17, 709). Increased expression of CD73 in tumor microenvironment was associated with tumor proliferation, metastasis, neovascularization, and poor survival of the patients (Allard, B. et al., (2017), Immunological reviews, 276 (1), 121-144). With the high expression of CD73, the increased adenosine inhibits tumor immunity by activating tumor intrinsic and host-mediated tumor-promoting mechanisms, restricting immune cell infiltration and production of cytotoxicity and cytokines (such as interferon), and causes strong immunosuppression (Ohta, A. et al., (2016), Front Immunol, 7, 109). Immunosuppression is a typical characteristic of cancer, and it is important to overcome the inhibitory barrier. Therefore, it is a highly potential therapeutic direction of inhibiting the production of adenosine in the tumor microenvironment by inhibiting CD73, thereby activating immunity and inhibiting tumor growth.
[0006] Antibodies can inhibit the enzymatic activity of CD73 by antagonizing CD73 allosteric to the active form, but there is no report of any antibody that can directly bind to the CD73 active site to inhibit its enzyme activity. Meanwhile, although CD73 is a very potential therapeutic target, more research is needed to verify the prognosis of CD73 targets and to develop related drugs and combination therapies.
SUMMARY OF INVENTION
[0007] The invention provide an isolated antibody or antigen-binding fragment specifically binding for CD73 and uses thereof in the treatment diseases.
[0008] In one respect, the invention provide an isolated antibody or antigen-binding fragment thereof comprising a heavy chain variable region that comprises HCDR1, HCDR2, HCDR3; and a light chain variable region that comprises LCDR1, LCDR2, LCDR3, wherein:
[0009] (a) HCDR1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 5, 18, 31, 43 and 56, and conservative modifications thereof;
[0010] (b) HCDR2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 6, 19, 32, 44 and 57, and conservative modifications thereof;
[0011] (c) HCDR3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 7, 20, 33, 45 and 58, and conservative modifications thereof;
[0012] (d) LCDR1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 10, 23, 36, 48 and 61, and conservative modifications thereof;
[0013] (e) LCDR2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 11, 24, 37, 49 and 62, and conservative modifications thereof; and
[0014] (f) LCDR3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 25, 38, 50 and 63, and conservative modifications thereof.
[0015] In some embodiments, the isolated antibody or antigen-binding fragment thereof comprises:
[0016] 1) (a) HCDR1 comprising SEQ ID NO: 5, (b) HCDR2 comprising SEQ ID NO: 6, (c) HCDR3 comprising SEQ ID NO: 7, (d) LCDR1 comprising SEQ ID NO: 10, (e) LCDR2 comprising SEQ ID NO: 11, and (f) LCDR3 comprising SEQ ID NO: 12;
[0017] 2) (a) HCDR1 comprising SEQ ID NO: 18, (b) HCDR2 comprising SEQ ID NO: 19, (c) HCDR3 comprising SEQ ID NO: 20, (d) LCDR1 comprising SEQ ID NO: 23, (e) LCDR2 comprising SEQ ID NO: 24, and (f) LCDR3 comprising SEQ ID NO: 25;
[0018] 3) (a) HCDR1 comprising SEQ ID NO: 31, (b) HCDR2 comprising SEQ ID NO: 32, (c) HCDR3 comprising SEQ ID NO: 33, (d) LCDR1 comprising SEQ ID NO: 36, (e) LCDR2 comprising SEQ ID NO: 37, and (f) LCDR3 comprising SEQ ID NO: 38;
[0019] 4) (a) HCDR1 comprising SEQ ID NO: 43, (b) HCDR2 comprising SEQ ID NO: 44, (c) HCDR3 comprising SEQ ID NO: 45, (d) LCDR1 comprising SEQ ID NO: 48, (e) LCDR2 comprising SEQ ID NO: 49, and (f) LCDR3 comprising SEQ ID NO: 50; or
[0020] 5) (a) HCDR1 comprising SEQ ID NO: 56, (b) HCDR2 comprising SEQ ID NO: 57, (c) HCDR3 comprising SEQ ID NO: 58, (d) LCDR1 comprising SEQ ID NO: 61, (e) LCDR2 comprising SEQ ID NO: 62, and (f) LCDR3 comprising SEQ ID NO: 63.
[0021] In some embodiments, the isolated antibody or antigen-binding fragment thereof comprises: (a) HCDR1 comprising SEQ ID NO: 5, (b) HCDR2 comprising SEQ ID NO: 6, (c) HCDR3 comprising SEQ ID NO: 7, (d) LCDR1 comprising SEQ ID NO: 10, (e) LCDR2 comprising SEQ ID NO: 11, and (f) LCDR3 comprising SEQ ID NO: 12.
[0022] In some embodiments, the isolated antibody or antigen-binding fragment thereof comprises: (a) HCDR1 comprising SEQ ID NO: 18, (b) HCDR2 comprising SEQ ID NO: 19, (c) HCDR3 comprising SEQ ID NO: 20, (d) LCDR1 comprising SEQ ID NO: 23, (e) LCDR2 comprising SEQ ID NO: 24, and (f) LCDR3 comprising SEQ ID NO: 25.
[0023] In some embodiments, the isolated antibody or antigen-binding fragment thereof comprises: (a) HCDR1 comprising SEQ ID NO: 31, (b) HCDR2 comprising SEQ ID NO: 32, (c) HCDR3 comprising SEQ ID NO: 33, (d) LCDR1 comprising SEQ ID NO: 36, (e) LCDR2 comprising SEQ ID NO: 37, and (f) LCDR3 comprising SEQ ID NO: 38.
[0024] In some embodiments, the isolated antibody or antigen-binding fragment thereof comprises: (a) HCDR1 comprising SEQ ID NO: 43, (b) HCDR2 comprising SEQ ID NO: 44, (c) HCDR3 comprising SEQ ID NO: 45, (d) LCDR1 comprising SEQ ID NO: 48, (e) LCDR2 comprising SEQ ID NO: 49, and (f) LCDR3 comprising SEQ ID NO: 50.
[0025] In some embodiments, the isolated antibody or antigen-binding fragment thereof comprises: (a) HCDR1 comprising SEQ ID NO: 56, (b) HCDR2 comprising SEQ ID NO: 57, (c) HCDR3 comprising SEQ ID NO: 58, (d) LCDR1 comprising SEQ ID NO: 61, (e) LCDR2 comprising SEQ ID NO: 62, and (f) LCDR3 comprising SEQ ID NO: 63.
[0026] In some embodiments, the isolated antibody or antigen-binding fragment thereof comprises:
[0027] (i) the heavy chain variable region (VH) comprising an amino acid sequence which has at least 85% identity to the amino acid sequences selected from the group consisting of SEQ ID NOs: 3, 16, 29, 41, 54, 66, 67, 76, 77 and 78, and conservative modifications thereof; and
[0028] (ii) the light chain variable region (VL) comprising an amino acid sequence which has at least 85% identity to the amino acid sequence selected from the group consisting of SEQ ID NOs: 8, 21, 34, 46, 59, 68, 69, 70, 79 and 80, and conservative modifications thereof.
[0029] In some embodiments, the heavy chain variable regions comprise an amino acid sequence which has at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the heavy variable regions selected from the group of (i), and the light chain variable regions comprise an amino acid sequence which has at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the light variable regions selected from the group of (ii).
[0030] In some embodiments, the isolated antibody or antigen-binding fragment thereof comprises:
[0031] 1) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 3, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 8;
[0032] 2) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 16, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identical to the amino acid sequences of SEQ ID NO:21;
[0033] 3) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 29, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 34;
[0034] 4) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 41, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 46;
[0035] 5) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 54, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 59;
[0036] 6) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 66, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 68;
[0037] 7) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 66, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 69;
[0038] 8) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 66, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 70;
[0039] 9) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 67, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 68;
[0040] 10) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 67, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 69;
[0041] 11) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 67, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 70;
[0042] 12) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 76, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 79;
[0043] 13) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 76, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 80;
[0044] 14) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 77, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 79;
[0045] 15) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 77, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 80;
[0046] 16) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 78, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 79;
[0047] 17) a heavy chain variable region (VH) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 78, and a light chain variable region (VL) that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 80.
[0048] In some embodiments, the isolated antibody or antigen-binding fragment thereof, wherein the heavy and light chain variable regions comprise an amino acid sequence at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the heavy and light chain variable regions, respectively, selected from the group consisting of 1)-17).
[0049] In some embodiments, the isolated antibody is an IgG.
[0050] In some embodiments, the isolated antibody is an IgG1, IgG2 or IgG4.
[0051] In some embodiments, the isolated antibody is a monoclonal antibody, a chimeric antibody, a humanized antibody, a human engineered antibody, a human antibody, Fv, a single chain antibody (scFv), Fab, Fab', Fab'-SH or F(ab').sub.2.
[0052] In some embodiments, the isolated antibody or antigen-binding fragment thereof comprising a heavy chain and a light chain, wherein:
[0053] (I) the heavy chain comprising an amino acid sequence which is at least 85% identity to the amino acid sequences selected from the group consisting of SEQ ID NOs: 13, 15, 26, 27, 39, 51, 52, 64, 71, 72, 81, 82, 83, 86, 87, 90, 91, 124, 125, 126 and 127, and conservative modifications thereof; and
[0054] (II) the light chain comprising an amino acid sequence which is at least 85% identity to the amino acid sequences selected from the group consisting of SEQ ID NOs: 14, 28, 40, 53, 65, 73, 74, 75, 84, 85, 88 and 89, and conservative modifications thereof.
[0055] In some embodiments, the heavy chain comprises an amino acid sequence which has at least 90%, at least 95%, at least 96%, at least 97%,at least 98%, or 100% identity to the heavy chains selected from the group of (I), and the light chain comprises an amino acid sequence which has at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or 100% identity to the light chain selected from the group of (II).
[0056] In some embodiments, the isolated antibody or antigen-binding fragment thereof comprises:
[0057] 1) a heavy chain that comprises an amino acid sequence which is at least 85% identity to the amino acid sequences of SEQ ID NO: 13, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 14;
[0058] 2) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 15, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 14;
[0059] 3) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 26, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 28;
[0060] 4) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 27, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 28;
[0061] 5) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 39, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 40;
[0062] 6) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 51, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 53;
[0063] 7) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 52, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 53;
[0064] 8) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 64, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 65;
[0065] 9) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 71, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 73;
[0066] 10) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 71, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 74;
[0067] 11) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 71, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 75;
[0068] 12) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 72, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 73;
[0069] 13) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 72, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 74;
[0070] 14) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 72, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 75;
[0071] 15) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 81, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 84;
[0072] 16) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 81, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 85;
[0073] 17) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 82, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 84;
[0074] 18) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 82, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 85;
[0075] 19) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 83, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 84;
[0076] 20) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 83, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 85;
[0077] 21) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 90, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 84;
[0078] 22) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 90, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 85;
[0079] 23) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 91, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 84;
[0080] 24) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 91, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 85;
[0081] 25) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 86, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 88;
[0082] 26) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 86, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 89;
[0083] 27) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 87, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 88;
[0084] 28) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 87, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 89;
[0085] 29) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 124, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 84;
[0086] 30) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 124, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 85;
[0087] 31) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 125, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 84; or
[0088] 32) a heavy chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequences of SEQ ID NO: 125, and a light chain that comprises an amino acid sequence which has at least 85% identity to the amino acid sequence of SEQ ID NO: 85.
[0089] In some embodiments, the heavy and light chain comprise an amino acid sequence at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the heavy and light chain variable regions, respectively, selected from the group consisting of 1)-32).
[0090] In another respect, the invention provides an isolated antibody or antigen-binding fragment thereof, which comprises a heavy chain of SEQ ID NO: 71 and a light chain of SEQ ID NO: 73.
[0091] In yet another respect, the invention provides an isolated antibody or antigen-binding fragment thereof, which comprises a heavy chain consisting essentially of SEQ ID NO: 72 and a light chain consisting essentially of SEQ ID NO: 74.
[0092] In one respect, the invention provides an isolated antibody or antigen-binding fragment thereof, which comprises a heavy chain of SEQ ID NO: 72 and a light chain of SEQ ID NO: 75.
[0093] In another respect, the invention provides an isolated antibody or antigen-binding fragment thereof, which comprises a heavy chain consisting essentially of SEQ ID NO: 81 and a light chain consisting essentially of SEQ ID NO: 85.
[0094] In yet another respect, the invention provides an isolated antibody or antigen-binding fragment thereof, which comprises a heavy chain consisting essentially of SEQ ID NO: 82 and a light chain consisting essentially of SEQ ID NO: 84.
[0095] In one respect, the invention provides an isolated antibody or antigen-binding fragment thereof, which comprises a heavy chain consisting essentially of SEQ ID NO: 83 and a light chain consisting essentially of SEQ ID NO: 85.
[0096] In another respect, the invention provides an isolated antibody or antigen-binding fragment thereof, which comprises a heavy chain consisting essentially of SEQ ID NO: 124 and a light chain consisting essentially of SEQ ID NO: 85.
[0097] In yet another respect, the invention provides an isolated antibody or antigen-binding fragment thereof, which comprises a heavy chain consisting essentially of SEQ ID NO: 125 and a light chain consisting essentially of SEQ ID NO: 85.
[0098] In some embodiments, the isolated antibody or antigen-binding fragment thereof is an antagonist of CD73 or 5'-nucleotidase of CD73.
[0099] In some embodiments, the CD73 is human CD73.
[0100] In one respect, the invention provides a method of decreasing adenosine levels in a subject with tumor, comprising administering a therapeutically effective amount of the isolated antibody or antigen-binding fragment thereof.
[0101] In another respect, the invention provides a method of improving a T cell response in a subject with tumor, comprising administering a therapeutically effective amount of the isolated antibody or antigen-binding fragment thereof.
[0102] In yet another respect, the invention provides a method of stimulating an immune response in a subject comprising administering a therapeutically effective amount of the isolated antibody or antigen-binding fragment thereof.
[0103] In some embodiments, the subject is the subject with tumor.
[0104] In some embodiments, the subject has a tumor cell expressing CD73 and/or a tumor microenvironment containing CD73.
[0105] In one respect, the invention provides a method for inhibiting the growth of tumor cells in a subject comprising administering to the subject a therapeutically effective amount of the isolated antibody or antigen-binding fragment thereof.
[0106] In another respect, the invention provides use of the isolated antibody or antigen-binding fragment thereof in the manufacture of a medicament for decreasing adenosine levels in a tumor cell and/or a tumor microenvironment.
[0107] In yet another respect, the invention provides use of the isolated antibody or antigen-binding fragment thereof in the manufacture of a medicament for stimulating a T cell response in a subject with tumor.
[0108] In one respect, the invention provides use of the isolated antibody or antigen-binding fragment thereof in the manufacture of a medicament for stimulating an immune response in a subject.
[0109] In some embodiments, the subject is a subject with tumor.
[0110] In some embodiments, the subject has a tumor cell expressing CD73 and/or a tumor microenvironment containing CD73.
[0111] In another respect, the invention provides use of the isolated antibody or antigen-binding fragment thereof in the manufacture of a medicament for inhibiting the growth of tumor cells in a subject.
[0112] In yet another respect, the invention provides the isolated antibody or antigen-binding fragment thereof for use in decreasing adenosine levels in a tumor cell and/or a tumor microenvironment.
[0113] In one respect, the invention provides the isolated antibody or antigen-binding fragment thereof for use in stimulating a T cell response in a subject with tumor.
[0114] In another respect, the invention provides the isolated antibody or antigen-binding fragment thereof for use in stimulating an immune response in a subject.
[0115] In some embodiments, the subject is a subject with tumor.
[0116] In some embodiments, the subject has a tumor cell expressing CD73 and/or a tumor microenvironment containing CD73.
[0117] In another respect, the invention provides the isolated antibody or antigen-binding fragment thereof for use in inhibiting the growth of tumor cells in a subject.
[0118] In yet another respect, the invention provides an isolated nucleic acid composition, which comprises:
[0119] (I) a first nucleic acid comprising a nucleotide sequence selected from the group consisting of SEQ ID NOs: 4, 17, 30, 42, 55, 92, 93, 102, 103 and 104; and
[0120] (II) a second nucleic acid comprising a nucleotide sequence selected from the group consisting of SEQ ID NOs: 9, 22, 35, 47, 60, 94, 95, 96, 105 and 106.
[0121] In some embodiments, the isolated nucleic acid composition comprises:
[0122] 1) the first nucleic acid comprising SEQ ID NO: 4 and the second nucleic acid comprising SEQ ID NO: 9;
[0123] 2) the first nucleic acid comprising SEQ ID NO: 17 and the second nucleic acid comprising SEQ ID NO: 22;
[0124] 3) the first nucleic acid comprising SEQ ID NO: 30 and the second nucleic acid comprising SEQ ID NO: 35;
[0125] 4) the first nucleic acid comprising SEQ ID NO: 42 and the second nucleic acid comprising SEQ ID NO: 47;
[0126] 5) the first nucleic acid comprising SEQ ID NO: 55 and the second nucleic acid comprising SEQ ID NO: 60;
[0127] 6) the first nucleic acid comprising SEQ ID NO: 92 and the second nucleic acid comprising SEQ ID NO: 94;
[0128] 7) the first nucleic acid comprising SEQ ID NO: 92 and the second nucleic acid comprising SEQ ID NO: 95;
[0129] 8) the first nucleic acid comprising SEQ ID NO: 92 and the second nucleic acid comprising SEQ ID NO: 96;
[0130] 9) the first nucleic acid comprising SEQ ID NO: 93 and the second nucleic acid comprising SEQ ID NO: 94;
[0131] 10) the first nucleic acid comprising SEQ ID NO: 93 and the second nucleic acid comprising SEQ ID NO: 95;
[0132] 11) the first nucleic acid comprising SEQ ID NO: 93 and the second nucleic acid comprising SEQ ID NO: 96;
[0133] 12) the first nucleic acid comprising SEQ ID NO: 102 and the second nucleic acid comprising SEQ ID NO: 105;
[0134] 13) the first nucleic acid comprising SEQ ID NO: 102 and the second nucleic acid comprising SEQ ID NO: 106;
[0135] 14) the first nucleic acid comprising SEQ ID NO: 103 and the second nucleic acid comprising SEQ ID NO: 105;
[0136] 15) the first nucleic acid comprising SEQ ID NO: 103 and the second nucleic acid comprising SEQ ID NO: 106;
[0137] 16) the first nucleic acid comprising SEQ ID NO: 104 and the second nucleic acid comprising SEQ ID NO: 105; or
[0138] 17) the first nucleic acid comprising SEQ ID NO: 104 and the second nucleic acid comprising SEQ ID NO: 106.
[0139] In one respect, the invention provides an expression vector composition, which comprises:
[0140] (I) a first expression vector comprising a nucleotide sequence selected from the group consisting of SEQ ID NOs: 4, 17, 30, 42, 55, 92, 93, 102, 103 and 104; and
[0141] (II) a second expression vector comprising a nucleotide sequences selected from the group consisting of SEQ ID NOs: 9, 22, 35, 47, 60, 94, 95, 96, 105 and 106.
[0142] In some embodiments, the expression vector composition comprises:
[0143] 1) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 4 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 9;
[0144] 2) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 17 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 22;
[0145] 3) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 30 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 35;
[0146] 4) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 42 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 47;
[0147] 5) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 55 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 60;
[0148] 6) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 92 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 94;
[0149] 7) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 92 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 95;
[0150] 8) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 92 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 96;
[0151] 9) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 93 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 94;
[0152] 10) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 93 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 95;
[0153] 11) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 93 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 96;
[0154] 12) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 102 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 105;
[0155] 13) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 102 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 106;
[0156] 14) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 103 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 105;
[0157] 15) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 103 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 106;
[0158] 16) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 104 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 105; or
[0159] 17) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 104 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 106.
[0160] In another respect, the invention provides an expression vector, which comprises:
[0161] (I) a first nucleic acid sequence comprising a nucleotide sequence selected from the group consisting of SEQ ID NOs: 4, 17, 30, 42, 55, 92, 93, 102, 103 and 104; and
[0162] (II) a second nucleic acid sequence comprising a nucleotide sequence selected from the group consisting of SEQ ID NOs: 9, 22, 35, 47, 60, 94, 95, 96, 105 and 106.
[0163] In some embodiments, the expression vector, comprises:
[0164] 1) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 4 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 9;
[0165] 2) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 17 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 22;
[0166] 3) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 30 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 35;
[0167] 4) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 42 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 47;
[0168] 5) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 55 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 60;
[0169] 6) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 92 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 94;
[0170] 7) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 92 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 95;
[0171] 8) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 92 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 96;
[0172] 9) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 93 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 94;
[0173] 10) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 93 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 95;
[0174] 11) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 93 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 96;
[0175] 12) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 102 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 105;
[0176] 13) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 102 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 106;
[0177] 14) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 103 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 105;
[0178] 15) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 103 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 106;
[0179] 16) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 104 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 105;
[0180] 17) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 104 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 106.
[0181] In yet another respect, the invention provides an isolated nucleic acid composition, which comprises:
[0182] (I) a first nucleic acid comprising a nucleotide sequence selected from the group consisting of SEQ ID NOs: 97, 98, 107, 108, 109, 112, 113, 116 and 117; and
[0183] (II) a second nucleic acid comprising a nucleotide sequence selected from the group consisting of SEQ ID NOs: 99, 100, 101, 110, 111, 114 and 115.
[0184] In some embodiments, the isolated nucleic acid composition, comprises:
[0185] 1) the first nucleic acid comprising SEQ ID NO: 97 and the second nucleic acid comprising SEQ ID NO: 99;
[0186] 2) the first nucleic acid comprising SEQ ID NO: 97 and the second nucleic acid comprising SEQ ID NO: 100;
[0187] 3) the first nucleic acid comprising SEQ ID NO: 97 and the second nucleic acid comprising SEQ ID NO: 101;
[0188] 4) the first nucleic acid comprising SEQ ID NO: 98 and the second nucleic acid comprising SEQ ID NO: 99;
[0189] 5) the first nucleic acid comprising SEQ ID NO: 98 and the second nucleic acid comprising SEQ ID NO: 100;
[0190] 6) the first nucleic acid comprising SEQ ID NO: 98 and the second nucleic acid comprising SEQ ID NO: 101;
[0191] 7) the first nucleic acid comprising SEQ ID NO: 107 and the second nucleic acid comprising SEQ ID NO: 110;
[0192] 8) the first nucleic acid comprising SEQ ID NO: 107 and the second nucleic acid comprising SEQ ID NO: 111;
[0193] 9) the first nucleic acid comprising SEQ ID NO: 108 and the second nucleic acid comprising SEQ ID NO: 110;
[0194] 10) the first nucleic acid comprising SEQ ID NO: 108 and the second nucleic acid comprising SEQ ID NO: 111;
[0195] 11)the first nucleic acid comprising SEQ ID NO: 109 and the second nucleic acid comprising SEQ ID NO: 110;
[0196] 12) the first nucleic acid comprising SEQ ID NO: 109 and the second nucleic acid comprising SEQ ID NO: 111;
[0197] 13) the first nucleic acid comprising SEQ ID NO: 116 and the second nucleic acid comprising SEQ ID NO: 110;
[0198] 14) the first nucleic acid comprising SEQ ID NO: 116 and the second nucleic acid comprising SEQ ID NO: 111;
[0199] 15) the first nucleic acid comprising SEQ ID NO: 117 and the second nucleic acid comprising SEQ ID NO: 110;
[0200] 16) the first nucleic acid comprising SEQ ID NO: 117 and the second nucleic acid comprising SEQ ID NO: 111;
[0201] 17) the first nucleic acid comprising SEQ ID NO: 112 and the second nucleic acid comprising SEQ ID NO: 114;
[0202] 18) the first nucleic acid comprising SEQ ID NO: 112 and the second nucleic acid comprising SEQ ID NO: 115;
[0203] 19) the first nucleic acid comprising SEQ ID NO: 113 and the second nucleic acid comprising SEQ ID NO: 114; or
[0204] 20) the first nucleic acid comprising SEQ ID NO: 113 and the second nucleic acid comprising SEQ ID NO: 115.
[0205] In one respect, the invention provides an expression vector composition, which comprises:
[0206] (I) a first expression vector comprising a nucleotide sequence selected from the group consisting of SEQ ID NOs: 97, 98, 107, 108, 109, 112, 113, 116 and 117; and
[0207] (II) a second expression vector comprising a nucleotide sequences selected from the group consisting of SEQ ID NOs: 99, 100, 101, 110, 111, 114 and 115.
[0208] In some embodiments, the invention provides the expression vector composition, which comprises:
[0209] 1) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 97 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 99;
[0210] 2) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 97 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 100;
[0211] 3) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 97 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 101;
[0212] 4) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 98 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 99;
[0213] 5) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 98 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 100;
[0214] 6) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 98 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 101;
[0215] 7) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 107 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 110;
[0216] 8) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 107 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 111;
[0217] 9) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 108 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 110;
[0218] 10) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 108 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 111;
[0219] 11) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 109 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 110;
[0220] 12) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 109 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 111;
[0221] 13) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 116 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 110;
[0222] 14) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 116 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 111;
[0223] 15) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 117 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 110;
[0224] 16) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 117 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 111;
[0225] 17) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 112 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 114;
[0226] 18) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 112 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 115;
[0227] 19) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 113 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 114; or
[0228] 20) a first expression vector comprising a nucleotide sequence of SEQ ID NO: 113 and a second expression vector comprising a nucleotide sequence of SEQ ID NO: 115.
[0229] In another respect, the invention provides an expression vector, which comprises:
[0230] (I) a first nucleic acid sequence comprising a nucleotide sequence selected from the group consisting of SEQ ID NOs: 97, 98, 107, 108, 109, 112, 113, 116 and 117; and
[0231] (II) a second nucleic acid sequence comprising a nucleotide sequence selected from the group consisting of SEQ ID NOs: 99, 100, 101, 110, 111, 114 and 115.
[0232] In some embodiments, the expression vector, comprises:
[0233] 1) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 97 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 99;
[0234] 2) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 97 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 100;
[0235] 3) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 97 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 101;
[0236] 4) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 98 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 99;
[0237] 5) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 98 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 100;
[0238] 6) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 98 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 101;
[0239] 7) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 107 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 110;
[0240] 8) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 107 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 111;
[0241] 9) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 108 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 110;
[0242] 10) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 108 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 111;
[0243] 11) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 109 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 110;
[0244] 12) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 109 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 111;
[0245] 13) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 116 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 110;
[0246] 14) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 116 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 111;
[0247] 15) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 117 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 110;
[0248] 16) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 117 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 111;
[0249] 17) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 112 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 114;
[0250] 18) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 112 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 115;
[0251] 19) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 113 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 114; or
[0252] 20) a first nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 113 and a second nucleic acid sequence comprising a nucleotide sequence of SEQ ID NO: 115.
[0253] In yet another respect, the invention provides a cell comprising any one of the expression vector composition.
[0254] In one respect, the invention provides a method of preparing the isolated antibody or antigen-binding fragment thereof, comprising expressing the isolated antibody or antigen-bind thereof in the cell, and isolating the isolated antibody or antigen-binding fragment from the cell.
[0255] In another respect, the invention provides a pharmaceutical composition comprising the isolated antibody or antigen-binding fragment thereof, and a pharmaceutically acceptable excipient.
[0256] In yet another respect, the invention provides a kit comprising the isolated antibody or antigen-binding fragment thereof.
[0257] In one respect, the invention provides a method of treating tumor comprising administering a subject in need a therapeutically effective amount of the isolated antibody or antigen-binding fragment thereof, or the pharmaceutical composition. In some embodiments, the tumor is selected from solid tumor or hematological tumor. In some embodiments, the tumor is selected from bladder cancer, breast cancer, cervical cancer, ovarian cancer, prostate cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, pancreatic cancer, colorectal cancer, colon cancer, renal cancer, head and neck cancer, lung cancer (small cell lung cancer or non-small cell lung cancer), stomach cancer, bone cancer, liver cancer, thyroid cancer, skin cancer, central nervous system tumor, lymphoma, leukemia, myeloma, sarcoma, and virus-associated cancer.
[0258] In another respect, the invention provides use of the isolated antibody or antigen-binding fragment thereof, or the pharmaceutical composition for the manufacture of a medicament for a treatment of tumor. In some embodiments, the tumor is selected from solid tumor or hematological tumor. In some embodiments, the tumor is selected from bladder cancer, breast cancer, cervical cancer, ovarian cancer, prostate cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, pancreatic cancer, colorectal cancer, colon cancer, renal cancer, head and neck cancer, lung cancer (small cell lung cancer or non-small cell lung cancer), stomach cancer, bone cancer, liver cancer, thyroid cancer, skin cancer, central nervous system tumor, lymphoma, leukemia, myeloma, sarcoma, and virus-associated cancer.
[0259] In yet another respect, the invention provides the isolated antibody or antigen-binding fragment thereof, or the pharmaceutical composition for use in a treatment of tumor. In some embodiments, the tumor is selected from solid tumor or hematological tumor. In some embodiments, the cancer is selected from bladder cancer, breast cancer, cervical cancer, ovarian cancer, prostate cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, pancreatic cancer, colorectal cancer, colon cancer, renal cancer, head and neck cancer, lung cancer (small cell lung cancer or non-small cell lung cancer), stomach cancer, bone cancer, liver cancer, thyroid cancer, skin cancer, central nervous system tumor, lymphoma, leukemia, myeloma, sarcoma, and virus-associated cancer.
TABLE-US-00001 TABLE I Description of the antibody sequence listing of the invention SEQ ID Sequence NO: Description Sequence 1 huCD73 WELTILHTNDVHSRLEQTSEDSSKCVNASRCMGG VARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFT VYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLI EPLLKEAKFPILSANIKAKGPLASQISGLYLPYK VLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDE ITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIA QKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYP FIVTSDDGRKVPVVQAYAFGKYLGYLKIEFDERG NVISSHGNPILLNSSIPEDPSIKADINKWRIKLD NYSTQELGKTIVYLDGSSQSCRFRECNMGNLICD AMINNNLRHTDEMFWNHVSMCILNGGGIRSPIDE RNNGTITWENLAAVLPFGGTFDLVQLKGSTLKKA FEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDR VVKLDVLCTKCRVPSYDPLKMDEVYKVILPNFLA NGGDGFQMIKDELLRHDSGDQDINVVSTYISKMK VIYPAVEGRIKAHHHHHHHHHH 2 cynoCD73 WELTILHTNDVHSRLEQTSEDSSKCVNASRCMGG VARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFT VYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLI EPLLKEAKFPILSANIKAKGPLASQISGLYLPYK VLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDE ITALQPEVDKLKTLNVNKIIALGHSGFETDKLIA QKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYP FIVTSDDGRKVPVVQAYAFGKYLGYLKIEFDERG NVISSHGNPILLNSSIPEDPSIKADINKWRIKLD NYSTQELGKTIVYLDGSSQSCRFRECNMGNLICD AMINNNLRHADEMEWNHVSMCILNGGGIRSPIDE RNNGTITWENLAAVLPFGGTFDLVQLKGSTLKKA FEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDR VVKLDVLCTKCRVPSYDPLKMDEIYKVILPNFLA NGGDGFQMIKDELLRHDSGDQDINVVSTYISKMK VIYPAVEGRIKAHHHHHHHHHH 3 S1B5 VH aa EVQLKESGAELVKPGASVKISCKATGYTFTGYWI EWVKQRPGRGLEWIGEILPGSDITNYNEKFKGKA TITADTSSNTAYMQLSSLTTEDSAIYYCARRGYD ETGYAMDYWGQGTSVTVSS 4 S1B5 VH nt GAGGTGCAGCTGAAGGAGTCTGGGGCTGAGCTGG TGAAGCCTGGGGCCTCAGTGAAGATTTCCTGCAA AGCTACTGGCTATACATTCACTGGCTACTGGATA GAGTGGGTAAAGCAGAGGCCTGGACGTGGCCTTG AGTGGATTGGAGAGATTTTACCTGGAAGTGATAT TACTAACTACAATGAGAAGTTCAAGGGCAAGGCC ACAATCACTGCAGATACATCCTCCAACACAGCCT ACATGCAACTCAGCAGCCTGACAACTGAGGACTC TGCCATCTATTACTGTGCAAGAAGGGGTTACGAC GAGACGGGCTATGCTATGGACTACTGGGGTCAAG GAACCTCAGTCACAGTCTCCTCA 5 S1B5 VH GYWIE CDR1 6 S1B5 VH EILPGSDITNYNEKFKG CDR2 7 S1B5 VH RGYDETGYAMDY CDR3 8 S1B5 VL aa DIVMTQSPASLAVSLGQRATISCKASQSVDYDGD SYMNWYQQKPGQPPKLLIHAASNLESGIPARFSG SGSGTDFTLNIHPVEEEDAAVYFCQQSKEVPWTF GEGTKLEIK 9 S1B5 VL nt GACATTGTGATGACCCAATCTCCAGCTTCTTTGG CTGTGTCTCTAGGGCAGAGGGCCACCATCTCCTG CAAGGCCAGCCAAAGTGTTGATTATGATGGTGAT AGCTATATGAACTGGTACCAACAGAAACCAGGAC AGCCACCCAAACTCCTCATCCATGCTGCATCCAA TCTAGAATCTGGGATCCCAGCCAGGTTTAGTGGC AGTGGGTCTGGGACAGACTTCACCCTCAACATCC ATCCTGTGGAGGAAGAGGATGCTGCAGTGTATTT CTGTCAGCAAAGTAAGGAGGTTCCGTGGACGTTC GTGGAAGGGACCAAGCTGGAAATCAAA 10 S1B5 VL KASQSVDYDGDSYMN CDR1 11 S1B5 VL AASNLES CDR2 12 S1B5 VL QQSKEVPWT CDR3 13 S1B5 hIgG1 EVQLKESGAELVKPGASVKISCKATGYTFTGYWI full heavy EWVKQRPGRGLEWIGEILPGSDITNYNEKFKGKA chain TITADTSSNTAYMQLSSLTTEDSAIYYCARRGYD ETGYAMDYWGQGTSVTVSSASTKGPSVFPLAPSS KSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC NVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQ KSLSLSPGK 14 S1B5 DIVMTQSPASLAVSLGQRATISCKASQSVDYDGD hkappa full SYMNWYQQKPGQPPKLLIHAASNLESGIPARFSG light chain SGSGTDFTLNIHPVEEEDAAVYFCQQSKEVPWTF GEGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQ DSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG LSSPVTKSFNRGEC 15 S1B5 hIgG2 EVQLKESGAELVKPGASVKISCKATGYTFTGYWI full heavy EWVKQRPGRGLEWIGEILPGSDITNYNEKFKGKA chain TITADTSSNTAYMQLSSLTTEDSAIYYCARRGYD ETGYAMDYWGQGTSVTVSSASTKGPSVFPLAPCS RSTSESTAALGCLVKDYFPEPVTVSWNSGALTSG VHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTC NVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE VQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVL TVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTK GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK 16 JB24Chi QVQLQQSGLELVKPGASVKMSCKASGYTFTDYNM VH aa HWVKQSHGKSLEWIGYIKPHNGGTTYNPKFEGKA TLTVNKSSSTAYMELRSLTSEDSAVYYCVRCDFL YWYFDVWGTGTTVTVSS 17 JB24Chi CAGGTCCAACTGCAGCAGTCTGGACTTGAGCTGG VH nt TGAAGCCTGGGGCTTCAGTGAAGATGTCCTGCAA GGCTTCTGGATACACATTCACTGACTACAACATG CACTGGGTGAAGCAGAGCCATGGAAAGAGCCTTG AGTGGATTGGATATATTAAGCCTCACAATGGTGG TACTACCTACAACCCGAAGTTCGAGGGCAAGGCC ACATTGACTGTAAACAAGTCTTCCAGCACAGCCT ACATGGAGCTCCGCAGCCTGACATCGGAGGATTC TGCAGTCTATTACTGTGTAAGATGCGATTTTCTC TACTGGTATTTCGATGTCTGGGGCACAGGGACCA CGGTCACCGTCTCCTCA 18 JB24Chi DYNMH VH CDR1 19 JB24Chi YIKPHNGGTTYNPKFEG VH CDR2 20 JB24Chi CDFLYWYFDV VH CDR3 21 JB24Chi DIVMTQSPAIMSASLGERVTMTCTASSSVSSSYL VL aa HWYQQKPGSSPKLWIYSTSNLASGVPGRFSGSGS GTSYSLTISSMEAEDAATYYCHQYHRSPLTFGAG TKLEMK 22 JB24Chi GACATTGTGATGACCCAGTCTCCAGCAATCATGT VL nt CTGCATCTCTAGGGGAACGGGTCACCATGACCTG CACTGCCAGCTCAAGTGTAAGTTCCAGTTACTTG CACTGGTACCAGCAGAAGCCAGGATCCTCCCCCA AACTCTGGATTTATAGCACATCCAACCTGGCTTC TGGAGTCCCAGGTCGCTTCAGTGGCAGTGGGTCT GGGACCTCTTACTCTCTCACAATCAGCAGCATGG AGGCTGAAGATGCTGCCACTTATTACTGCCACCA GTATCATCGTTCCCCGCTCACGTTCGGTGCTGGG ACCAAGCTGGAAATGAAA 23 JB24Chi TASSSVSSSYLH VL CDR1 24 JB24Chi STSNLAS VL CDR2 25 JB24Chi HQYHRSPLT VL CDR3 26 JB24Chi QVQLQQSGLELVKPGASVKMSCKASGYTFTDYNM hIgG1 full HWVKQSHGKSLEWIGYIKPHNGGTTYNPKFEGKA heavy chain TLTVNKSSSTAYMELRSLTSEDSAVYYCVRCDFL YWYFDVWGTGTTVTVSSASTKGPSVFPLAPSSKS TSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVH TFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV NHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK 27 JB24Chi QVQLQQSGLELVKPGASVKMSCKASGYTFTDYNM hIgG2 full HWVKQSHGKSLEWIGYIKPHNGGTTYNPKFEGKA heavy chain TLTVNKSSSTAYMELRSLTSEDSAVYYCVRCDFL YWYFDVWGTGTTVTVSSASTKGPSVFPLAPCSRS TSESTAALGCLVKDYFPEPVTVSWNSGALTSGVH TFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNV DHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQ FNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTV VHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQ PREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSD IAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGK 28 JB24Chi DIVMTQSPAIMSASLGERVTMTCTASSSVSSSYL hkappa full HWYQQKPGSSPKLWIYSTSNLASGVPGRFSGSGS light chain GTSYSLTISSMEAEDAATYYCHQYHRSPLTFGAG TKLEMKRTVAAPSVFIFPPSDEQLKSGTASVVCL LNNFYPREAKVQWKVDNALQSGNSQESVTEQDSK DSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSS PVTKSFNRGEC 29 66F2A8D6 QVHLQQSGAELAKPGASVNLSCKASGYAFTSYWM VH aa HWVKQRPGQGLEWIGYINPSSGLAKYNQKFKDKA TLTTDKSSNTAYMQLSSLTYDDSAVYYCGRWLLS AWFAYWGQGTLVTVSA 30 66F2A8D6 CAGGTCCACCTGCAGCAGTCTGGGGCTGAACTGG VH nt CAAAACCTGGGGCCTCAGTGAACCTGTCCTGCAA GGCTTCTGGCTACGCCTTTACTAGTTACTGGATG CACTGGGTAAAACAGAGGCCTGGACAGGGTCTGG AATGGATTGGATACATTAATCCTAGCAGTGGTCT TGCTAAGTATAATCAGAAGTTCAAAGACAAGGCC ACATTGACTACAGACAAATCTTCCAACACAGCCT ACATGCAACTGAGCAGCCTGACATATGACGACTC TGCAGTCTATTACTGTGGAAGATGGTTACTTTCG GCCTGGTTTGCTTACTGGGGCCAAGGGACTCTGG TCACTGTCTCTGCA 31 66F2A8D6 SYWMH VH CDR1 32 66F2A8D6 YINPSSGLAKYNQKFKD VH CDR2 33 66F2A8D6 WLLSAWFAY VH CDR3 34 66F2A8D6 DIKMTQSPSSIYASLGERVTITCKASQGINTYLS VL aa WFQQKPGKSPKTLIYRANILVDGVPSRFSGSGSG QDYSLTINSLEYEDMGIYYCLQYDEFPYTFGGGT KLEIK
35 66F2A8D6 GACATCAAGATGACCCAGTCTCCATCTTCCATAT VL nt ATGCATCTCTAGGAGAGAGAGTCACTATCACTTG CAAGGCGAGTCAGGGCATTAATACCTATTTAAGC TGGTTCCAGCAGAAACCAGGAAAATCTCCTAAGA CCCTGATCTATCGTGCAAACATCTTGGTAGATGG GGTCCCATCAAGGTTCAGTGGCAGTGGATCTGGG CAAGATTATTCTCTCACCATCAACAGCCTGGAGT ATGAAGATATGGGAATTTATTATTGTCTACAGTA TGATGAGTTTCCGTACACGTTCGGAGGGGGGACC AAGCTGGAAATAAAA 36 66F2A8D6 KASQGINTYLS VL CDR1 37 66F2A8D6 RANILVD VL CDR2 38 66F2A8D6 LQYDEFPYT VL CDR3 39 66-hIgG2 QVHLQQSGAELAKPGASVNLSCKASGYAFTSYWM full heavy HWVKQRPGQGLEWIGYINPSSGLAKYNQKFKDKA chain TLTTDKSSNTAYMQLSSLTYDDSAVYYCGRWLLS AWFAYWGQGTLVTVSAASTKGPSVFPLAPCSRST SESTAALGCLVKDYFPEPVTVSWNSGALTSGVHT FPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVD HKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQF NWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVV HQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQP REPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GK 40 66-hkappa DIKMTQSPSSIYASLGERVTITCKASQGINTYLS full light WFQQKPGKSPKTLIYRANILVDGVPSRFSGSGSG chain QDYSLTINSLEYEDMGIYYCLQYDEFPYTFGGGT KLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLL NNFYPREAKVQWKVDNALQSGNSQESVTEQDSKD STYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP VTKSFNRGEC 41 94A12G11F2 QVQLQQSGAELAKPGASVKLSCKASGYTFTSYWM VH aa HWVKQRPGQGLEWIGYINPSSGYTKSNQKFKDKA TLTADKSSSTAYMQLSSLTYEDSAVYYCGRWLLS AWFAYWGQGTLVTVSA 42 94A12G11F2 CAGGTCCAGCTGCAGCAGTCTGGGGCTGAACTGG VH nt CAAAACCTGGGGCCTCAGTGAAGCTGTCCTGCAA GGCTTCTGGCTACACCTTTACTAGTTACTGGATG CACTGGGTAAAACAGAGGCCTGGACAGGGTCTGG AATGGATTGGATACATTAATCCTAGCAGTGGTTA TACTAAGTCCAATCAGAAGTTCAAGGACAAGGCC ACATTGACTGCAGACAAATCCTCCAGCACAGCCT ACATGCAGCTGAGCAGCCTGACATATGAGGACTC TGCAGTCTATTACTGTGGAAGATGGTTACTTTCG GCCTGGTTTGCTTACTGGGGCCAAGGGACTCTGG TCACTGTCTCTGCA 43 94A12G11F2 SYWMH VH CDR1 44 94A12G11F2 YINPSSGYTKSNQKFKD VH CDR2 45 94A12G11F2 WLLSAWFAY VH CDR3 46 94A12G11F2 DIRMTQSPSSMYASLGERVTITCKASQDINTYLS VL aa WFQQKPGKSPKSLIYRSNILVDGVPSRFSGSGSG QDYSLTISSLEYEDMGIYYCLQYDDFPYTFGGGT KLEIK 47 94A12G11F2 GACATCAGGATGACCCAGTCTCCATCTTCCATGT VL nt ATGCATCTCTAGGAGAGAGAGTCACTATCACTTG CAAGGCGAGTCAGGACATTAATACCTATTTAAGC TGGTTCCAGCAGAAACCAGGAAAATCTCCTAAGT CCCTGATCTATCGCTCAAACATCTTGGTAGATGG GGTCCCATCAAGATTCAGTGGCAGTGGATCTGGT CAAGATTATTCTCTCACCATCAGCAGCCTGGAGT ATGAGGATATGGGAATTTATTATTGTCTACAGTA TGATGACTTTCCGTACACGTTCGGAGGGGGGACC AAGCTGGAAATAAAA 48 94A12G11F2 KASQDINTYLS VL CDR1 49 94A12G11F2 RSNILVD VL CDR2 50 94A12G11F2 LQYDDFPYT VL CDR3 51 94-hIgG2 QVQLQQSGAELAKPGASVKLSCKASGYTFTSYWM full heavy HWVKQRPGQGLEWIGYINPSSGYTKSNQKFKDKA chain TLTADKSSSTAYMQLSSLTYEDSAVYYCGRWLLS AWFAYWGQGTLVTVSAASTKGPSVFPLAPCSRST SESTAALGCLVKDYFPEPVTVSWNSGALTSGVHT FPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVD HKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQF NWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVV HQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQP REPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GK 52 94-hIgG1 QVQLQQSGAELAKPGASVKLSCKASGYTFTSYWM full heavy HWVKQRPGQGLEWIGYINPSSGYTKSNQKFKDKA chain TLTADKSSSTAYMQLSSLTYEDSAVYYCGRWLLS AWFAYWGQGTLVTVSAASTKGPSVFPLAPSSKST SGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHT FPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN HKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPGK 53 94-hkappa DIRMTQSPSSMYASLGERVTITCKASQDINTYLS full light WFQQKPGKSPKSLIYRSNILVDGVPSRFSGSGSG chain QDYSLTISSLEYEDMGIYYCLQYDDFPYTFGGGT KLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLL NNFYPREAKVQWKVDNALQSGNSQESVTEQDSKD STYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP VTKSFNRGEC 54 191C3A8B9 QVQLKESGPGLVAPSQSLSITCTVSGFSLTNYGV VH aa HWVRQPPGKGLEWLGVIWAGGSTNYNSALMSRLS ISKDNSKSQLFLKMNSLQADDTAMYYCARERGSS WGTMDYWGQGTSVTVSS 55 191C3A8B9 CAGGTGCAGCTGAAGGAGTCAGGACCTGGCCTGG VH nt TGGCGCCCTCACAGAGCCTGTCCATCACTTGCAC TGTCTCTGGGTTTTCATTAACCAACTATGGTGTA CACTGGGTTCGCCAGCCTCCAGGAAAGGGTCTGG AGTGGCTGGGAGTAATATGGGCTGGTGGAAGCAC AAATTATAATTCGGCTCTCATGTCCAGACTGAGC ATCAGCAAAGACAACTCCAAGAGCCAACTTTTCT TAAAAATGAACAGTCTGCAAGCTGATGACACAGC CATGTACTACTGTGCCAGAGAGAGGGGTAGTAGC TGGGGGACTATGGACTACTGGGGTCAAGGAACCT CAGTCACTGTCTCCTCA 56 191C3A8B9 NYGVH VH CDR1 57 191C3A8B9 VIWAGGSTNYNSALMS VH CDR2 58 191C3A8B9 ERGSSWGTMDY VH CDR3 59 191C3A8B9 QIVLTQSPAIMSASPGEKVTMTCSASSRVSYMHW VL aa YQQKSGTSPKRWIYDTSQLASGVPARFSGSGSGT SYSLTISSMEAEDAATYYCQQWSSNPYTFGGGTK LEMR 60 191C3A8B9 CAAATTGTTCTCACCCAGTCTCCAGCAATCATGT VL nt CTGCATCTCCAGGGGAGAAGGTCACCATGACCTG CAGTGCCAGCTCACGTGTAAGTTACATGCACTGG TACCAGCAGAAGTCAGGCACCTCCCCCAAAAGAT GGATTTATGACACATCCCAACTGGCTTCTGGAGT CCCTGCTCGCTTCAGTGGCAGTGGGTCTGGGACC TCTTACTCTCTCACAATCAGCAGCATGGAGGCTG AAGATGCTGCCACTTATTACTGCCAGCAGTGGAG TAGTAACCCATACACGTTCGGAGGGGGGACCAAG CTGGAAATGAGA 61 191C3A8B9 SASSRVSYMH VL CDR1 62 191C3A8B9 DTSQLAS VL CDR2 63 191C3A8B9 QQWSSNPYT VL CDR3 64 191-hIgG2 QVQLKESGPGLVAPSQSLSITCTVSGFSLTNYGV full heavy HWVRQPPGKGLEWLGVIWAGGSTNYNSALMSRLS chain ISKDNSKSQLFLKMNSLQADDTAMYYCARERGSS WGTMDYWGQGTSVTVSSASTKGPSVFPLAPCSRS TSESTAALGCLVKDYFPEPVTVSWNSGALTSGVH TFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNV DHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQ FNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTV VHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQ PREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSD IAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGK 65 191-hkappa QIVLTQSPAIMSASPGEKVTMTCSASSRVSYMHW full light YQQKSGTSPKRWIYDTSQLASGVPARFSGSGSGT chain SYSLTISSMEAEDAATYYCQQWSSNPYTFGGGTK LEMRRTVAAPSVFIFPPSDEQLKSGTASVVCLLN NFYPREAKVQWKVDNALQSGNSQESVTEQDSKDS TYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPV TKSFNRGEC 66 JB24H2 VH QVQLVQSGAEVKKPGASVKMSCKASGYTFTDYNM HWVRQSPGKSLEWIGYIKPHNAGTTYNPKFEGRA TLTVDTSASTAYMELSSLRSEDTAVYYCVRSDFL YWYFDVWGQGTTVTVSS 67 JB24H3 VH QVQLVQSGAEVKKPGASVKMSCKASGYTFTDYNM HWVKQSHGKSLEWIGYIKPHNAGTTYNPKFEGRA TLTVDTSASTAYMELRSLRSEDTAVYYCVRSDFL YWYFDVWGQGTTVTVSS 68 JB24L1 VL DIQMTQSPSSLSASVGDRVTITCTASSSVSSSYL HWYQQKPGKAPKLLIYSTSNLASGVPSRFSGSGS GTDFTLTISSLQPEDFATYYCHQYHRSPLTFGAG TKLEIK 69 JB24L2 VL DIQMTQSPSSLSASVGDRVTITCTASSSVSSSYL HWYQQKPGSAPKLWIYSTSNLASGVPSRFSGSGS GTDYTLTISSLQPEDFATYYCHQYHRSPLTFGAG TKLEIK 70 JB24L3 VL DIVMTQSPSSLSASVGDRVTITCTASSSVSSSYL HWYQQKPGSSPKLWIYSTSNLASGVPGRFSGSGS GTDYTLTISSLQPEDFATYYCHQYHRSPLTFGAG TKLEIK 71 JB24H2 QVQLVQSGAEVKKPGASVKMSCKASGYTFTDYNM hIgG1 full HWVRQSPGKSLEWIGYIKPHNAGTTYNPKFEGRA heavy chain TLTVDTSASTAYMELSSLRSEDTAVYYCVRSDFL YWYFDVWGQGTTVTVSSASTKGPSVFPLAPSSKS TSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVH TFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV NHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK 72 JB24H3 QVQLVQSGAEVKKPGASVKMSCKASGYTFTDYNM hIgG1 full HWVKQSHGKSLEWIGYIKPHNAGTTYNPKFEGRA heavy chain TLTVDTSASTAYMELRSLRSEDTAVYYCVRSDFL YWYFDVWGQGTTVTVSSASTKGPSVFPLAPSSKS
TSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVH TFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV NHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK 73 JB24L1 DIQMTQSPSSLSASVGDRVTITCTASSSVSSSYL hkappa full HWYQQKPGKAPKLLIYSTSNLASGVPSRFSGSGS light chain GTDFTLTISSLQPEDFATYYCHQYHRSPLTFGAG TKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCL LNNFYPREAKVQWKVDNALQSGNSQESVTEQDSK DSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSS PVTKSFNRGEC 74 JB24L2 DIQMTQSPSSLSASVGDRVTITCTASSSVSSSYL hkappa full HWYQQKPGSAPKLWIYSTSNLASGVPSRFSGSGS light chain GTDYTLTISSLQPEDFATYYCHQYHRSPLTFGAG TKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCL LNNFYPREAKVQWKVDNALQSGNSQESVTEQDSK DSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSS PVTKSFNRGEC 75 JB24L3 DIVMTQSPSSLSASVGDRVTITCTASSSVSSSYL hkappa full HWYQQKPGSSPKLWIYSTSNLASGVPGRFSGSGS light chain GTDYTLTISSLQPEDFATYYCHQYHRSPLTFGAG TKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCL LNNFYPREAKVQWKVDNALQSGNSQESVTEQDSK DSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSS PVTKSFNRGEC 76 JB94H1 VH QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWM HWVRQAPGQGLEWMGYINPSSGYTKSNQKFKDRV TMTADTSTSTAYMELSSLRSEDTAVYYCGRWLLS AWFAYWGQGTLVTVSS 77 JB94H2 VH QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWM HWVRQRPGQGLEWMGYINPSSGYTKSNQKFKDRV TLTADTSTSTAYMELSSLRSEDTAVYYCGRWLLS AWFAYWGQGTLVTVSS 78 JB94H3 VH QVQLQQSGAEVKKPGASVKLSCKASGYTFTSYWM HWVRQRPGQGLEWIGYINPSSGYTKSNQKFKDRA TLTADTSTSTAYMELSSLRSEDTAVYYCGRWLLS AWFAYWGQGTLVTVSS 79 JB94L1 VL DIQMTQSPSSLSASVGDRVTITCKASQDINTYLS WFQQKPGKAPKSLIYRSNILVDGVPSRFSGSGSG QDFTLTISSLQPEDFAIYYCLQYDDFPYTFGQGT KLEIK 80 JB94L3 VL DIQMTQSPSSLSASVGDRVTITCKASQDINTYLS WFQQKPGKSPKSLIYRSNILVDGVPSRFSGSGSG QDYTLTISSLQPEDFAIYYCLQYDDFPYTFGQGT KLEIK 81 JB94H1 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWM hIgG1 full HWVRQAPGQGLEWMGYINPSSGYTKSNQKFKDRV heavy chain TMTADTSTSTAYMELSSLRSEDTAVYYCGRWLLS AWFAYWGQGTLVTVSSASTKGPSVFPLAPSSKST SGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHT FPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN HKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPGK 82 JB94H2 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWM hIgG1 full HWVRQRPGQGLEWMGYINPSSGYTKSNQKFKDRV heavy chain TLTADTSTSTAYMELSSLRSEDTAVYYCGRWLLS AWFAYWGQGTLVTVSSASTKGPSVFPLAPSSKST SGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHT FPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN HKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPGK 83 JB94H3 QVQLQQSGAEVKKPGASVKLSCKASGYTFTSYWM hIgG1 full HWVRQRPGQGLEWIGYINPSSGYTKSNQKFKDRA heavy chain TLTADTSTSTAYMELSSLRSEDTAVYYCGRWLLS AWFAYWGQGTLVTVSSASTKGPSVFPLAPSSKST SGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHT FPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN HKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGP GSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPGK 84 JB94L1 DIQMTQSPSSLSASVGDRVTITCKASQDINTYLS hkappa full WFQQKPGKAPKSLIYRSNILVDGVPSRFSGSGSG light chain QDFTLTISSLQPEDFAIYYCLQYDDFPYTFGQGT KLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLL NNFYPREAKVQWKVDNALQSGNSQESVTEQDSKD STYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP VTKSFNRGEC 85 JB94L3 DIQMTQSPSSLSASVGDRVTITCKASQDINTYLS hkappa full WFQQKPGKSPKSLIYRSNILVDGVPSRFSGSGSG light chain QDYTLTISSLQPEDFAIYYCLQYDDFPYTFGQGT KLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLL NNFYPREAKVQWKVDNALQSGNSQESVTEQDSKD STYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP VTKSFNRGEC 86 JB94H1 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWM mIgG1 full HWVRQAPGQGLEWMGYINPSSGYTKSNQKFKDRV heavy chain TMTADTSTSTAYMELSSLRSEDTAVYYCGRWLLS AWFAYWGQGTLVTVSSAKTTPPSVYPLAPGSAAQ TNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHT FPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAH PASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIF PPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSW FVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQ DWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKA PQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITV EWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQ KSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK 87 JB94H3 QVQLQQSGAEVKKPGASVKLSCKASGYTFTSYWM mIgG1 full HWVRQRPGQGLEWIGYINPSSGYTKSNQKFKDRA heavy chain TLTADTSTSTAYMELSSLRSEDTAVYYCGRWLLS AWFAYWGQGTLVTVSSAKTTPPSVYPLAPGSAAQ TNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHT FPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAH PASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIF PPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSW FVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQ DWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKA PQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITV EWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQ KSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK 88 JB94L1 DIQMTQSPSSLSASVGDRVTITCKASQDINTYLS mkappa full WFQQKPGKAPKSLIYRSNILVDGVPSRFSGSGSG light chain QDFTLTISSLQPEDFAIYYCLQYDDFPYTFGQGT KLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFL NNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKD STYSMSSTLTLTKDEYERHNSYTCEATHKTSTSP IVKSFNRNEC 89 JB94L3 DIQMTQSPSSLSASVGDRVTITCKASQDINTYLS mkappa full WFQQKPGKSPKSLIYRSNILVDGVPSRFSGSGSG light chain QDYTLTISSLQPEDFAIYYCLQYDDFPYTFGQGT KLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFL NNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKD STYSMSSTLTLTKDEYERHNSYTCEATHKTSTSP IVKSFNRNEC 90 JB94H1 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWM hIgG1mt HWVRQAPGQGLEWMGYINPSSGYTKSNQKFKDRV full heavy TMTADTSTSTAYMELSSLRSEDTAVYYCGRWLLS chain AWFAYWGQGTLVTVSSASTKGPSVFPLAPSSKST SGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHT FPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN HKPSNTKVDKRVEPKSCDKTHTCPPCPAPEFEGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPASIEKTISKA KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPGK 91 JB94H3 QVQLQQSGAEVKKPGASVKLSCKASGYTFTSYWM hIgG1mt HWVRQRPGQGLEWIGYINPSSGYTKSNQKFKDRA full heavy TLTADTSTSTAYMELSSLRSEDTAVYYCGRWLLS chain AWFAYWGQGTLVTVSSASTKGPSVFPLAPSSKST SGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHT FPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN HKPSNTKVDKRVEPKSCDKTHTCPPCPAPEFEGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPASIEKTISKA KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPGK 92 JB24H2 CAGGTGCAGCTGGTGCAGAGCGGCGCCGAGGTGA VH nt AGAAGCCCGGCGCCAGCGTGAAGATGAGCTGCAA GGCCAGCGGCTACACCTTCACCGACTACAACATG CACTGGGTGAGACAGAGCCCCGGCAAGAGCCTGG AGTGGATCGGCTACATCAAGCCCCACAACGCCGG CACCACCTACAACCCCAAGTTCGAGGGCAGAGCC ACCCTGACCGTGGACACCAGCGCCAGCACCGCCT ACATGGAGCTGAGCAGCCTGAGAAGCGAGGACAC CGCCGTGTACTACTGCGTAAGAAGCGACTTCCTG TACTGGTACTTCGACGTGTGGGGCCAGGGCACCA CCGTGACCGTGTCCTCA 93 JB24H3 CAGGTGCAGCTGGTGCAGAGCGGCGCCGAGGTGA VH nt AGAAGCCCGGCGCCAGCGTGAAGATGAGCTGCAA GGCCAGCGGCTACACCTTCACCGACTACAACATG CACTGGGTGAAGCAGAGCCACGGCAAGAGCCTGG AGTGGATCGGCTACATCAAGCCCCACAACGCCGG CACCACCTACAACCCCAAGTTCGAGGGCAGAGCC ACCCTGACCGTGGACACCAGCGCCAGCACCGCCT ACATGGAGCTGAGAAGCCTGAGAAGCGAGGACAC CGCCGTGTACTACTGCGTAAGAAGCGATTTTCTC TACTGGTATTTCGATGTCTGGGGCCAGGGCACCA CCGTGACCGTGTCCTCA 94 JB24L1 GACATCCAGATGACCCAGAGCCCCAGCAGCCTGA VL nt GCGCCAGCGTGGGCGACAGAGTGACCATCACCTG CACCGCCAGCAGCAGCGTGAGCAGCAGCTACCTG CACTGGTACCAGCAGAAGCCCGGCAAGGCCCCCA AGCTGCTGATCTACAGCACCAGCAACCTGGCCAG CGGCGTGCCCAGCAGATTCAGCGGCAGCGGCAGC GGCACCGACTTCACCCTGACCATCAGCAGCCTGC AGCCCGAGGACTTCGCCACCTACTACTGCCACCA GTATCATCGTTCCCCGCTCACGTTCGGCGCCGGC ACCAAGCTGGAGATCAAG 95 JB24L2 GACATCCAGATGACCCAGAGCCCCAGCAGCCTGA VL nt GCGCCAGCGTGGGCGACAGAGTGACCATCACCTG CACCGCCAGCAGCAGCGTGAGCAGCAGCTACCTG CACTGGTACCAGCAGAAGCCCGGCAGCGCCCCCA AGCTGTGGATCTACAGCACCAGCAACCTGGCCAG CGGCGTGCCCAGCAGATTCAGCGGCAGCGGCAGC GGCACCGACTACACCCTGACCATCAGCAGCCTGC AGCCCGAGGACTTCGCCACCTACTACTGCCACCA GTATCATCGTTCCCCGCTCACGTTCGGCGCCGGC ACCAAGCTGGAGATCAAG 96 JB24L3 GACATCGTGATGACCCAGAGCCCCAGCAGCCTGA VL nt GCGCCAGCGTGGGCGACAGAGTGACCATCACCTG CACCGCCAGCAGCAGCGTGAGCAGCAGCTACCTG CACTGGTACCAGCAGAAGCCCGGCAGCAGCCCCA AGCTGTGGATCTACAGCACCAGCAACCTGGCCAG CGGCGTGCCCGGCAGATTCAGCGGCAGCGGCAGC GGCACCGACTACACCCTGACCATCAGCAGCCTGC AGCCCGAGGACTTCGCCACCTACTACTGCCACCA GTATCATCGTTCCCCGCTCACGTTCGGCGCCGGC ACCAAGCTGGAGATCAAG
97 JB24H2 CAGGTGCAGCTGGTGCAGAGCGGCGCCGAGGTGA hIgG1 full AGAAGCCCGGCGCCAGCGTGAAGATGAGCTGCAA heavy chain GGCCAGCGGCTACACCTTCACCGACTACAACATG nt CACTGGGTGAGACAGAGCCCCGGCAAGAGCCTGG AGTGGATCGGCTACATCAAGCCCCACAACGCCGG CACCACCTACAACCCCAAGTTCGAGGGCAGAGCC ACCCTGACCGTGGACACCAGCGCCAGCACCGCCT ACATGGAGCTGAGCAGCCTGAGAAGCGAGGACAC CGCCGTGTACTACTGCGTAAGAAGCGACTTCCTG TACTGGTACTTCGACGTGTGGGGCCAGGGCACCA CCGTGACCGTGTCCTCAGCTAGCACCAAGGGCCC ATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGC ACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGG TCAAGGACTACTTCCCCGAACCGGTGACGGTGTC GTGGAACTCAGGCGCCCTGACCAGCGGCGTGCAC ACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCT ACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAG CAGCTTGGGCACCCAGACCTACATCTGCAACGTG AATCACAAGCCCAGCAACACCAAGGTGGACAAGA AAGTTGAGCCCAAATCTTGTGACAAAACTCACAC ATGCCCACCGTGCCCAGCACCTGAACTCCTGGGG GGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCA AGGACACCCTCATGATCTCCCGGACCCCTGAGGT CACATGCGTGGTGGTGGACGTGAGCCACGAAGAC CCTGAGGTCAAGTTCAACTGGTACGTGGACGGCG TGGAGGTGCATAATGCCAAGACAAAGCCGCGGGA GGAGCAGTACAACAGCACGTACCGTGTGGTCAGC GTCCTCACCGTCCTGCACCAGGACTGGCTGAATG GCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGC CCTCCCAGCCCCCATCGAGAAAACCATCTCCAAA GCCAAAGGGCAGCCCCGAGAACCACAGGTGTACA CCCTGCCCCCATCCCGGGATGAGTTGACCAAGAA CCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTC TATCCCAGCGACATCGCCGTGGAGTGGGAGAGCA ATGGGCAGCCGGAGAACAACTACAAGACCACGCC TCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTC TACAGCAAGCTCACCGTGGACAAGAGCAGGTGGC AGCAGGGGAACGTCTTCTCATGCTCCGTGATGCA TGAGGCTCTGCACAACCACTACACGCAGAAGAGC CTCTCCCTGTCTCCGGGTAAA 98 JB24H3 CAGGTGCAGCTGGTGCAGAGCGGCGCCGAGGTGA hIgG1 full AGAAGCCCGGCGCCAGCGTGAAGATGAGCTGCAA heavy chain GGCCAGCGGCTACACCTTCACCGACTACAACATG nt CACTGGGTGAAGCAGAGCCACGGCAAGAGCCTGG AGTGGATCGGCTACATCAAGCCCCACAACGCCGG CACCACCTACAACCCCAAGTTCGAGGGCAGAGCC ACCCTGACCGTGGACACCAGCGCCAGCACCGCCT ACATGGAGCTGAGAAGCCTGAGAAGCGAGGACAC CGCCGTGTACTACTGCGTAAGAAGCGATTTTCTC TACTGGTATTTCGATGTCTGGGGCCAGGGCACCA CCGTGACCGTGTCCTCAGCTAGCACCAAGGGCCC ATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGC ACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGG TCAAGGACTACTTCCCCGAACCGGTGACGGTGTC GTGGAACTCAGGCGCCCTGACCAGCGGCGTGCAC ACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCT ACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAG CAGCTTGGGCACCCAGACCTACATCTGCAACGTG AATCACAAGCCCAGCAACACCAAGGTGGACAAGA AAGTTGAGCCCAAATCTTGTGACAAAACTCACAC ATGCCCACCGTGCCCAGCACCTGAACTCCTGGGG GGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCA AGGACACCCTCATGATCTCCCGGACCCCTGAGGT CACATGCGTGGTGGTGGACGTGAGCCACGAAGAC CCTGAGGTCAAGTTCAACTGGTACGTGGACGGCG TGGAGGTGCATAATGCCAAGACAAAGCCGCGGGA GGAGCAGTACAACAGCACGTACCGTGTGGTCAGC GTCCTCACCGTCCTGCACCAGGACTGGCTGAATG GCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGC CCTCCCAGCCCCCATCGAGAAAACCATCTCCAAA GCCAAAGGGCAGCCCCGAGAACCACAGGTGTACA CCCTGCCCCCATCCCGGGATGAGTTGACCAAGAA CCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTC TATCCCAGCGACATCGCCGTGGAGTGGGAGAGCA ATGGGCAGCCGGAGAACAACTACAAGACCACGCC TCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTC TACAGCAAGCTCACCGTGGACAAGAGCAGGTGGC AGCAGGGGAACGTCTTCTCATGCTCCGTGATGCA TGAGGCTCTGCACAACCACTACACGCAGAAGAGC CTCTCCCTGTCTCCGGGTAAA 99 JB24L1 GACATCCAGATGACCCAGAGCCCCAGCAGCCTGA hkappa full GCGCCAGCGTGGGCGACAGAGTGACCATCACCTG light chain CACCGCCAGCAGCAGCGTGAGCAGCAGCTACCTG nt CACTGGTACCAGCAGAAGCCCGGCAAGGCCCCCA AGCTGCTGATCTACAGCACCAGCAACCTGGCCAG CGGCGTGCCCAGCAGATTCAGCGGCAGCGGCAGC GGCACCGACTTCACCCTGACCATCAGCAGCCTGC AGCCCGAGGACTTCGCCACCTACTACTGCCACCA GTATCATCGTTCCCCGCTCACGTTCGGCGCCGGC ACCAAGCTGGAGATCAAGCGTACGGTGGCTGCAC CATCTGTCTTCATCTTCCCGCCATCTGATGAGCA GTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTG CTGAATAACTTCTATCCCAGAGAGGCCAAAGTAC AGTGGAAGGTGGATAACGCCCTCCAATCGGGTAA CTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAG GACAGCACCTACAGCCTCAGCAGCACCCTGACGC TGAGCAAAGCAGACTACGAGAAACACAAAGTCTA CGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCG CCCGTCACAAAGAGCTTCAACAGGGGAGAGTGT 100 JB24L2 GACATCCAGATGACCCAGAGCCCCAGCAGCCTGA hkappa full GCGCCAGCGTGGGCGACAGAGTGACCATCACCTG light chain CACCGCCAGCAGCAGCGTGAGCAGCAGCTACCTG nt CACTGGTACCAGCAGAAGCCCGGCAGCGCCCCCA AGCTGTGGATCTACAGCACCAGCAACCTGGCCAG CGGCGTGCCCAGCAGATTCAGCGGCAGCGGCAGC GGCACCGACTACACCCTGACCATCAGCAGCCTGC AGCCCGAGGACTTCGCCACCTACTACTGCCACCA GTATCATCGTTCCCCGCTCACGTTCGGCGCCGGC ACCAAGCTGGAGATCAAGCGTACGGTGGCTGCAC CATCTGTCTTCATCTTCCCGCCATCTGATGAGCA GTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTG CTGAATAACTTCTATCCCAGAGAGGCCAAAGTAC AGTGGAAGGTGGATAACGCCCTCCAATCGGGTAA CTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAG GACAGCACCTACAGCCTCAGCAGCACCCTGACGC TGAGCAAAGCAGACTACGAGAAACACAAAGTCTA CGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCG CCCGTCACAAAGAGCTTCAACAGGGGAGAGTGT 101 JB24L3 GACATCGTGATGACCCAGAGCCCCAGCAGCCTGA hkappa full GCGCCAGCGTGGGCGACAGAGTGACCATCACCTG light chain CACCGCCAGCAGCAGCGTGAGCAGCAGCTACCTG nt CACTGGTACCAGCAGAAGCCCGGCAGCAGCCCCA AGCTGTGGATCTACAGCACCAGCAACCTGGCCAG CGGCGTGCCCGGCAGATTCAGCGGCAGCGGCAGC GGCACCGACTACACCCTGACCATCAGCAGCCTGC AGCCCGAGGACTTCGCCACCTACTACTGCCACCA GTATCATCGTTCCCCGCTCACGTTCGGCGCCGGC ACCAAGCTGGAGATCAAGCGTACGGTGGCTGCAC CATCTGTCTTCATCTTCCCGCCATCTGATGAGCA GTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTG CTGAATAACTTCTATCCCAGAGAGGCCAAAGTAC AGTGGAAGGTGGATAACGCCCTCCAATCGGGTAA CTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAG GACAGCACCTACAGCCTCAGCAGCACCCTGACGC TGAGCAAAGCAGACTACGAGAAACACAAAGTCTA CGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCG CCCGTCACAAAGAGCTTCAACAGGGGAGAGTGT 102 JB94H1 CAGGTGCAGCTGGTGCAGAGCGGCGCCGAGGTGA VH nt AGAAGCCCGGCGCCAGCGTGAAGGTGAGCTGCAA GGCCAGCGGCTACACCTTCACCAGCTACTGGATG CACTGGGTGAGACAGGCCCCCGGCCAGGGCCTGG AGTGGATGGGCTACATCAACCCCAGCAGCGGCTA CACCAAGAGCAACCAGAAGTTCAAGGACAGAGTG ACCATGACCGCCGACACCAGCACCAGCACCGCCT ACATGGAGCTGAGCAGCCTGAGAAGCGAGGACAC CGCCGTGTACTACTGCGGAAGATGGTTACTTTCG GCCTGGTTTGCTTACTGGGGCCAGGGCACCCTGG TGACCGTGAGCAGC 103 JB94H2 CAGGTGCAGCTGGTGCAGAGCGGCGCCGAGGTGA VH nt AGAAGCCCGGCGCCAGCGTGAAGGTGAGCTGCAA GGCCAGCGGCTACACCTTCACCAGCTACTGGATG CACTGGGTGAGACAGAGACCCGGCCAGGGCCTGG AGTGGATGGGCTACATCAACCCCAGCAGCGGCTA CACCAAGAGCAACCAGAAGTTCAAGGACAGAGTG ACCCTGACCGCCGACACCAGCACCAGCACCGCCT ACATGGAGCTGAGCAGCCTGAGAAGCGAGGACAC CGCCGTGTACTACTGCGGCAGATGGCTGCTGAGC GCCTGGTTCGCCTACTGGGGCCAGGGCACCCTGG TGACCGTGAGCAGC 104 JB94H3 CAGGTGCAGCTGCAGCAGAGCGGCGCCGAGGTGA VH nt AGAAGCCCGGCGCCAGCGTGAAGCTGAGCTGCAA GGCCAGCGGCTACACCTTCACCAGCTACTGGATG CACTGGGTGAGACAGAGACCCGGCCAGGGCCTGG AGTGGATCGGCTACATCAACCCCAGCAGCGGCTA CACCAAGAGCAACCAGAAGTTCAAGGACAGAGCC ACCCTGACCGCCGACACCAGCACCAGCACCGCCT ACATGGAGCTGAGCAGCCTGAGAAGCGAGGACAC CGCCGTGTACTACTGCGGCAGATGGCTGCTGAGC GCCTGGTTCGCCTACTGGGGCCAGGGCACCCTGG TGACCGTGAGCAGC 105 JB94L1 GACATCCAGATGACCCAGAGCCCCAGCAGCCTGA VL nt GCGCCAGCGTGGGCGACAGAGTGACCATCACCTG CAAGGCCAGCCAGGACATCAACACCTACCTGAGC TGGTTCCAGCAGAAGCCCGGCAAGGCCCCCAAGA GCCTGATCTACAGAAGCAACATCCTGGTGGACGG CGTGCCCAGCAGATTCAGCGGCAGCGGCAGCGGC CAGGACTTCACCCTGACCATCAGCAGCCTGCAGC CCGAGGACTTCGCCATCTACTACTGCCTACAGTA TGATGACTTTCCGTACACGTTCGGCCAGGGCACC AAGCTGGAGATCAAG 106 JB94L3 GACATCCAGATGACCCAGAGCCCCAGCAGCCTGA VL nt GCGCCAGCGTGGGCGACAGAGTGACCATCACCTG CAAGGCCAGCCAGGACATCAACACCTACCTGAGC TGGTTCCAGCAGAAGCCCGGCAAGAGCCCCAAGA GCCTGATCTACAGAAGCAACATCCTGGTGGACGG CGTGCCCAGCAGATTCAGCGGCAGCGGCAGCGGC CAGGACTACACCCTGACCATCAGCAGCCTGCAGC CCGAGGACTTCGCCATCTACTACTGCCTACAGTA TGATGACTTTCCGTACACGTTCGGCCAGGGCACC AAGCTGGAGATCAAG 107 JB94H1 CAGGTGCAGCTGGTGCAGAGCGGCGCCGAGGTGA hIgG1 full AGAAGCCCGGCGCCAGCGTGAAGGTGAGCTGCAA heavy chain GGCCAGCGGCTACACCTTCACCAGCTACTGGATG nt CACTGGGTGAGACAGGCCCCCGGCCAGGGCCTGG AGTGGATGGGCTACATCAACCCCAGCAGCGGCTA CACCAAGAGCAACCAGAAGTTCAAGGACAGAGTG ACCATGACCGCCGACACCAGCACCAGCACCGCCT ACATGGAGCTGAGCAGCCTGAGAAGCGAGGACAC CGCCGTGTACTACTGCGGAAGATGGTTACTTTCG GCCTGGTTTGCTTACTGGGGCCAGGGCACCCTGG TGACCGTGAGCAGCGCTAGCACCAAGGGCCCATC GGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACC TCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCA AGGACTACTTCCCCGAACCGGTGACGGTGTCGTG GAACTCAGGCGCCCTGACCAGCGGCGTGCACACC TTCCCGGCTGTCCTACAGTCCTCAGGACTCTACT CCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAG CTTGGGCACCCAGACCTACATCTGCAACGTGAAT CACAAGCCCAGCAACACCAAGGTGGACAAGAAAG TTGAGCCCAAATCTTGTGACAAAACTCACACATG CCCACCGTGCCCAGCACCTGAACTCCTGGGGGGA CCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGG ACACCCTCATGATCTCCCGGACCCCTGAGGTCAC ATGCGTGGTGGTGGACGTGAGCCACGAAGACCCT GAGGTCAAGTTCAACTGGTACGTGGACGGCGTGG AGGTGCATAATGCCAAGACAAAGCCGCGGGAGGA GCAGTACAACAGCACGTACCGTGTGGTCAGCGTC CTCACCGTCCTGCACCAGGACTGGCTGAATGGCA AGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCT CCCAGCCCCCATCGAGAAAACCATCTCCAAAGCC AAAGGGCAGCCCCGAGAACCACAGGTGTACACCC TGCCCCCATCCCGGGATGAGTTGACCAAGAACCA GGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTAT CCCAGCGACATCGCCGTGGAGTGGGAGAGCAATG GGCAGCCGGAGAACAACTACAAGACCACGCCTCC CGTGCTGGACTCCGACGGCTCCTTCTTCCTCTAC AGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGC AGGGGAACGTCTTCTCATGCTCCGTGATGCATGA GGCTCTGCACAACCACTACACGCAGAAGAGCCTC TCCCTGTCTCCGGGTAAA 108 JB94H2 CAGGTGCAGCTGGTGCAGAGCGGCGCCGAGGTGA hIgG1 full AGAAGCCCGGCGCCAGCGTGAAGGTGAGCTGCAA heavy chain GGCCAGCGGCTACACCTTCACCAGCTACTGGATG nt CACTGGGTGAGACAGAGACCCGGCCAGGGCCTGG AGTGGATGGGCTACATCAACCCCAGCAGCGGCTA CACCAAGAGCAACCAGAAGTTCAAGGACAGAGTG ACCCTGACCGCCGACACCAGCACCAGCACCGCCT ACATGGAGCTGAGCAGCCTGAGAAGCGAGGACAC CGCCGTGTACTACTGCGGCAGATGGCTGCTGAGC
GCCTGGTTCGCCTACTGGGGCCAGGGCACCCTGG TGACCGTGAGCAGCGCTAGCACCAAGGGCCCATC GGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACC TCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCA AGGACTACTTCCCCGAACCGGTGACGGTGTCGTG GAACTCAGGCGCCCTGACCAGCGGCGTGCACACC TTCCCGGCTGTCCTACAGTCCTCAGGACTCTACT CCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAG CTTGGGCACCCAGACCTACATCTGCAACGTGAAT CACAAGCCCAGCAACACCAAGGTGGACAAGAAAG TTGAGCCCAAATCTTGTGACAAAACTCACACATG CCCACCGTGCCCAGCACCTGAACTCCTGGGGGGA CCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGG ACACCCTCATGATCTCCCGGACCCCTGAGGTCAC ATGCGTGGTGGTGGACGTGAGCCACGAAGACCCT GAGGTCAAGTTCAACTGGTACGTGGACGGCGTGG AGGTGCATAATGCCAAGACAAAGCCGCGGGAGGA GCAGTACAACAGCACGTACCGTGTGGTCAGCGTC CTCACCGTCCTGCACCAGGACTGGCTGAATGGCA AGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCT CCCAGCCCCCATCGAGAAAACCATCTCCAAAGCC AAAGGGCAGCCCCGAGAACCACAGGTGTACACCC TGCCCCCATCCCGGGATGAGTTGACCAAGAACCA GGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTAT CCCAGCGACATCGCCGTGGAGTGGGAGAGCAATG GGCAGCCGGAGAACAACTACAAGACCACGCCTCC CGTGCTGGACTCCGACGGCTCCTTCTTCCTCTAC AGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGC AGGGGAACGTCTTCTCATGCTCCGTGATGCATGA GGCTCTGCACAACCACTACACGCAGAAGAGCCTC TCCCTGTCTCCGGGTAAA 109 JB94H3 CAGGTGCAGCTGCAGCAGAGCGGCGCCGAGGTGA hIgG1 full AGAAGCCCGGCGCCAGCGTGAAGCTGAGCTGCAA heavy chain GGCCAGCGGCTACACCTTCACCAGCTACTGGATG nt CACTGGGTGAGACAGAGACCCGGCCAGGGCCTGG AGTGGATCGGCTACATCAACCCCAGCAGCGGCTA CACCAAGAGCAACCAGAAGTTCAAGGACAGAGCC ACCCTGACCGCCGACACCAGCACCAGCACCGCCT ACATGGAGCTGAGCAGCCTGAGAAGCGAGGACAC CGCCGTGTACTACTGCGGCAGATGGCTGCTGAGC GCCTGGTTCGCCTACTGGGGCCAGGGCACCCTGG TGACCGTGAGCAGCGCTAGCACCAAGGGCCCATC GGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACC TCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCA AGGACTACTTCCCCGAACCGGTGACGGTGTCGTG GAACTCAGGCGCCCTGACCAGCGGCGTGCACACC TTCCCGGCTGTCCTACAGTCCTCAGGACTCTACT CCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAG CTTGGGCACCCAGACCTACATCTGCAACGTGAAT CACAAGCCCAGCAACACCAAGGTGGACAAGAAAG TTGAGCCCAAATCTTGTGACAAAACTCACACATG CCCACCGTGCCCAGCACCTGAACTCCTGGGGGGA CCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGG ACACCCTCATGATCTCCCGGACCCCTGAGGTCAC ATGCGTGGTGGTGGACGTGAGCCACGAAGACCCT GAGGTCAAGTTCAACTGGTACGTGGACGGCGTGG AGGTGCATAATGCCAAGACAAAGCCGCGGGAGGA GCAGTACAACAGCACGTACCGTGTGGTCAGCGTC CTCACCGTCCTGCACCAGGACTGGCTGAATGGCA AGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCT CCCAGCCCCCATCGAGAAAACCATCTCCAAAGCC AAAGGGCAGCCCCGAGAACCACAGGTGTACACCC TGCCCCCATCCCGGGATGAGTTGACCAAGAACCA GGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTAT CCCAGCGACATCGCCGTGGAGTGGGAGAGCAATG GGCAGCCGGAGAACAACTACAAGACCACGCCTCC CGTGCTGGACTCCGACGGCTCCTTCTTCCTCTAC AGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGC AGGGGAACGTCTTCTCATGCTCCGTGATGCATGA GGCTCTGCACAACCACTACACGCAGAAGAGCCTC TCCCTGTCTCCGGGTAAA 110 JB94L1 GACATCCAGATGACCCAGAGCCCCAGCAGCCTGA hkappa full GCGCCAGCGTGGGCGACAGAGTGACCATCACCTG light chain CAAGGCCAGCCAGGACATCAACACCTACCTGAGC nt TGGTTCCAGCAGAAGCCCGGCAAGGCCCCCAAGA GCCTGATCTACAGAAGCAACATCCTGGTGGACGG CGTGCCCAGCAGATTCAGCGGCAGCGGCAGCGGC CAGGACTTCACCCTGACCATCAGCAGCCTGCAGC CCGAGGACTTCGCCATCTACTACTGCCTACAGTA TGATGACTTTCCGTACACGTTCGGCCAGGGCACC AAGCTGGAGATCAAGCGTACGGTGGCTGCACCAT CTGTCTTCATCTTCCCGCCATCTGATGAGCAGTT GAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTG AATAACTTCTATCCCAGAGAGGCCAAAGTACAGT GGAAGGTGGATAACGCCCTCCAATCGGGTAACTC CCAGGAGAGTGTCACAGAGCAGGACAGCAAGGAC AGCACCTACAGCCTCAGCAGCACCCTGACGCTGA GCAAAGCAGACTACGAGAAACACAAAGTCTACGC CTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCC GTCACAAAGAGCTTCAACAGGGGAGAGTGT 111 JB94L3 GACATCCAGATGACCCAGAGCCCCAGCAGCCTGA hkappa full GCGCCAGCGTGGGCGACAGAGTGACCATCACCTG light chain CAAGGCCAGCCAGGACATCAACACCTACCTGAGC nt TGGTTCCAGCAGAAGCCCGGCAAGAGCCCCAAGA GCCTGATCTACAGAAGCAACATCCTGGTGGACGG CGTGCCCAGCAGATTCAGCGGCAGCGGCAGCGGC CAGGACTACACCCTGACCATCAGCAGCCTGCAGC CCGAGGACTTCGCCATCTACTACTGCCTACAGTA TGATGACTTTCCGTACACGTTCGGCCAGGGCACC AAGCTGGAGATCAAGCGTACGGTGGCTGCACCAT CTGTCTTCATCTTCCCGCCATCTGATGAGCAGTT GAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTG AATAACTTCTATCCCAGAGAGGCCAAAGTACAGT GGAAGGTGGATAACGCCCTCCAATCGGGTAACTC CCAGGAGAGTGTCACAGAGCAGGACAGCAAGGAC AGCACCTACAGCCTCAGCAGCACCCTGACGCTGA GCAAAGCAGACTACGAGAAACACAAAGTCTACGC CTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCC GTCACAAAGAGCTTCAACAGGGGAGAGTGT 112 JB94H1 CAGGTGCAGCTGGTGCAGAGCGGCGCCGAGGTGA mIgG1 full AGAAGCCCGGCGCCAGCGTGAAGGTGAGCTGCAA heavy chain GGCCAGCGGCTACACCTTCACCAGCTACTGGATG nt CACTGGGTGAGACAGGCCCCCGGCCAGGGCCTGG AGTGGATGGGCTACATCAACCCCAGCAGCGGCTA CACCAAGAGCAACCAGAAGTTCAAGGACAGAGTG ACCATGACCGCCGACACCAGCACCAGCACCGCCT ACATGGAGCTGAGCAGCCTGAGAAGCGAGGACAC CGCCGTGTACTACTGCGGAAGATGGTTACTTTCG GCCTGGTTTGCTTACTGGGGCCAGGGCACCCTGG TGACCGTGAGCAGCGCCAAGACCACCCCTCCTTC CGTGTATCCTCTGGCTCCAGGATCCGCCGCTCAG ACAAACTCCATGGTGACCCTGGGTTGCCTGGTGA AGGGCTACTTCCCTGAGCCAGTGACCGTGACTTG GAACTCCGGCTCTCTGTCTTCCGGAGTGCACACA TTTCCAGCCGTGCTGCAGAGCGACCTGTACACAC TGTCCTCCTCCGTGACCGTGCCTTCTTCCACTTG GCCTTCCGAGACCGTGACTTGCAACGTGGCCCAC CCAGCCTCTTCTACCAAGGTGGACAAGAAGATCG TCCCCCGGGATTGCGGTTGCAAGCCTTGCATTTG CACCGTGCCCGAGGTGTCCTCCGTGTTCATCTTC CCTCCCAAGCCTAAGGACGTGCTGACCATCACCC TGACCCCCAAAGTGACTTGCGTGGTGGTGGACAT CTCTAAGGACGACCCCGAGGTGCAGTTCTCTTGG TTCGTGGACGACGTGGAGGTGCACACAGCTCAGA CACAGCCCCGGGAGGAGCAGTTCAACTCCACCTT CCGGAGCGTGTCCGAGCTGCCCATCATGCACCAG GATTGGCTGAACGGCAAGGAGTTCAAGTGCCGCG TGAACAGCGCCGCTTTTCCAGCCCCTATCGAGAA GACCATCTCCAAGACCAAGGGCAGGCCCAAGGCT CCTCAGGTGTACACCATCCCTCCCCCTAAGGAGC AGATGGCCAAGGACAAGGTGTCCCTGACTTGCAT GATCACCGACTTCTTCCCCGAGGACATCACAGTC GAGTGGCAGTGGAACGGCCAGCCAGCCGAGAACT ACAAGAACACCCAGCCCATCATGGATACCGACGG CTCTTACTTCGTGTACTCCAAGCTGAACGTGCAG AAGTCCAATTGGGAGGCCGGCAACACCTTCACTT GCTCCGTGCTGCACGAGGGACTGCATAACCACCA CACCGAGAAGTCCCTGTCCCACTCTCCCGGCAAG 113 JB94H3 CAGGTGCAGCTGCAGCAGAGCGGCGCCGAGGTGA mIgG1 full AGAAGCCCGGCGCCAGCGTGAAGCTGAGCTGCAA heavy chain GGCCAGCGGCTACACCTTCACCAGCTACTGGATG nt CACTGGGTGAGACAGAGACCCGGCCAGGGCCTGG AGTGGATCGGCTACATCAACCCCAGCAGCGGCTA CACCAAGAGCAACCAGAAGTTCAAGGACAGAGCC ACCCTGACCGCCGACACCAGCACCAGCACCGCCT ACATGGAGCTGAGCAGCCTGAGAAGCGAGGACAC CGCCGTGTACTACTGCGGCAGATGGCTGCTGAGC GCCTGGTTCGCCTACTGGGGCCAGGGCACCCTGG TGACCGTGAGCAGCGCCAAGACCACCCCTCCTTC CGTGTATCCTCTGGCTCCAGGATCCGCCGCTCAG ACAAACTCCATGGTGACCCTGGGTTGCCTGGTGA AGGGCTACTTCCCTGAGCCAGTGACCGTGACTTG GAACTCCGGCTCTCTGTCTTCCGGAGTGCACACA TTTCCAGCCGTGCTGCAGAGCGACCTGTACACAC TGTCCTCCTCCGTGACCGTGCCTTCTTCCACTTG GCCTTCCGAGACCGTGACTTGCAACGTGGCCCAC CCAGCCTCTTCTACCAAGGTGGACAAGAAGATCG TCCCCCGGGATTGCGGTTGCAAGCCTTGCATTTG CACCGTGCCCGAGGTGTCCTCCGTGTTCATCTTC CCTCCCAAGCCTAAGGACGTGCTGACCATCACCC TGACCCCCAAAGTGACTTGCGTGGTGGTGGACAT CTCTAAGGACGACCCCGAGGTGCAGTTCTCTTGG TTCGTGGACGACGTGGAGGTGCACACAGCTCAGA CACAGCCCCGGGAGGAGCAGTTCAACTCCACCTT CCGGAGCGTGTCCGAGCTGCCCATCATGCACCAG GATTGGCTGAACGGCAAGGAGTTCAAGTGCCGCG TGAACAGCGCCGCTTTTCCAGCCCCTATCGAGAA GACCATCTCCAAGACCAAGGGCAGGCCCAAGGCT CCTCAGGTGTACACCATCCCTCCCCCTAAGGAGC AGATGGCCAAGGACAAGGTGTCCCTGACTTGCAT GATCACCGACTTCTTCCCCGAGGACATCACAGTC GAGTGGCAGTGGAACGGCCAGCCAGCCGAGAACT ACAAGAACACCCAGCCCATCATGGATACCGACGG CTCTTACTTCGTGTACTCCAAGCTGAACGTGCAG AAGTCCAATTGGGAGGCCGGCAACACCTTCACTT GCTCCGTGCTGCACGAGGGACTGCATAACCACCA CACCGAGAAGTCCCTGTCCCACTCTCCCGGCAAG 114 JB94L1 GACATCCAGATGACCCAGAGCCCCAGCAGCCTGA mkappa full GCGCCAGCGTGGGCGACAGAGTGACCATCACCTG light chain CAAGGCCAGCCAGGACATCAACACCTACCTGAGC nt TGGTTCCAGCAGAAGCCCGGCAAGGCCCCCAAGA GCCTGATCTACAGAAGCAACATCCTGGTGGACGG CGTGCCCAGCAGATTCAGCGGCAGCGGCAGCGGC CAGGACTTCACCCTGACCATCAGCAGCCTGCAGC CCGAGGACTTCGCCATCTACTACTGCCTACAGTA TGATGACTTTCCGTACACGTTCGGCCAGGGCACC AAGCTGGAGATCAAGAGAGCCGACGCCGCTCCTA CAGTGTCTATCTTCCCCCCTTCTTCCGAGCAGCT GACCTCTGGAGGAGCCTCCGTCGTGTGTTTCCTC AACAACTTCTACCCCAAGGACATCAACGTCAAGT GGAAGATCGACGGCTCCGAGAGGCAGAACGGCGT GCTGAACTCTTGGACCGACCAGGACTCCAAGGAC TCCACCTACTCCATGTCCTCCACCCTGACCCTGA CCAAGGACGAGTACGAGCGGCACAACTCCTACAC TTGCGAGGCTACCCACAAGACCTCTACCTCCCCC ATCGTGAAGAGCTTCAACCGCAACGAGTGT 115 JB94L3 GACATCCAGATGACCCAGAGCCCCAGCAGCCTGA mkappa full GCGCCAGCGTGGGCGACAGAGTGACCATCACCTG light chain CAAGGCCAGCCAGGACATCAACACCTACCTGAGC nt TGGTTCCAGCAGAAGCCCGGCAAGAGCCCCAAGA GCCTGATCTACAGAAGCAACATCCTGGTGGACGG CGTGCCCAGCAGATTCAGCGGCAGCGGCAGCGGC CAGGACTACACCCTGACCATCAGCAGCCTGCAGC CCGAGGACTTCGCCATCTACTACTGCCTACAGTA TGATGACTTTCCGTACACGTTCGGCCAGGGCACC AAGCTGGAGATCAAGAGAGCCGACGCCGCTCCTA CAGTGTCTATCTTCCCCCCTTCTTCCGAGCAGCT GACCTCTGGAGGAGCCTCCGTCGTGTGTTTCCTC AACAACTTCTACCCCAAGGACATCAACGTCAAGT GGAAGATCGACGGCTCCGAGAGGCAGAACGGCGT GCTGAACTCTTGGACCGACCAGGACTCCAAGGAC TCCACCTACTCCATGTCCTCCACCCTGACCCTGA CCAAGGACGAGTACGAGCGGCACAACTCCTACAC TTGCGAGGCTACCCACAAGACCTCTACCTCCCCC ATCGTGAAGAGCTTCAACCGCAACGAGTGT 116 JB94H1 CAGGTGCAGCTGGTGCAGAGCGGCGCCGAGGTGA hIgG1mt AGAAGCCCGGCGCCAGCGTGAAGGTGAGCTGCAA full heavy GGCCAGCGGCTACACCTTCACCAGCTACTGGATG chain nt CACTGGGTGAGACAGGCCCCCGGCCAGGGCCTGG AGTGGATGGGCTACATCAACCCCAGCAGCGGCTA CACCAAGAGCAACCAGAAGTTCAAGGACAGAGTG ACCATGACCGCCGACACCAGCACCAGCACCGCCT ACATGGAGCTGAGCAGCCTGAGAAGCGAGGACAC CGCCGTGTACTACTGCGGAAGATGGTTACTTTCG GCCTGGTTTGCTTACTGGGGCCAGGGCACCCTGG TGACCGTGAGCAGCGCTAGCACAAAAGGACCTTC CGTGTTTCCTCTGGCTCCTTCTTCTAAGTCTACC AGCGGAGGAACAGCAGCTCTGGGTTGTCTGGTGA AAGATTACTTCCCAGAGCCAGTGACAGTGTCTTG GAATTCAGGAGCTCTGACATCAGGAGTGCATACA TTTCCAGCAGTGCTGCAGTCTTCAGGTCTGTATT CTCTGTCCTCAGTGGTGACAGTGCCTTCTTCTTC TCTGGGAACCCAGACCTACATCTGTAACGTGAAC
CACAAGCCTTCCAACACCAAGGTGGATAAGAGAG TGGAGCCCAAGTCTTGCGATAAGACCCATACTTG CCCTCCTTGTCCAGCTCCAGAATTTGAAGGAGGA CCATCAGTGTTCCTGTTTCCTCCTAAGCCTAAGG ACACCCTGATGATCTCCCGGACCCCAGAAGTGAC TTGTGTGGTGGTGGACGTGTCTCACGAAGATCCC GAGGTGAAGTTCAATTGGTACGTGGACGGAGTGG AAGTGCATAACGCTAAGACAAAGCCTAGAGAGGA GCAGTACAACTCCACATACAGAGTGGTGTCAGTG CTGACAGTGCTGCATCAGGATTGGCTGAACGGAA AGGAGTACAAGTGCAAGGTGTCTAACAAGGCTCT GCCAGCTTCTATCGAGAAGACCATCTCCAAGGCT AAGGGACAGCCTAGAGAACCTCAGGTGTACACCC TGCCTCCTTCCCGGGAGGAGATGACAAAGAACCA GGTCTCTCTGACTTGTCTGGTGAAGGGCTTTTAC CCTTCCGACATCGCCGTGGAATGGGAATCTAACG GACAGCCAGAGAACAACTACAAGACCACACCTCC AGTGCTGGATTCCGACGGCTCCTTCTTCCTGTAC TCCAAGCTGACCGTGGATAAATCTCGTTGGCAGC AGGGAAACGTGTTCTCTTGTAGCGTGATGCACGA AGCTCTGCACAATCACTACACCCAGAAGTCCCTG TCTCTGTCTCCAGGAAAA 117 JB94H3 CAGGTGCAGCTGCAGCAGAGCGGCGCCGAGGTGA hIgG1mt AGAAGCCCGGCGCCAGCGTGAAGCTGAGCTGCAA full heavy GGCCAGCGGCTACACCTTCACCAGCTACTGGATG chain nt CACTGGGTGAGACAGAGACCCGGCCAGGGCCTGG AGTGGATCGGCTACATCAACCCCAGCAGCGGCTA CACCAAGAGCAACCAGAAGTTCAAGGACAGAGCC ACCCTGACCGCCGACACCAGCACCAGCACCGCCT ACATGGAGCTGAGCAGCCTGAGAAGCGAGGACAC CGCCGTGTACTACTGCGGCAGATGGCTGCTGAGC GCCTGGTTCGCCTACTGGGGCCAGGGCACCCTGG TGACCGTGAGCAGCGCTAGCACAAAAGGACCTTC CGTGTTTCCTCTGGCTCCTTCTTCTAAGTCTACC AGCGGAGGAACAGCAGCTCTGGGTTGTCTGGTGA AAGATTACTTCCCAGAGCCAGTGACAGTGTCTTG GAATTCAGGAGCTCTGACATCAGGAGTGCATACA TTTCCAGCAGTGCTGCAGTCTTCAGGTCTGTATT CTCTGTCCTCAGTGGTGACAGTGCCTTCTTCTTC TCTGGGAACCCAGACCTACATCTGTAACGTGAAC CACAAGCCTTCCAACACCAAGGTGGATAAGAGAG TGGAGCCCAAGTCTTGCGATAAGACCCATACTTG CCCTCCTTGTCCAGCTCCAGAATTTGAAGGAGGA CCATCAGTGTTCCTGTTTCCTCCTAAGCCTAAGG ACACCCTGATGATCTCCCGGACCCCAGAAGTGAC TTGTGTGGTGGTGGACGTGTCTCACGAAGATCCC GAGGTGAAGTTCAATTGGTACGTGGACGGAGTGG AAGTGCATAACGCTAAGACAAAGCCTAGAGAGGA GCAGTACAACTCCACATACAGAGTGGTGTCAGTG CTGACAGTGCTGCATCAGGATTGGCTGAACGGAA AGGAGTACAAGTGCAAGGTGTCTAACAAGGCTCT GCCAGCTTCTATCGAGAAGACCATCTCCAAGGCT AAGGGACAGCCTAGAGAACCTCAGGTGTACACCC TGCCTCCTTCCCGGGAGGAGATGACAAAGAACCA GGTCTCTCTGACTTGTCTGGTGAAGGGCTTTTAC CCTTCCGACATCGCCGTGGAATGGGAATCTAACG GACAGCCAGAGAACAACTACAAGACCACACCTCC AGTGCTGGATTCCGACGGCTCCTTCTTCCTGTAC TCCAAGCTGACCGTGGATAAATCTCGTTGGCAGC AGGGAAACGTGTTCTCTTGTAGCGTGATGCACGA AGCTCTGCACAATCACTACACCCAGAAGTCCCTG TCTCTGTCTCCAGGAAAA 118 66F2A8D6 QVHLQQSGAELAKPGASVNLSCKASGYAFTSYWM mIgG1 full HWVKQRPGQGLEWIGYINPSSGLAKYNQKFKDKA heavy chain TLTTDKSSNTAYMQLSSLTYDDSAVYYCGRWLLS AWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQ TNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHT FPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAH PASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIF PPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSW FVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQ DWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKA PQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITV EWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQ KSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK 119 66F2A8D6 DIKMTQSPSSIYASLGERVTITCKASQGINTYLS mkappa full WFQQKPGKSPKTLIYRANILVDGVPSRFSGSGSG light chain QDYSLTINSLEYEDMGIYYCLQYDEFPYTFGGGT KLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFL NNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKD STYSMSSTLTLTKDEYERHNSYTCEATHKTSTSP IVKSFNRNEC 120 94A12G11F2 QVQLQQSGAELAKPGASVKLSCKASGYTFTSYWM mIgG1 HWVKQRPGQGLEWIGYINPSSGYTKSNQKFKDKA full heavy TLTADKSSSTAYMQLSSLTYEDSAVYYCGRWLLS chain AWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQ TNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHT FPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAH PASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIF PPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSW FVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQ DWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKA PQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITV EWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQ KSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK 121 94A12G11F2 DIRMTQSPSSMYASLGERVTITCKASQDINTYLS mkappa WFQQKPGKSPKSLIYRSNILVDGVPSRFSGSGSG full light QDYSLTISSLEYEDMGIYYCLQYDDFPYTFGGGT chain KLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFL NNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKD STYSMSSTLTLTKDEYERHNSYTCEATHKTSTSP IVKSFNRNEC 122 191C3A8B9 QVQLKESGPGLVAPSQSLSITCTVSGFSLTNYGV mIgG1 HWVRQPPGKGLEWLGVIWAGGSTNYNSALMSRLS full heavy ISKDNSKSQLFLKMNSLQADDTAMYYCARERGSS chain WGTMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAA QTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVH TFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVA HPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFI FPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFS WFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMH QDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPK APQVYTIPPPKEQMAKDKVSLTCMITDFFPEDIT VEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNV QKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPG K 123 191C3A8B9 QIVLTQSPAIMSASPGEKVTMTCSASSRVSYMHW mkappa YQQKSGTSPKRWIYDTSQLASGVPARFSGSGSGT full light SYSLTISSMEAEDAATYYCQQWSSNPYTFGGGTK chain LEMRRADAAPTVSIFPPSSEQLTSGGASVVCFLN NFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDS TYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPI VKSFNRNEC 124 JB94H1 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWM hIgG2 full HWVRQAPGQGLEWMGYINPSSGYTKSNQKFKDRV heavy chain TMTADTSTSTAYMELSSLRSEDTAVYYCGRWLLS AWFAYWGQGTLVTVSSASTKGPSVFPLAPCSRST SESTAALGCLVKDYFPEPVTVSWNSGALTSGVHT FPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVD HKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQF NWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVV HQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQP REPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GK 125 JB94H1 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWM hIgG4 full HWVRQAPGQGLEWMGYINPSSGYTKSNQKFKDRV heavy chain TMTADTSTSTAYMELSSLRSEDTAVYYCGRWLLS AWFAYWGQGTLVTVSSASTKGPSVFPLAPCSRST SESTAALGCLVKDYFPEPVTVSWNSGALTSGVHT FPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVD HKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQ FNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTV LHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQ PREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSD IAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRL TVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLS LGK 126 JB94H3 QVQLQQSGAEVKKPGASVKLSCKASGYTFTSYWM hIgG2 full HWVRQRPGQGLEWIGYINPSSGYTKSNQKFKDRA heavy chain TLTADTSTSTAYMELSSLRSEDTAVYYCGRWLLS AWFAYWGQGTLVTVSSASTKGPSVFPLAPCSRST SESTAALGCLVKDYFPEPVTVSWNSGALTSGVHT FPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVD HKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQF NWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVV HQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQP REPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GK 127 JB94H3 QVQLQQSGAEVKKPGASVKLSCKASGYTFTSYWM hIgG4 full HWVRQRPGQGLEWIGYINPSSGYTKSNQKFKDRA heavy chain TLTADTSTSTAYMELSSLRSEDTAVYYCGRWLLS AWFAYWGQGTLVTVSSASTKGPSVFPLAPCSRST SESTAALGCLVKDYFPEPVTVSWNSGALTSGVHT FPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVD HKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQ FNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTV LHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQ PREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSD IAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRL TVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLS LGK Notes: Unless specified otherwise herein, all amino acid numbers are according to the EU index of the Kabat system (Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242). aa: amino acid, nt: nucleotide.
BRIEF DESCRIPTION OF THE DRAWING
[0260] FIG. 1 shows the binding ability assay of positive clones and soluble huCD73 protein;
[0261] FIG. 2 shows the binding ability assay of the positive clones and the natural CD73 protein;
[0262] FIG. 3 showing the enzyme activity blockage of soluble recombinant human CD73;
[0263] FIG. 4 shows the cell-based enzyme activity blocking experiment;
[0264] FIG. 5 shows CD4+ T cell proliferation reversed by CD73 antibody;
[0265] FIG. 6 shows CD73 enzyme activity of CD4+ T cells blocked by antibody;
[0266] FIG. 7 shows IFN-.gamma. releasing from CD4+ T cells reversed by antibody;
[0267] FIG. 8 shows CD73 endocytosis mediated by CD73 antibody;
[0268] FIG. 9 shows the affinity of humanized antibodies and chimeric antibodies detected by ELISA;
[0269] FIG. 10 shows the affinity of humanized antibodies and chimeric antibodies detected by FACs;
[0270] FIG. 11 shows the 5' exonuclease activity on the cell surface blocked by humanized antibody;
[0271] FIG. 12 shows 5' ectonucleotidase activity of U87-MG cell blocked by humanized antibody;
[0272] FIG. 13 shows CD4+ T cell proliferation reversed by humanized CD73 antibody;
[0273] FIG. 14 shows IFN-.gamma. releasing from CD4+ T cells reversed by humanized CD73 antibody;
[0274] FIG. 15A and FIG. 15B show the inhibitory effect of humanized antibodies against the 5' exonuclease activity of tumors in xenograft animal models;
[0275] FIG. 16 shows the tumor suppression effect of humanized antibody on A375 human melanoma xenograft model.
DETAILED DESCRIPTION
[0276] Described herein are isolated antibodies, particularly monoclonal antibodies, e.g., human monoclonal antibodies, which specifically bind to CD73 and thereby reduce CD73 activity ("antagonist anti-CD73 antibodies"). In certain embodiments, the antibodies described herein are derived from specific heavy and light chain germline sequences and/or comprise specific structural features such as CDR regions comprising specific amino acid sequences. Provided herein are isolated antibodies, methods of preparing such antibodies. Also provided herein are methods of using the antibodies for reducing tumor growth, alone or in combination with other therapeutic agents (e.g., antibodies) and/or cancer therapies. Accordingly, the anti-CD73 antibodies described herein may be used in a treatment of a wide variety of therapeutic applications, including, for example, inhibition of tumor growth, inhibition of metastasis, and enhancement of an immune response against a tumor.
Definitions
[0277] In order that the present description may be more readily understood, certain terms are firstly defined. Additional definitions are set forth throughout the detailed description.
[0278] The term "Cluster of Differentiation 73" or "CD73" as used herein refers to an enzyme (nucleotidase) capable of converting extracellular nucleoside 5' monophosphates to nucleosides, namely converting adenosine monophosphate (AMP) to adenosine. CD73 is usually found as a dimer anchored to the cell membrane through a glycosylphosphatidylinositol (GPI) bond, has ecto-enzyme activity and plays a role in signal transduction. The primary function of CD73 is converting extracellular nucleotides (e.g., 5'-AMP) to adenosine, which is a highly immunosuppressive molecule. Thus, ecto-5'-nucleotidase catalyzes the dephosphorylation of purine and pyrimidine ribo- and deoxyribonucleoside monophosphates to the corresponding nucleoside. Although CD73 has broad substrate specificity, it prefers purine ribonucleosides.
[0279] CD73 is also referred to as ecto-5'nuclease (ecto-5'NT, EC 3.1.3.5). The term "CD73" includes any variants or isoforms of CD73 which are naturally expressed by cells. Accordingly, antibodies described herein may cross-react with CD73 from species other than human (e.g., cynomolgus CD73). Alternatively, the antibodies may be specific for human CD73 and may not exhibit any cross-reactivity with other species. CD73 or any variants and isoforms thereof, may either be isolated from cells or tissues which naturally express them or be recombinantly produced using well-known techniques in the art and/or those described herein.
[0280] Two isoforms of human CD73 have been identified, both of which share the same N-terminal and C-terminal portions. Isoform 1 (Accession No. NP_002517.1; SEQ ID NO: 1) represents the longest protein, consisting of 574 amino acids and 9 exons. Isoform 2 (Accession No. NP_001191742.1) encodes a shorter protein, consisting of 524 amino acids, lacking amino acids 404-453. Isoform 2 lacks an alternate in-frame exon, resulting in a transcript with only 8 exons, but with the same N- and C-terminal sequences.
[0281] The cynomolgus (cyno) CD73 protein sequence is provided as SEQ ID NO: 2. The terms cynomolgus and cyno both refer to the Macaca fascicularis species and are used interchangeably throughout the description.
[0282] The term "antibody" as used herein may include whole antibodies and any antigen binding fragments (i.e., "antigen-binding portions") or single chains thereof. An "antibody" refers, in one embodiment, to a glycoprotein or an antigen binding portion thereof comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region. In some certain naturally occurring IgG, IgD and IgA antibodies, the heavy chain constant region is comprised of three domains, CH1, CH2 and CH3. In some certain naturally occurring antibodies, each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region. The light chain constant region is comprised of one domain, CL. The VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), and regions that are more conserved, termed framework regions (FR), both of which are intermingled arrangement. Herein, the CDRs of the VH region are abbreviated as HCDR, that is, the three CDRs of the VH region can be abbreviated as HCDR1, HCDR2, and HCDR3; the CDRs of the VL region are abbreviated as LCDR, that is, the three CDRs of the VL region can be abbreviated as LCDR1, LCDR2. LCDR3. Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component of the classical complement system (C1q).
[0283] The heavy chain of an antibody may or may not contain a terminal lysine (K), or a terminal glycine and lysine (GK). Thus, any of the heavy chain sequences and heavy chain constant region sequences provided herein can end in either GK or K, or lack K or GK, regardless of what the last amino acid of the sequence provides. This is because the terminal lysine and sometimes glycine and lysine are cleaved during expression of the antibody.
[0284] Antibodies typically bind specifically to their cognate antigen with high affinity, reflected by a dissociation constant (K.sub.D) of 10.sup.-7 to 10.sup.-11 M or less. Any K.sub.D greater than about 10.sup.-6 M is generally considered to indicate binding nonspecifically. As used herein, an antibody that "binds specifically" to an antigen refers to an antibody that binds to the antigen and substantially identical antigens with high affinity, which means having a K.sub.D of 10.sup.-7 M or less, preferably 10.sup.-8 M or less, even more preferably 5.times.10.sup.-9 M or less, and most preferably between 10.sup.-8 M and 10.sup.-10 M or less, but does not bind with high affinity to unrelated antigens. An antigen is "substantially identical" to a given antigen if it exhibits a high degree of sequence identity to the given antigen, for example, if it exhibits at least 80%, at least 90%, at least 95%, at least 97%, or at least 99% or greater sequence identity to the sequence of the given antigen. By way of example, an antibody that binds specifically to human CD73 may also cross-react with CD73 from some non-human primate species (e.g., cynomolgus), but may not cross-react with CD73 from other species, or with an antigen other than CD73.
[0285] An immunoglobulin may be from any of the commonly known isotypes, including but not limited to IgA, secretory IgA, IgG and IgM. The IgG isotype is divided in subclasses in some species: IgG1, IgG2, IgG3 and IgG4 in humans, and IgG1, IgG2a, IgG2b and IgG3 in mice. In certain embodiments, the anti-CD73 antibodies described herein are of the human IgG1 or IgG2 subtype. Immunoglobulins, e.g., human IgG1, exist in several allotypes, which differ from each other in at most a few amino acids. "Antibody" may include, by way of example, both naturally occurring and non-naturally occurring antibodies; monoclonal and polyclonal antibodies; chimeric and humanized antibodies; human and nonhuman antibodies; wholly synthetic antibodies; and single chain antibodies.
[0286] The term "antigen-binding portion" of an antibody, as used herein, refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., human CD73). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody. Examples of binding fragments encompassed within the term "antigen-binding portion" of an antibody, e.g., an anti-CD73 antibody described herein, include (i) a Fab fragment, which is a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab').sub.2 fragment, which is a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR) or (vii) a combination of two or more isolated CDRs which may optionally be linked by a synthetic linker. Furthermore, although the two domains of the Fv fragment, VL and VH, are encoded by different genes, they can be linked, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules known as single chain Fv (scFv); see e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883). Such single chain antibodies are also intended to be encompassed within the term "antigen-binding portion" of an antibody. These and other potential constructs are described at Chan & Carter (2010) Nat. Rev. Immunol. 10:301. These antibody fragments are obtained using conventional techniques known to those with skill in the art, and the fragments are screened for utility in the same manner as intact antibodies. Antigen-binding portions can be produced by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact immunoglobulins.
[0287] The term "amino acid sequence of conservative modifications form" refers to the amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody containing the amino acid sequence, and the modifications include amino acid substitutions, additions and deletions. Modifications can be introduced into an antibody of the invention by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, one or more amino acid residues within the CDR regions of an antibody of the invention can be replaced with other amino acid residues from the same side chain family and the altered antibody can be tested for retained function using the functional assays described herein. Preferably, the conservative modifications are no more than one or two in number.
[0288] A "bispecific" or "bifunctional antibody" is an artificial hybrid antibody having two different heavy/light chain pairs, giving rise to two antigen binding sites with specificity for different antigens. Bispecific antibodies can be produced by a variety of methods including fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsivilai & Lachmann, Clin. Exp. Immunol. 79:315-321 (1990); Kostelny et al., J. Immunol. 148, 1547-1553 (1992).
[0289] The term "monoclonal antibody," as used herein, refers to an antibody that displays a single binding specificity and affinity for a specific epitope or a composition of antibodies in which all antibodies display a single binding specificity and affinity for a specific epitope. Typically such monoclonal antibodies will be derived from a single antibody encoding cell or nucleic acid, and will be propagated without intentionally introducing any sequence alterations. Accordingly, the term "human monoclonal antibody" refers to a monoclonal antibody that has variable and optional constant regions derived from human germline immunoglobulin sequences. In one embodiment, human monoclonal antibodies are produced by a hybridoma, for example, obtained by fusing a B cell derived from a transgenic or transchromosomal non-human animal (e.g., a transgenic mouse having a genome comprising a human heavy chain transgene and a light chain transgene), with an immortalized cell.
[0290] The term "recombinant human antibody," as used herein, includes all human antibodies that are prepared, expressed, produced or isolated by recombinant means, such as (a) antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom, (b) antibodies isolated from a host cell transformed to express the antibody, e.g., from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial human antibody library, and (d) antibodies prepared, expressed, produced or isolated by any other means that involve splicing of human immunoglobulin gene sequences to other DNA sequences. Such recombinant human antibodies comprise variable and constant regions that utilize specific human germline immunoglobulin sequences and are encoded by the germline genes, but include subsequent rearrangements and mutations that occur, for example, during antibody maturation. As known in the art (see, e.g., Lonberg (2005) Nature Biotech. 23(9): 1117-1125), the variable region contains the antigen binding domain, which is encoded by various genes that rearrange to form an antibody specific for a exogenous antigen. In addition to rearrangement, the variable region can be further modified by multiple single amino acid changes (referred to as somatic mutation or hypermutation) to increase the affinity of the antibody to the exogenous antigen. The constant region will change in further response to an antigen (i.e., isotype switch). Therefore, the rearranged and somatically mutated nucleic acid sequences that encode the light chain and heavy chain immunoglobulin polypeptides in response to an antigen may not be identical to the original germline sequences, but instead will be substantially identical or similar (i.e. , have at least 80% identity).
[0291] A "human" antibody (HuMAb) refers to an antibody having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences. Furthermore, if the antibody contains a constant region, the constant region is also derived from human germline immunoglobulin sequences. The antibodies described herein may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo). However, the term "human antibody", as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences. The terms "human" antibodies and "fully human" antibodies are used synonymously.
[0292] A "humanized" antibody refers to an antibody in which some, most or all of the amino acids outside the CDR domains of a non-human antibody are replaced with corresponding amino acids derived from human immunoglobulins. In one embodiment of an antibody in humanized form, some, most or all of the amino acids outside the CDR domains have been replaced with amino acids from human immunoglobulins, whereas some, most or all amino acids within one or more CDR regions are unchanged. Small additions, deletions, insertions, substitutions or modifications of amino acids are permissible as long as they do not abrogate the ability of the antibody to bind to a specific antigen. A "humanized" antibody retains an antigenic specificity similar to that of the original antibody.
[0293] A "chimeric antibody" refers to an antibody in which the variable regions are derived from one species and the constant regions are derived from another species, such as an antibody in which the variable regions are derived from a mouse antibody and the constant regions are derived from a human antibody.
[0294] A "modified heavy chain constant region" refers to a heavy chain constant region comprising the constant domains CH1, hinge, CH2, and CH3, wherein one or more of the constant domains are from a different isotype (e.g. IgG1, IgG2, IgG3, IgG4). In some embodiments, the modified constant region includes a human IgG2 CH1 domain and a human IgG2 hinge fused to a human IgG1 CH2 domain and a human IgG1 CH3 domain. In certain embodiments, such modified constant regions also include amino acid modifications within one or more of the domains relative to the wildtype amino acid sequence.
[0295] As used herein, "isotype" refers to the antibody class (e.g., IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE antibody) that is encoded by the heavy chain constant region genes.
[0296] "Allotype" refers to naturally occurring variants in a specific isotype group, which variants differ in a few amino acids (see, e.g., Jefferis et al. (2009) mAbs 1: 1). Antibodies described herein may be of any allotype.
[0297] Unless specified otherwise herein, all amino acid numbers are according to the EU index of the Kabat system (Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
[0298] The terms "an antibody recognizing an antigen" and "an antibody specific for an antigen" are used interchangeably herein with the term "an antibody which binds specifically to an antigen."
[0299] The term "an isolated antibody," as used herein, is intended to refer to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds to CD73 is substantially free of antibodies that specifically bind antigens other than CD73). An isolated antibody that specifically binds to an epitope of CD73 may, however, have cross-reactivity to other CD73 proteins from different species.
[0300] As used herein, an antibody that "inhibits CD73" refers to an antibody that inhibits a biological and/or enzymatic function of CD73. These functions include, for example, the ability of an antibody to inhibit CD73 enzymatic activity, e.g., CD73-regulated production of adenosine or reduction of cAMP production.
[0301] As used herein, an antibody that "internalizes" refers to an antibody that crosses the cell membrane upon binding to a cell-surface antigen. Internalization includes antibody mediated receptor, e.g., CD73, internalization. In some embodiments, the antibody "internalizes" into cells expressing CD73 at a rate of T.sub.1/2 equal to about 10 min or less.
[0302] An "effector function" refers to the interaction of an antibody Fc region with an Fc receptor or ligand, or a biochemical event that results therefrom. Exemplary "effector functions" include C1q binding, complement dependent cytotoxicity (CDC), Fc receptor binding, Fc.gamma.R-mediated effector functions such as ADCC and antibody dependent cell-mediated hagocytosis (ADCP), and downregulation of a cell surface receptor (e.g., the B cell receptor; BCR). Such effector functions generally require the Fc region to be combined with a binding domain (e.g., an antibody variable domain).
[0303] An "Fc receptor" or "FcR" is a receptor that binds to the Fc region of an immunoglobulin. FcRs that bind to an IgG antibody comprise receptors of the Fc.gamma.R family, including allelic variants and alternatively spliced forms of these receptors. The Fc.gamma.R family consists of three activating receptors (Fc.gamma.RI, Fc.gamma.RIII, and Fc.gamma.RIV in mice; Fc.gamma.RIA, Fc.gamma.RIIA, and Fc.gamma.RIIIA in humans) and one inhibitory receptor (Fc.gamma.RIIB). Various properties of human Fc.gamma.Rs are summarized in Table A. The majority of innate effector cell types coexpress one or more activating Fc.gamma.R and the inhibitory Fc.gamma.RIIB, whereas natural killer (NK) cells selectively express one activating Fc receptor (Fc.gamma.RIII in mice and Fc.gamma.RIIIA in humans) but does not express the inhibitory Fc.gamma.RIIB in mice and humans. Human IgG1 binds to most human Fc receptors and is considered that the types of activating Fc receptors which it binds to are equivalent to murine IgG2a.
TABLE-US-00002 TABLE A Characteristics of human Fc.gamma.Rs Allelic Affinity for Isotype Fc.gamma. variants human IgG preference Cellular distribution Fc.gamma.RI None High (K.sub.D IgG1 = 3 > 4 >> 2 Monocytes, macrophages, described ~10 nM) activated neutrophils, dentritic cells Fc.gamma.RIIA H131 Low to IgG1 > 3 > 2 > 4 Neutrophils, monocytes, medium macrophages, eosinophils, R131 Low IgG1 > 3 > 4 > 2 dentritic cells, platelets Fc.gamma.RIIIA V158 Medium IgG1 = 3 >> 4 > 2 NK cell, monocytes, F158 Low IgG1 = 3 >> 4 > 2 macrophages, mast cells, eosinophils, dentritic cell Fc.gamma.RIIB I232 Low IgG1 = 3 = 4 > 2 B cells, monocytes, T232 Low IgG1 = 3 = 4 > 2 macrophages, dentritic cells, mast cells
[0304] A "hinge", "hinge domain" or "hinge region" or "antibody hinge region" refers to the domain of a heavy chain constant region that links the CH1 domain to the CH2 domain and includes the upper, middle, and lower portions of the hinge (Roux et al. J. Immunol. 1998 161:4083). The hinge provides varying levels of flexibility between the binding and effector regions of an antibody and also provides sites for intermolecular disulfide bonding between the two heavy chain constant regions. The term "hinge" includes wildtype hinges, as well as variants thereof (e.g., non-naturally-occurring hinges or modified hinges). For example, the term "IgG2 hinge" includes wildtype IgG2 hinge, and variants having 1, 2, 3, 4, 5, 1-3, 1-5, 3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions, deletions or additions.
[0305] The term "CH1 domain" refers to the heavy chain constant region linking the variable domain to the hinge in a heavy chain constant domain. The term "CH1 domain" includes wildtype CH1 domains, as well as variants thereof (e.g., non-naturally-occurring CH1 domains or modified CH1 domains). For example, the term "CH1 domain" includes wildtype CH1 domains and variants thereof having 1, 2, 3, 4, 5, 1-3, 1-5, 3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions, deletions or additions.
[0306] Exemplary CH1 domains include CH1 domains with mutations that change a biological activity of an antibody, such as ADCC, CDC or half-life period. Modifications to the CH1 domain that affect a biological activity of an antibody are provided herein.
[0307] The term "CH2 domain" refers to the heavy chain constant region linking the hinge in a heavy chain constant domain to the CH3 domain. The term "CH2 domain" includes wildtype CH2 domains, as well as variants thereof (e.g., non-naturally-occurring CH2 domains or modified CH2 domains). For example, the term "CH2 domain" includes wildtype CH2 domains and variants thereof having 1, 2, 3, 4, 5, 1-3, 1-5, 3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions, deletions or additions. Exemplary CH2 domains include CH2 domains with mutations that change a biological activity of an antibody, such as ADCC, CDC or half-life.
[0308] The term "CH3 domain" refers to the heavy chain constant region that is C-terminal to the CH2 domain in a heavy chain constant domain. The term "CH3 domain" includes wildtype CH3 domains, as well as variants thereof (e.g., non-naturally-occurring CH3 domains or modified CH3 domains). For example, the term "CH3 domain" includes wildtype CH3 domains and variants thereof having 1, 2, 3, 4, 5, 1-3, 1-5, 3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions, deletions or additions. Exemplary CH3 domains include CH3 domains with mutations that change a biological activity of an antibody, such as ADCC, CDC or half-life. Modifications to the CH3 domain that affect a biological activity of an antibody are provided herein.
[0309] A "CL domain" refers to the constant domain of a light chain. The term "CL domain" includes wildtype CL domains and variants thereof.
[0310] A "native sequence Fc region" or "native sequence Fc" comprises an amino acid sequence that is identical to the amino acid sequence of an Fc region found in nature. Native sequence human Fc regions include a native sequence human IgG1 Fc region; native sequence human IgG2 Fc region; native sequence human IgG3 Fc region; and native sequence human IgG4 Fc region as well as naturally occurring variants thereof. Native sequence Fc includes the various allotypes of Fcs (see, e.g., Jefferis et al. (2009) mAbs 1: 1).
[0311] The term "epitope" or "antigenic determinant" refers to a site on an antigen (e.g., CD73) to which an immunoglobulin or antibody specifically binds. Epitopes within protein antigens can be formed both from contiguous amino acids (usually a linear epitope) or noncontiguous amino acids juxtaposed by tertiary folding of the protein (usually a conformational epitope). Epitopes formed from contiguous amino acids are typically, but not always, retained when exposing to denaturing solvents, whereas epitopes formed by tertiary folding are typically lost when treating with denaturing solvents. An epitope typically includes at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids in a unique spatial conformation. Methods for determining what epitopes are bound by a given antibody (i.e., epitope mapping) are well known in the art and include, for example, immunoblotting and immunoprecipitation analysis, wherein overlapping or contiguous peptides (e.g., from CD73) are tested for reactivity with a given antibody (e.g., anti-CD73 antibody). Methods of determining spatial conformation of epitopes include techniques in the art and those described herein, for example, x-ray crystallography, 2-dimensional nuclear magnetic resonance and HDX-MS (see, e.g., Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, G. E. Morris, Ed. (1996)).
[0312] The term "epitope mapping" refers to the process of identification of the molecular determinants on the antigen involved in antibody-antigen recognition.
[0313] The term "binds to the same epitope" with reference to two or more antibodies means that the antibodies bind to the same segment of amino acid residues, as determined by a given method. Techniques for determining whether antibodies bind to the "same epitope on CD73" of the antibodies described herein include, for example, epitope mapping methods, such as, x-ray analyses of crystals of antigen: antibody complexes, which provide atomic resolution of the epitope, and hydrogen/deuterium exchange mass spectrometry (HDX-MS). Other methods that monitor the binding of the antibody to antigen fragments (e.g. proteolytic fragments) or to mutated variations of the antigen where loss of binding due to a modification of an amino acid residue in the antigen sequence is often considered an indication of an epitope component (e.g. alanine scanning mutagenesis--Cunningham & Wells (1985) Science 244: 1081). In addition, computational combinatorial methods for epitope mapping can also be used. These methods rely on the ability of the antibody of interest from combinatorial phage display peptide libraries to affinity isolate specific short peptides.
[0314] Antibodies that "compete with another antibody for binding to a target" refer to antibodies that inhibit (partially or completely inhibit) the binding of another antibody to the target. Whether the two antibodies compete with each other for binding to a target, i.e., whether and to what extent one antibody inhibits the binding of another antibody to a target, may be determined using known competition experiments, such as those described in the Examples. In certain embodiments, an antibody competes with another antibody, and inhibit at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100% of the binding. The extent of inhibition or competition may be different depending on which antibody is the "blocking antibody" (i.e., the cold antibody that is incubated first with the target). Competition assays can be conducted as described, for example, in Ed Harlow and David Lane, Cold Spring Harb Pro toe; 2006; doi: 10.1101/pdb.prot4277 or in Chapter 11 of "Using Antibodies" by Ed Harlow and David Lane, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., USA 1999. Competing antibodies bind to the same epitope, the overlapping epitope or the adjacent epitopes (e.g., as evidenced by steric hindrance).
[0315] Other competitive binding assays include: solid phase direct or indirect radioimmunoassay (RIA), solid phase direct or indirect enzyme immunoassay (EIA), sandwich competition assay (see Stahli et al., Methods in Enzymology 9:242 (1983)); solid phase direct biotin-avidin EIA (see Kirkland et al., J. Immunol. 137:3614 (1986)); solid phase direct labeled assay, solid phase direct labeled sandwich analysis (see Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Press (1988)); solid phase direct label RIA using I-125 label (see Morel et al., Mol. Immunol. 25(1):7 (1988)); solid phase direct biotin-avidin EIA (Cheung et al., Virology 176:546 (1990)); and direct labeled RIA. (Moldenhauer et al., Scand. J. Immunol. 32:77 (1990)).
[0316] As used herein, the terms "specific binding," "selective binding," "selectively binds," and "specifically binds," refer to antibody binding to an epitope on a predetermined antigen but not to other antigens. Typically, the antibody (i) binds with an equilibrium dissociation constant (KD) of approximately less than 10.sup.-7M, such as approximately less than 10.sup.-8M, 10.sup.-9M or 10.sup.-10M or even lower when determined by, e.g., surface plasmon resonance (SPR) technology in a BIACORE.RTM. 2000 surface plasmon resonance instrument using the predetermined antigen, e.g., recombinant human CD73, as the analyte and the antibody as the ligand, or Scatchard analysis of binding of the antibody to antigen positive cells, and (ii) binds to the predetermined antigen with an affinity that is at least two-times greater than its affinity for binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely-related antigen. Accordingly, unless otherwise indicated, an antibody that "specifically binds to human CD73" refers to an antibody that binds to soluble or cell bound human CD73 with a KD of 10.sup.-7M or less, such as approximately less than 10.sup.-8M, 10.sup.-9M or 10.sup.-10M or even lower. An antibody that "cross-reacts with cynomolgus CD73" refers to an antibody that binds to cynomolgus CD73 with a KD of 10.sup.-7M or less, such as less than 10.sup.-8M, 10.sup.-9M or 10.sup.-10M or even lower. In certain embodiments, antibodies that do not cross-react with CD73 from a non-human species exhibit essentially undetectable binding against these proteins in standard binding assays.
[0317] The term "Kassoc" or "Ka", as used herein, is intended to refer to the association rate constant of a specific antibody-antigen interaction, whereas the term "Kdis" or "Kd" as used herein, is intended to refer to the dissociation rate constant of a specific antibody-antigen interaction. The term "K.sub.D", as used herein, is intended to refer to the equilibrium dissociation constant, which is obtained from the ratio of Kd to Ka (i.e,. Kd/Ka) and is expressed as a molar concentration (M). K.sub.D values of antibodies can be determined using methods well established in the art. A preferred method for determining the K.sub.D of an antibody is to analyze by using surface plasmon resonance, preferably using a biosensor system such as a Biacore.RTM. surface plasmon resonance system or flow cytometry and Scatchard.
[0318] The term "EC50" in the context of an in vitro or in vivo assay using an antibody or antigen binding fragment thereof refers to the concentration of an antibody or an antigen-binding portion thereof that induces a response that is 50% of the maximal response, i.e., halfway between the maximal response and the baseline.
[0319] A "rate of internalization" of an antibody or of a receptor, e.g., CD73, as mediated by the antibody, e.g., an anti-CD73 antibody, may be represented, e.g., by T.sub.1/2 of internalization, e.g., as shown in the Examples. A rate of internalization of an anti-CD73 antibody may be enhanced or increased by at least 10%, 30%, 50%, 75%, 2 times, 3 times, 5 times or more, resulting in a reduction of the T.sub.1/2 by at least 10%, 30%, 50%, 75%, 2 times, 3 times, 5 times or more by changing the heavy chain constant region of the antibody to a modified heavy chain constant region, e.g., one that contains an IgG2 hinge and IgG2 CH1 domain. For example, instead of having a T.sub.1/2 of 10 minutes, a modified heavy chain constant region may increase the rate of internalization and thereby reduce the T.sub.1/2 to 5 minutes (i.e., a two times increase in rate of internalization or a two times decrease in T.sub.1/2). "T.sub.1/2" is defined as the time at which half of the maximal internalization is achieved, as measured from the time that the antibody is added to the cells. The maximal level of internalization can be the level of internalization at the plateau of a graph representing the internalization plotted against antibody concentrations. A modified heavy chain constant region may increase the maximal level of internalization of an antibody by at least 10%, 30%, 50%, 75%, 2 times, 3 times, 5 times or more. Another way of comparing internalization efficacies of different antibodies, such as an antibody with, and the same antibody without, a modified heavy chain constant region, is by comparing their level of internalization at a given antibody concentration (e.g., 100 nM) or at a given time (e.g., 2 minutes, 5 minutes, 10 minutes or 30 minutes). Comparing levels of internalization can also be done by comparing the EC50 levels of internalization.
[0320] The term "naturally-occurring" as used herein as applied to an object refers to the fact that an object can be found in nature. For example, a polypeptide or polynucleotide sequence that is present in an organism (including viruses) that can be isolated from a source in nature and which has not been intentionally modified by man in the laboratory is naturally-occurring.
[0321] A "polypeptide" refers to a chain comprising at least two consecutively linked amino acid residues, with no upper limit on the length of the chain. One or more amino acid residues in the protein may contain a modification such as, but not limited to, glycosylation, phosphorylation or a disulfide bond. A "protein" may comprise one or more polypeptides.
[0322] The term "nucleic acid molecule," as used herein, is intended to include DNA molecules and RNA molecules. A nucleic acid molecule may be a single chain or a double chain, and may be cDNA. Also provided are "conservative sequence modifications" of the sequences set forth in SEQ ID NOs described herein, i.e., nucleotide and amino acid sequence modifications which do not abrogate the binding of the antibody encoded by the nucleotide sequence or containing the amino acid sequence to the antigen. Such conservative sequence modifications include conservative nucleotide and amino acid substitutions, as well as, nucleotide and amino acid additions and deletions. For example, modifications can be introduced into SEQ ID NOs described herein by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis. Conservative sequence modifications include conservative amino acid substitutions, in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, a predicted nonessential amino acid residue in an anti-CD73 antibody is preferably replaced with another amino acid residue from the same side chain family. Methods of identifying nucleotide and amino acid conservative substitutions that do not eliminate antigen binding are well-known in the art (see, e.g., Brummell et al., Biochem. 32: 1180-1187 (1993); Kobayashi et al. Protein Eng. 12(10):879-884 (1999); and Burks et al. Proc. Natl. Acad. Sci. USA 94:412-417 (1997)). Alternatively, in another embodiment, mutations can be introduced randomly along all or part of an anti-CD73 antibody encoding sequence, such as by saturation mutagenesis, and the resulting modified anti-CD73 antibodies can be screened through improved binding activity.
[0323] For nucleic acids, the term "substantial identity " indicates that two nucleic acids, or designated sequences thereof, when optimally aligned and compared, are identical, with appropriate nucleotide insertions or deletions, in at least about 80% of the nucleotides, usually at least about 90% to 95%, and more preferably at least about 98% to 99.5% of the nucleotides. Alternatively, substantial identity exists when the segments will hybridize under selective hybridization conditions, to the complement of the chain.
[0324] For polypeptides, the term "substantial identity" indicates that two polypeptides, or designated sequences thereof, when optimally aligned and compared, are identical, with appropriate amino acid insertions or deletions, in at least about 80% of the amino acids, usually at least about 90% to 95%, and more preferably at least about 98% to 99.5% of the amino acids.
[0325] The identity % between two sequences is a function of the number of identical positions shared by the sequences when the sequences are optimally aligned (i.e., identity %=number of identical positions/total number of positions.times.100), with optimal alignment determined taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, as described in the non-limiting examples below.
[0326] The percent identity between two nucleotide sequences can be determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6. The percent identity between two nucleotide or amino acid sequences can also be determined using the algorithm of E. Meyers and W. Miller (CABIOS, 4: 11-17 (1989)) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. In addition, the percent identity between two amino acid sequences can be determined using the algorithm of Needleman and Wunsch (J. Mol. Biol. (48):444-453 (1970)) which has been incorporated into the GAP program in the GCG software package (available at http://www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
[0327] The nucleic acid and protein sequences described herein can further be used as a "query sequence" to perform searches against public databases to, for example, identify related sequences. Such searches can be performed with the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10. BLAST nucleotide searches can be performed with the NBLAST program, score=100, wordlength=12 to obtain nucleotide sequences identical to the nucleic acid molecules described herein. BLAST protein searches can be performed with the XBLAST program, score=50, wordlength=3 to obtain amino acid sequences identical to the protein molecules described herein. To obtain gapped alignments for comparison purposes, Gapped BLAST can be used as described in Altschul et al., (1997) Nucleic Acids Res. 25(17):3389-3402. When using BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used. See www.ncbi.nlm.nih.gov.
[0328] These nucleic acids may be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form. The nucleic acid is "isolated" or "rendered substantially pure" when purified away from other cellular components or other contaminants, e.g., other cellular nucleic acids (e.g., the other parts of the chromosome) or proteins, by standard techniques including alkaline/SDS treatment, CsCl banding, column chromatography, agarose gel electrophoresis and others well known in the art. See, F. Ausubel, et al., ed. Current Protocols in Molecular Biology, Greene Publishing and Wiley Interscience, New York (1987).
[0329] Nucleic acids, e.g., cDNA, may be mutated in accordance with standard techniques to provide gene sequences. For encoding sequences, these mutations may affect amino acid sequence as desired. Specifically, DNA sequences substantially identical to or derived from native V, D, J, constant, switches and other such sequences described herein are contemplated.
[0330] The term "vector," as used herein, is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is "plasmid," which refers to a circular double chains DNA loop into which other DNA segments may be linked. Another type of vector is viral vector, wherein other DNA segments may be linked into the viral genome. Some vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) can be integrated into the genome of a host cell when introduced into the host cell, and thereby are replicated along with the host genome. Moreover, some vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as "recombinant expression vectors" (or simply, "expression vectors"). In general, expression vectors used in recombinant DNA techniques are often in the form of plasmids. In the present description, "plasmid" and "vector" may be used interchangeably as the plasmid is the most commonly used form of vector. However, also included are other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
[0331] The term "recombinant host cell" (or simply "host cell"), as used herein, is intended to refer to a cell that comprises a nucleic acid that is not naturally present in the cell, and may be a cell into which a recombinant expression vector has been introduced. It should be understood that such terms are intended to refer not only to the specific subject cell but to the progeny of such a cell. Since certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term "host cell" as used herein.
[0332] As used herein, the term "antigen" refers to any natural or synthetic immunogenic substance, such as a protein, peptide, or hapten. An antigen may be CD73 or a fragment thereof.
[0333] An "immune response" refers to a biological response in a vertebrate for exogenous agents, such response protects the organism against these agents and diseases caused by them. An immune response is mediated by the action of a cell of the immune system (for example, a T lymphocyte, B lymphocyte, natural killer (NK) cell, macrophage, eosinophil, mast cell, dendritic cell or neutrophil) and soluble macromolecules produced by any of these cells or the liver (including antibodies, cytokines, and complement), the action results in selective targeting, binding to, damage to, destruction of, and/or elimination from the vertebrate's body of invading pathogens, cells or tissues infected with pathogens, cancerous or other abnormal cells, or, in cases of autoimmunity or pathological inflammation, normal human cells or tissues. An immune response or reaction includes, e.g., activation or inhibition of a T cell, e.g., an effector T cell or a Th cell, such as a CD4+ or CD8+ T cell, or inhibition of a Treg cell.
[0334] An "immunomodulator" or "immunoregulator" refers to an agent, e.g., a component of a signaling pathway, which may be involved in modulating, regulating, or modifying an immune response. "Modulating," "regulating," or "modifying" an immune response refers to any changes in a cell of the immune system or in the activity of such cell (e.g., an effector T cell). Such modulation includes stimulation or suppression of the immune system which may be manifested by an increase or decrease in the number of various cell types, an increase or decrease in the activity of these cells, or any other changes which can occur within the immune system. Both inhibitory and stimulatory immunomodulators have been identified, some of which may have enhanced function in a tumor microenvironment. The immunomodulator may be located on the surface of a T cell. An "immunomodulatory target" or "immunoregulatory target" is an immunomodulator that is targeted for binding by, and whose activity is altered by the binding of, a substance, agent, moiety, compound or molecule. Immunomodulatory targets include, for example, receptors on the surface of a cell ("immunomodulatory receptors") and receptor ligands ("immunomodulatory ligands").
[0335] An increased ability of stimulating an immune response, or the immune system can result from an enhanced agonist activity of T cell co-stimulatory receptors and/or an enhanced antagonist activity of inhibitory receptors. An increased ability of stimulating an immune response or the immune system may be reflected by a time increase of the EC50 or maximal level of activity in an assay that measures an immune response, e.g., an assay that measures changes in cytokine or chemokine release, cytolytic activity (determined directly on target cells or indirectly via detecting CD 107a or granzymes) and proliferation. The ability of stimulating an immune response or the immune system activity may be enhanced by at least 10%, 30%, 50%, 75%, 2 times, 3 times, 5 times or more.
[0336] "Immunotherapy" refers to the treatment of a subject afflicted with, or at risk of contracting or suffering a recurrence of, a disease by a method comprising inducing, enhancing, suppressing or otherwise modifying an immune response.
[0337] "Immuno stimulating therapy" or "immuno stimulatory therapy" refers to a therapy that results in increasing (inducing or enhancing) an immune response in a subject for, e.g., treating cancer.
[0338] "Potentiating an endogenous immune response" means increasing the effectiveness or potency of an existing immune response in a subject. This increase in effectiveness and potency may be achieved, for example, by overcoming mechanisms that suppress the endogenous host immune response or by stimulating mechanisms that enhance the endogenous host immune response.
[0339] "T effector" ("Teff") cells refers to T cells (e.g., CD4+ and CD8+ T cells) as well as T helper (Th) cells with cytolytic activities, which secrete cytokines and activate and direct other immune cells, but does not include regulatory T cells (Treg cells).
[0340] As used herein, the term "linkage" refers to the association of two or more molecules. The linkage can be covalent or non-covalent. The linkage also can be genetic (i.e., recombinantly fused). Such linkages can be achieved using a wide variety of art recognized techniques, such as chemical coupling and recombinant protein production.
[0341] As used herein, "administering" refers to the physical introduction of a composition comprising a therapeutic agent to a subject, using any of the various methods and delivery systems known to those skilled in the art. Preferred routes of administration for antibodies described herein include intravenous, intraperitoneal, intramuscular, subcutaneous, spinal or other parenteral routes of administration, for example by injection or infusion. The phrase "parenteral administration" as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, but not limited, intravenous, intraperitoneal, intramuscular, intraarterial, intrathecal, intralymphatic, intralesional, intracapsular, intraorbital, intracardiac, intradermal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion, as well as in vivo electroporation. Alternatively, an antibody described herein can be administered via a non-parenteral route, such as a topical, epidermal or mucosal route of administration, for example, intranasally, orally, vaginally, rectally, sublingually or topically. Administering can also be performed, for example, once, a plurality of times, and/or over one or more extended periods.
[0342] As used herein, the term "T cell-mediated response" refers to a response mediated by T cells, including effector T cells (e.g., CD8+ cells) and helper T cells (e.g., CD4+ cells). T cell mediated responses include, for example, T cell cytotoxicity and proliferation.
[0343] As used herein, the term "cytotoxic T lymphocyte (CTL) response" refers to an immune response induced by cytotoxic T cells. CTL responses are mediated primarily by CD8+ T cells.
[0344] As used herein, the terms "inhibition" or "blocking" (e.g., referring to inhibition/blocking of CD73 binding or activity) are used interchangeably and encompass both partial and complete inhibition/blocking.
[0345] As used herein, "cancer" refers a broad group of diseases characterized by the uncontrolled growth of abnormal cells in the body. Since unregulated cell division may result in the formation of malignant tumors or cells, they would invade neighboring tissues and may metastasize to distant parts of the body through the lymphatic system or bloodstream.
[0346] The terms "treat," "treating," and "treatment," as used herein, refer to any type of intervention or process performed on, or administering an active agent to, the subject with the objective of reversing, alleviating, ameliorating, inhibiting, or slowing down or preventing the progression, development, severity or recurrence of a symptom, complication, condition or biochemical indicia associated with a disease. Prophylaxis refers to administration to a subject who does not have a disease, to prevent the disease from occurring or minimize its effects if it does.
[0347] A "hematological malignancy" includes lymphoma, leukemia, myeloma or lymphoid malignancy, as well as cancers of the spleen and lymph nodes. Exemplary lymphomas include both B cell lymphomas and T cell lymphomas. B-cell lymphomas include both Hodgkin's lymphomas and most non-Hodgkin's lymphomas. Non-limiting examples of B cell lymphomas include diffuse large B-cell lymphoma, follicular lymphoma, mucosa-associated lymphatic tissue lymphoma, small cell lymphocytic lymphoma (overlaps with chronic lymphocytic leukemia), mantle cell lymphoma (MCL), Burkitt's lymphoma, mediastinal large B cell lymphoma, Waldenstrom macroglobulinemia, nodal marginal zone B cell lymphoma, splenic marginal zone lymphoma, intravascular large B-cell lymphoma, primary effusion lymphoma, lymphomatoid granulomatosis. Non-limiting examples of T cell lymphomas include extranodal T cell lymphoma, cutaneous T cell lymphomas, anaplastic large cell lymphoma, and angioimmunoblastic T cell lymphoma. Hematological malignancies also include leukemia, such as, but not limited to, secondary leukemia, chronic lymphocytic leukemia, acute myelogenous leukemia, chronic myelogenous leukemia, and acute lymphoblastic leukemia. Hematological malignancies further include myelomas, such as, but not limited to, multiple myeloma and smoldering multiple myeloma. Other hematological and/or B cell- or T-cell-related cancers are encompassed by the term hematological malignancy.
[0348] The term "effective dose" or "effective dosage" is defined as an amount sufficient to achieve or at least partially achieve a desired effect. A "therapeutically effective dose" or "therapeutically effective dosage" of a drug or therapeutic agent is any amount of the drug that, when used alone or in combination with another therapeutic agent, promotes disease regression evidenced by a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction. A "prophylactically effective dose" or a "prophylactically effective dosage" of a drug is an amount of the drug that, when administered alone or in combination with another therapeutic agent to a subject at risk of developing a disease or of suffering a recurrence of disease, inhibits the development or recurrence of the disease. The ability of a therapeutic or prophylactic agent to promote disease regression or inhibit the development or recurrence of the disease can be evaluated using a variety of methods known to those skilled in the art, such as in human subjects during clinical trials, in animal model systems predictive of efficacy in humans, or by assaying the activity of the agent in in-vitro assays.
[0349] By way of example, an anti-cancer agent is a drug that slows cancer progression or promotes cancer regression in a subject. In preferred embodiments, a therapeutically effective amount of the drug promotes cancer regression to the point of eliminating the cancer. "Promoting cancer regression" means that administering an effective amount of the drug, alone or in combination with an anti-neoplastic agent, results in a reduction in tumor growth or size, necrosis of the tumor, a decrease in severity of at least one disease symptom, an increase in frequency and duration of disease symptom-free periods, a prevention of impairment or disability due to the disease affliction, or otherwise amelioration of disease symptoms. Pharmacological effectiveness refers to the ability of the drug to promote cancer regression in the patient. Physiological safety refers to an acceptably low level of toxicity, or other adverse physiological effects at the cellular, organ and/or organism level (adverse effects) resulting from administration of the drug.
[0350] By way of example, for the treatment of tumors, a therapeutically effective dose or dosage of the drug preferably inhibits cell growth or tumor growth by at least about 20%, more preferably by at least about 40%, even more preferably by at least about 60%, and still more preferably by at least about 80% relative to untreated subjects. In the most preferred embodiments, a therapeutically effective dose or dosage of the drug completely inhibits cell growth or tumor growth, i.e., preferably inhibits cell growth or tumor growth by 100%. The ability of a compound to inhibit tumor growth can be evaluated using the assays described infra. Alternatively, this characteristic of a composition can be evaluated by examining the ability of the compound to inhibit cell growth, such inhibition can be measured in vitro by assays known to the skilled practitioner. In other preferred embodiments described herein, tumor regression may be observed and may continue for a period of at least about 20 days, more preferably at least about 40 days, or even more preferably at least about 60 days.
[0351] The terms "patient" and "subject" refer to any human or non-human animal that receives either prophylactic or therapeutic treatment. For example, the methods and compositions described herein can be used to treat a subject having cancer. The term "non-human animal" includes all vertebrates, e.g., mammals and non-mammals, such as non-human primates, sheep, dog, cow, chickens, amphibians, reptiles, etc.
[0352] "Pharmaceutically acceptable" is intended to refer to the substance or composition that must be chemically and/or toxicologically compatible with the other ingredients comprising the formulation and/or the mammal being treated with it.
[0353] "Pharmaceutically acceptable vectors" encompasses pharmaceutically acceptable vectors, excipients, and diluents, and is intended to refer to materials, compositions, or vehicles that involve carrying or transporting pharmaceutical agents from one organ or body part of a subject to another organ or body part of a subject, such as liquid or solid fillers, diluents, excipients, solvents or encapsulating materials.
EXAMPLES
TABLE-US-00003
[0354] EXAMPLE 1: Screening and identification of anti-CD73 antibodies
[0355] C57/BL6 mice were immunized with human CD73 ecto-domain recombinant protein (huCD73, SEQ ID NO: 1). Performing the first immunization (intraperitoneal injection) with an emulsion of 50 .mu.g huCD73 protein plus Freund's complete adjuvant, performing the second immunization (subcutaneous injection)with an emulsion of 25 .mu.g huCD73 protein plus incomplete Freund's adjuvant, performing the third immunization (intraperitoneal injection) with an emulsion of 25 .mu.g huCD73 protein plus incomplete Freund's adjuvant, performing the fourth immunization (subcutaneous injection) with an emulsion of 25 .mu.g huCD73 protein plus incomplete Freund's adjuvant, and finally, performing the final boost immunization (intraperitoneal injection) with 50 .mu.g huCD73 protein. Four days after the boost, the immune spleen cells were fused with SP2/0 cells by electrofusion to prepare hybridoma cells. Mice were immunized in the same way and phage library antibodies were prepared. Primary screening was performed by ELISA and flow cytometry, 32 hybridoma antibodies and 2 phage antibodies were obtained to bind human CD73 and cynomolgus CD73. Then, 293T/17 cells expressing huCD73 (293T/17-huCD73) were used to further screen the blockade enzyme activity, and finally 5 clones with function of blockade of CD73 enzyme activity were obtained.
Example 2
Indirect Assay of the Binding of Antibodies to CD73 by ELISA
[0356] The indirect ELISA method was applied to evaluate the binding ability of each positive clone to soluble huCD73 protein. Soluble huCD73 was coated, and gradient diluted samples were incubated, then HPR-labeled secondary antibody was added, finally TMB was added to develop the color, and OD450 was read after termination. As shown in FIG. 1, the result showed that all three cloned antibodies of 66F2A8D6 (SEQ ID NOs: 118 and 119), 94A12G11F2 (SEQ ID NOs: 120 and 121), 191C3A8B9 (SEQ ID NOs: 122 and 123) and two phage antibodies of S1B5 (SEQ ID NOs: 13 and 14) and JB24Chi (SEQ ID NOs: 26 and 28) bind to soluble recombinant CD73 with sub-nanomolar affinity.
TABLE-US-00004 TABLE 1 Binding ability of positive clones to soluble huCD73 protein Ab Bottom Top EC.sub.50(nM) 66F2A8D6 0.1646 3.108 0.153 94A12G11F2 0.0566 2.941 0.242 191C3A8B9 0.0498 2.748 0.279 S1B5 0.0070 2.926 0.085 JB24Chi 0.1360 3.086 0.039
Example 3
Assay of the Binding of Antibodies to Natural CD73 Cell Surface by Flow Cytometry
[0357] 293T/17-huCD73 cells were used to evaluate the binding ability of five antibodies to natural CD73 on cell surface. After incubating gradient diluted antibodies with 293T/17-huCD73 cells, fluorescently labeled detection antibody was added, the fluorescence intensity value was read, and EC.sub.50 was calculated. As shown in FIG. 2, the results showed that all antibodies bind to CD73 on cell surface with nanomolar or sub-nanomolar affinity.
TABLE-US-00005 TABLE 2 Binding ability of positive clones to natural CD73 protein Ab Bottom Top EC.sub.50(nM) 66F2A8D6 0.5465 174.2 1.664 94A12G11F2 1.132 221.7 2.077 191C3A8B9 2.671 105.4 0.828 S1B5 0.6408 14.66 0.099 JB24Chi -1.467 41.98 1.135
Example 4
Evaluation of Blockade of Soluble CD73 Recombinant Protease Activity
[0358] This assay evaluates the blockade ability of CD73 antibodies to the 5'exonuclease of soluble huCD73 recombinant protease. The binding of antibodies blocks the activity of huCD73 recombinant protein to hydrolysis AMP into adenosine and inorganic phosphate, while the competition of AMP with ATP inhibits the ability of luciferase to emit light. Thus, blocking antibodies attenuate light emission and results in reduced RLU values. As shown in FIG. 3, 66F2A8D6, 94A12G11F2, 191C3A8B9, antibody S1B5 and JB24Chi all have inhibitory effects on the activity of soluble CD73 recombinant protein, and the IC.sub.50 were at the nanomolar or subnanomolar level.
TABLE-US-00006 TABLE 3 The ability of CD73 antibodies to block soluble CD73 recombinant protease activity Ab Bottom Top IC.sub.50(nM) 66F2A8D6 6.361 86.08 1.956 94A12G11F2 6.213 87.77 1.496 191C3A8B9 5.553 93.72 2.407 S1B5 16.180 99.47 3.259 JB24Chi 14.710 101.70 0.401
Example 5
Blockade of 5' Exonuclease on the Cell Surface Activity Against CD73 Antibody
[0359] This method was based on 293T/17-huCD73 and 293T/17-cynoCD73 cells to evaluate the blockade ability of CD73 antibodies to 5'exonuclease on the cell surface activity, to further confirm the biochemical activities of the five antibodies. As shown in FIG. 4, all antibodies could inhibit the 5'exonuclease on the cell surface activity. Among them, the inhibitory activity of 191C3A8B9 against huCD73 was weaker than that of cynomolgus CD73, the others had similar inhibitory activity on human/cynomolgus CD73. The IC.sub.50 values of all antibodies were 10.sup.-11.about.10.sup.-12M (Table 4).
TABLE-US-00007 TABLE 4 The ability of CD73 antibodies to block 5 'exonuclease on the cell surface activity 293T/17-HuCD73 293T/17-cyno CD73 IC.sub.50 IC.sub.50 Ab Bottom Top (nM) Bottom Top (nM) 66F2A8D6 3935659 13777015 0.027 2542560 6682235 0.077 94A12G11F2 4013533 13788420 0.011 2845459 6641976 0.006 191C3A8B9 4644137 14192084 0.009 3764123 7369545 0.001 S1B5 8532921 16191747 0.034 1044320 4968902 0.085 JB24Chi 7418313 16806180 0.031 1156967 4317630 0.084
Example 6
Reverse Effect of CD73 Antibody on AMP-Mediated Human CD4+T Cell Proliferation Inhibition
[0360] Antibodies blocked the enzymatic activity of CD73, and the production of adenosine was inhibited, thereby releasing the proliferation inhibition of human CD4+T cells adenosine. This method confirmed the ability of CD73 antibody to release AMP-mediated CD4+T cell proliferation inhibition in vitro; at the same time, the blockade of CD73 antibodies to CD4+T cell CD73 was detected by CellTiter-Glo (Promega) reagent; and the IFN-.gamma. levels in cell culture supernatant were detected by ELISA.
[0361] The results showed that 66F2A8D6, 94A12G11F2, S1B5, and JB24Chi can reverse the AMP-mediated CD4+T cell proliferation inhibition (FIG. 5), and the EC.sub.50 values were relatively close, all in 10.sup.-11.about.10.sup.-12M (Table 5)
TABLE-US-00008 TABLE 5 The ability of CD73 antibodies reversing AMP-mediated human CD4 + T cell proliferation inhibition Ab Bottom Top EC.sub.50(nM) 66F2A8D6 29.55 69.45 0.010 94A12G11F2 32.63 73.53 0.004 S1B5 27.36 64.14 0.013 JB24Chi 26.58 62.33 0.007
[0362] Similar to the results of CD4+T cell proliferation experiments, 66F2A8D6, 94A12G11F2, 51B5, and JB24Chi all had potent inhibitory effects on enzyme activity (FIG. 6), and the inhibitory ability were 10.sup.-11.about.10.sup.-12M (Table 6).
TABLE-US-00009 TABLE 6 The ability of antibodies blocking CD4 + T cell Ab Bottom Top IC.sub.50(nM) 66F2A8D6 8353547 17766093 0.011 94A12G11F2 22404704 46921097 0.008 S1B5 22907851 25212940 0.048 JB24Chi 45017675 44400168 0.009
[0363] ELISA detection kit (Dakewe) was used to detect supernatant IFN-.gamma., as shown in FIG. 7, 66F2A8D6, 94A12G11F2, S1B5 and JB24Chi can stimulate CD4+T cells to release IFN-.gamma., and the EC.sub.50 of each antibody stimulated T cells to secrete IFN-.gamma. was in the range of 10.sup.-11.about.10.sup.-12M (Table 7).
TABLE-US-00010 TABLE 7 The ablity of antibodies to reverse the release of IFN-.gamma. from CD4 + T cells Ab Bottom Top EC.sub.50(nM) 66F2A8D6 88.7 461.4 0.0101 94A12G11F2 296.6 794.6 0.0049 S1B5 156.6 576.3 0.0411 JB24Chi 169.1 512.1 0.0132
Example 7
Experiment of CD73 Antibody-Mediated CD73 Internalization
[0364] 66-IgG2 (SEQ ID NOs: 39 and 40), 94-IgG2 (SEQ ID NOs: 51 and 53), S1B5, JB24Chi antibodies mediated internalization effect on MDA-MB-231 cell was detected using the Fab-ZAP saporin conjugate (Advanced Targeting Systems). As shown in FIG. 8, all four chimeric antibodies mediated the internalization effect of CD73 in a dose-dependent manner, and the IC.sub.50 of each antibody was about 10.sup.-11 M.
TABLE-US-00011 TABLE 8 The ability of antibody-mediated internalization of CD73 Ab Bottom Top IC.sub.50(nM) 66-hIgG2 581873 3044537 0.022 94-hIgG2 649643 2809795 0.019 S1B5 896346 3084741 0.029 JB24Chi 779820 3197304 0.012
Example 8
Humanization of Antibodies
[0365] The CDR and framework regions are numbered, and the amino acids of each antibody in the CDR regions and framework regions are numbered according to the Kabat system (see Table I). Two antibodies 94A12E7D5 and JB24Chi were humanized by CDR grafting method. The sequence identity and structural similarity of two murine antibodies and human antibodies were analyzed respectively, and the CDRs of the murine antibodies were grafted to a series of human antibody templates based on the above. After preliminary screening by ELISA, three humanized antibodies of JB24Chi and three humanized antibodies of 94A12E7D5 were obtained, which named as JB24H2L1 (SEQ ID NOs: 71 and 73), JB24H3L2 (SEQ ID NOs: 72 and 74), JB24H3L3 (SEQ ID NOs: 72 and 75), JB94H1L3 (SEQ ID NOs: 81 and 85), JB94H2L1 (SEQ ID NOs: 82 and 84), and JB94H3L3 (SEQ ID NOs: 83 and 85) respectively. Chimeric antibodies consisting of mouse-derived antibodies' Fv of 94A12G11F and human IgG1 and human kappa constant regions were named JB94Chi (SEQ ID NOS: 52 and 53).
Example 9
The Assay of Affinity of Humanized Antibodies and Chimeric Antibodies
[0366] The affinity of humanized antibodies was determined by indirect ELISA: 96-well ELISA plates were coated with 1 .mu.g/ml huCD73 recombinant protein, 50 ul/well, washed the plate 3 times with 200 ul PBST per well, blocked with 200 ul/well of 1% BSA for 1 h at room temperature, and the plates were washed 3 times with 200 ul/well of PBST. Incubated with gradient diluted 100 .mu.L/well of antibodies for 1 h at room temperature. After the plates were washed 3 times with 200 ul/well of PBST, 100 ul of diluted HRP-labeled secondary antibody at a ratio of 1:5000 was added to each well, and the plates were incubated for 1 hour at room temperature. The plates were washed 3 times with 200 ul/well of PBST, 100 ul of TMB was added to each well and reacted for 5 minutes at room temperature in the dark. Excitation at 530 nm, emission at 590 nm, cut-off at 570 nm, read the OD value. The results were shown in FIG. 9. The affinity of humanized antibodies and parent antibodies were similar to the antigen (table 9).
TABLE-US-00012 TABLE 9 The affinity of humanized antibodies to soluble huCD73 Ab Bottom Top EC.sub.50(nM) JB24Chi 128.1 6601 0.0273 JB24H2L1 190.9 6293 0.0248 JB24H3L2 89.06 7139 0.0208 JB24H3L3 9.8 7306 0.0228 JB94Chi 152 8474 0.0357 JB94H1L3 48.7 8288 0.0289 JB94H2L1 -141.9 7111 0.0252 JB94H3L3 320 8897 0.0292
[0367] Flow cytometry assay: the huCD73 or cynoCD73-expressing 293T/17 cells were used to evaluate the binding ability of humanized antibodies. 2.times.10.sup.6 cells resuspended in PBS buffer were distributed into 96-well plates and incubated with gradient diluted humanized antibodies for 1 h at refrigerator 4.degree. C. or on ice, then the cells was centrifuged for 3 min 1500 rpm at 4.degree. C. and washed three times by PBS, and diluted APC-labeled goat anti-human polyclonal antibody (Biolegend) were were incubated for 30 min at refrigerator 4.degree. C. Finally, the cells were washed three times with PBS as described above and analyzed on MACSQuant flow cytometer. GraphPad Prism software was used to generate data graphs and statistical affinity data. As shown in FIG. 10, humanized antibodies of JB24Chi and 94A12G11F had similar EC.sub.50 values to their parent antibodies, both in the 10.sup.-11 M to 10.sup.-12 M (Table 10).
TABLE-US-00013 TABLE 10 Affinity of humanized antibodies and chimeric antibodies to huCD73 and cynoCD73 antigens on cell surface 293T/17-human CD73 293T/17-Cyno CD73 Ab Bottom Top EC.sub.50 (nM) Bottom Top EC.sub.50 (nM) JB24H2L1 1.639 82.25 2.404 1.401 36.54 1.892 JB24H3L2 1.779 91.74 3.009 0.509 48.67 3.593 JB24H3L3 0.131 120.50 7.406 0.917 34.01 3.729 JB24Chi 3.723 195.50 5.334 0.709 68.54 6.379 JB94H1L3 3.258 172.50 4.507 1.510 78.70 5.424 JB94H2L1 0.604 222.80 9.152 0.220 82.03 7.974 JB94H3L3 1.785 239.30 15.290 1.395 125.40 9.824 JB94Chi 1.405 246 10.630 1.445 123.90 8.588
Example 10
Blockade of 5'Exonuclease on the Cell Surface Activity Against Humanized Antibodies
[0368] This method uses 293T/17-huCD73 cells to evaluate the AMP hydrolysis inhibited by CD73, to further confirm the biochemical activities of humanized antibodies. As shown in FIG. 11, the enzymatic blocking activities of all humanized antibodies of JB24H3L3, JB94H1L3, 94H1L3 hIgG2 (SEQ ID NOs:85 and 124) were in the 10.sup.-11.about.10.sup.-12 M levels (Table 11).
TABLE-US-00014 TABLE 11 Blockade activities of 5 'exonuclease on the cell surface activity against humanized antibodies 293T/17-human CD73 293T/17-Cyno CD73 Cells IC.sub.50 IC.sub.50 Ab Bottom Top (nM) Bottom Top (nM) JB24H2L1 8039545 27092351 0.042 6718233 28633058 0.079 JB24H3L2 7836350 27586937 0.014 6431345 33705693 0.004 JB24H3L3 7183191 27666447 0.016 7462673 32900976 0.003 JB24Chi 9147540 26077507 0.006 8819632 26477691 0.005 JB94H1L3 6727576 21364881 0.042 8000768 30217678 0.017 94H1L3 2016997 10921025 0.007 1213837 5673059 0.021 hIgG2 JB94H2L1 7233354 22246467 0.005 8309853 54243915 0.0001 JB94H3L3 7810738 19948965 0.004 9203356 27004932 0.002 JB94Chi 7836630 26055691 0.001 9159630 30233789 0.001
[0369] In addition, U87-MG cells were used to evaluate hydrolysis of AMP catalyzed by CD73, and further confirm the biochemical activity of humanized antibodies. After U87-MG cells were digested with trypsin, the cell density was adjusted to 4.times.10.sup.5 cells/ml with MEM medium, and 50 .mu.l/well was added to a 96-well plate. The humanized antibody was gradient diluted by MEM medium, 50 .mu.l/well was added to the wells, and incubated for 1 h at 37.degree. C. 100 .mu.l of 360 .mu.M AMP was added to each well and incubated for 1 h at 37.degree. C. The plates were then centrifuged for 3 min at 1500 rpm, a certain volume of culture supernatants were transferred to a opaque 96-well flat bottom plate (Costar, 3912), and added 2.times. ATP to make the final reaction concentration of 25 .mu.M. Finally, according to Promega instructions, corresponding volume of CellTiter Glo reagent in a ratio of 1:1 was added. After equilibrated for 5 minutes at room temperature, luminescence value was read on Perkin-Elmer Envision microplate reader and cell CD73 enzyme activity was determined by measuring ATP levels. GraphPad Prism software was used to generate data graphs and statistical enzyme kinetic data. The blocking activities of humanized antibodies of JB24Chi and JB94Chi were shown in FIG. 12, both value of IC.sub.50 is in the sub-nanomolar class (Table 12).
TABLE-US-00015 TABLE 12 Blockade ability of 5'exonuclease activity of U87-MG cells against humanized antibodies Ab Bottom Top IC50(nM) JB24H2L1 5795303 11954887 0.474 JB24H3L2 4703766 12052334 0.270 JB24H3L3 5596400 12116519 0.120 JB24Chi 5780677 14683906 0.053 JB94H1L3 5605512 12073719 0.314 JB94H2L1 5565211 12085615 0.214 JB94H3L3 3402301 12844937 0.456 JB94Chi 4653071 12168782 0.257
Example 11
Reverse Effect of Humanized Antibody on AMP-Mediated Human CD4+T Cell Proliferation Inhibition
[0370] This method confirmed the ability of humanized CD73 antibody to release AMP-mediated CD4+T cell proliferation inhibition in vitro; at the same time, the blockade ability of humanized antibodies to CD4+T cell CD73 enzyme activity was detected by CellTiter-Glo (Promega) reagent; and the IFN-.gamma. levels in cell culture supernatant were detected by ELISA.
[0371] The results of the activities of humanized antibody of JB24Chi and JB94Chi were shown in FIG. 13. Among them, the activities of JB94H1L3, 94H1L3 hIgG2 and JB94H3L3 were about 10.sup.-11.about.10.sup.-12M (Table 13).
TABLE-US-00016 TABLE 13 The ability of humanized antibodies reversing AMP-mediated human CD4 + T cell proliferation inhibition Ab Bottom Top EC.sub.50(nM) JB24H2L1 22.61 81.28 0.032 JB24H3L2 6.097 86.32 0.022 JB24H3L3 16.45 85.72 0.068 JB24Chi 25.18 81.45 0.003 JB94H1L3 29.9 81.79 0.002 94H1L3 0.558 103.5 0.012 hIgG2 JB94H2L1 20.33 81.28 0.032 JB94H3L3 24.47 82.01 0.003 JB94Chi 22.86 83.57 0.003
[0372] ELISA detection kit (Dakewe) was used to detect cell supernatant IFN-.gamma. level. As shown in FIG. 14, except for JB24H3L3, each humanized antibody stimulated T cells to secrete IFN-.gamma. with a EC.sub.50 of 10.sup.-11.about.10.sup.-12M (Table 14).
TABLE-US-00017 TABLE 14 The ability of humanized Cd73 antibodies reversing the release of IFN-.gamma. from CD4 + T cells Ab Bottom Top EC.sub.50(nM) JB24H2L1 380.5 875 0.002 JB24H3L2 164.6 1527 0.015 JB24H3L3 387.6 2249 0.345 JB24Chi 474.1 1897 0.006 JB94H1L3 391.1 1165 0.001 94H1L3 267.7 4791 0.001 hIgG2 JB94H2L1 380.4 875 0.002 JB94H3L3 245.9 1419 0.003 JB94Chi 267.4 1550 0.004
Example 12
Inhibition of 5'Exonuclease Activity in A375 Xenograft Model by Humanized Antibody
[0373] B-NDG mice (Biocytogen) were subcutaneously inoculated with A375 cells, and 3 days later, the antibodies JB94H1L3, 94H3L3 hIgG1 (SEQ ID NOS: 91 and 85) or PBS were injected intraperitoneally (i.p.) 2 times/week, and dosing for two weeks, tumors were harvested at 1 d, 2 d, 3 d, and 7 d after administration. Place fresh tissue in a small cup filled with liquid nitrogen to freeze the tissue quickly, embed it in OCT, cut into 5-6 .mu.m thickness and dry at room temperature. The tumor section is fixed with 4.degree. C. pre-cooled acetone for 20 min. Store at -80.degree. C. after drying. Take the tumor section out of the refrigerator at -80.degree. C., equilibrate at room temperature for 5-10 min, put it into 50 mM Tris-maleic acid buffer (PH7.4, containing 2 mM CaCl.sub.2 and 0.25M sucrose), pre-incubate at room temperature for 1 h, remove the pre-incubation buffer after 1 h, and again add 50 mM Tris-maleic acid buffer (PH7.4, containing 5 mM MnCl.sub.2, 2 mM lead nitrate, 2.5% dextran T200, 2.5 mM levamisole and 400 .mu.M AMP), incubate at 37.degree. C. for 1.5 h; rinse three times with water, incubate the sections with 1% (NH.sub.4).sub.2S for 1 min at room temperature, and then quickly rinse three times with water; the sections were counterstained with hematoxylin and eosin, dehydrated, xylene transparent, and photographed under a microscope. Brown indicates the presence of activated CD73, and deletion of brown indicates that the antibody blocks the enzyme activity of CD73. Results are shown in FIG. 15A and FIG. 15B.
[0374] The above results show that both JB94H1L3 and 94H3L3 hIgG1 can significantly reduce the 5'exonuclease activity of tumors in xenograft animal models, and are related to the administration time. On the 3rd day after discontinuation, the CD73 enzyme activity in the JB94H1L3 treatment group was reduced to the lowest point, and then slightly increased on the 7th day. The CD73 enzyme activity in the 94H3L3 hIgG1 treatment group gradually increased from the first day after administration. In summary, both antibodies showed good effect on inhibiting CD73 activity.
Example 13
Tumor Suppressive Effect of Humanized Antibodies on A375 Human Melanoma Xenograft Model
[0375] A375 human melanoma cells were inoculated subcutaneously in the right hypochondrium of NCG mice, and PBMC were resuspended in PBS and then inoculated in the mice. When the tumors grew to 50-100 mm.sup.3, administering in two groups, giving JB94H1L3 (10 mg/kg) or solvent control. The tumor volume was measured twice a week using vernier calipers to measure the long and short diameters of the tumor, and the volume calculation formula is: volume=0.5 along diameter.times.short diameter.sup.2. As shown in FIG. 16, JB94H1L3 exhibited significant tumor growth inhibition effect.
These results were obtained using the following materials and methods:
[0376] Antibody Preparation:
[0377] Preparation of hybridoma antibodies: Thawed hybridoma cells were cultured for 7-10 days in 10% FBS-containing DMEM medium, and the cell culture supernatant was collected, centrifuged at 1000 rpm for 10 minutes, then the supernatants was purified with Protein G HP SpinTrap (GE Healthcare). Quantification was performed using an UV5nano (millipore) spectrophotometer.
[0378] Preparation of recombinant antibody: ExpiCHO cells (Thermo Fisher Scientific) with a viability of 99% were adjust to a density of 6.times.10.sup.6 cells/ml. The cells were centrifuged at 1500 rpm for 5 min and resuspended. Prepare the expression vector diluent, ExpiFectamine CHO reagent diluent and DNA-ExpiFectamine CHO complex according to the instructions, and transfer the DNA-ExpiFectamine complex to the cell culture solution. Incubate for 8 days at 37.degree. C. in an 8% CO.sub.2 shaker. Centrifuge at 11,000 rpm for 10 min to collect the cell supernatant. Antibodies were purified using an NGC chromatography system (Bio-Rad) and rProtein G Beads 4FF pre-assembled columns. Quantification was performed using an UV5nano (millipore) spectrophotometer.
[0379] Assay 1: Indirect ELISA
[0380] 1 ug/ml of recombinant CD73 protein was coated on ELISA plates (Coning), incubate overnight at 4.degree. C. The next day, wash 5 times in PBS and blocked with 200 ul/well 2% skimmed milk, a certain dose range of CD73 antibodies were incubated for 1 h at room temperature. Wash 5 times with PBST washing buffer (PBS, 0.05% Tween 20), add HRP-conjugated goat anti-mouse IgG (H+L) (Promega) and incubate at room temperature for 1 h to detect bound anti-CD73 antibodies; wash the plate 5 times again and add TMB (Life Technologies) for color development for 5 to 10 min; finally the reaction was stopped by adding 1N HCl, and the OD value was measured at 450 nm. GraphPad Prism software was used to generate data graphs and statistical affinity data.
[0381] Assay 2: Flow Cytometry
[0382] Add 100 .mu.L 2.times.10.sup.5 cells/well expressing huCD73 (293T/17-huCD73), cynoCD73 (293T/17-cynoCD73) or moCD73 (293T/17-moCD73) cells to a 96-well U-shaped cell culture plate. The samples to be tested were incubated for 1 h at 4.degree. C. after gradient dilution. After washing, 100 .mu.L of APC-labeled secondary antibody was added to each well and incubated for 30 min. After washing, detecting on machine and the fluorescence value was read. GraphPad Prism software was used to generate data graphs and statistical affinity data.
[0383] Construction of recombinant host cells 293T/17-huCD73, 293T/17-cynoD73, 293T/17-moD73: use the PLVX-EF1a virus vector having huCD73, cynoCD73 and moCD73 genes and puromycin resistance to transfect 293T/17 cells with TransIT.RTM.-293 transfection reagent, after about 2 days, replace the complete medium containing puromycin to cultivate, and after the cells are expanded and cultivated, a single cloned cell is selected using a limited gradient dilution method, and PE-labeled anti-huCD73, cynoCD73 and moCD73 antibodies were used to detect cell surface antigens after transfection. Then the cells are expanded and cultivated for enzyme activity assay and flow cytometry.
[0384] Assay 3: Soluble CD73 Enzyme Activity Blocking Assay
[0385] The blocking function of enzyme activity by antibodies was determined based on the soluble CD73 recombinant protein. In the presence of 500 ng/ml CD73 recombinant protein, a certain dose range of CD73 antibody was added to a 96-well flat bottom plate and incubated at 37.degree. C. for 1 h; then AMP and ATP with a final concentration of 180 uM and 25 uM was added to each well. Incubate for 30 min at 37.degree. C.; transfer a certain volume of cell supernatant to a blank plate, add CellTiterr-Glo (Promega) containing luciferase to the above wells at a ratio of 1:1, at room temperature, equilibrated for 5 minutes in the dark. Finally, the Enspire microplate reader (Perkin Elmer) was used to measure the luminescence value. GraphPad Prism software was used to generate a data graph and statistics of enzyme kinetic data.
[0386] Assess the percentage of enzyme inhibition as follows:
[0387] ATP+AMP: maxial luciferase inhibition (100%)
[0388] ATP+AMP+CD73: no luciferase inhibition (0%)
[0389] The formula of residual CD7 activity was evaluated as follows:
( C .times. D .times. 7 .times. 3 + A .times. b + A .times. T .times. P + A .times. M .times. P ) - ( A .times. T .times. P + A .times. M .times. P ) ( C .times. D .times. 7 .times. 3 + A .times. T .times. P + A .times. M .times. P ) - ( A .times. T .times. P + A .times. M .times. P ) * 100 ##EQU00001##
[0390] Assay 4: Cell CD73 Enzyme Activity Blocking Assay
[0391] The 293T/17-huCD73 cells were digested, centrifuged at 1500 rpm for 3 minutes, and the supernatant was discarded. The cells were resuspended in serum-free DMEM medium and counted with a Biorad TC20 cell counter. Adjust the cell density, spread the cells into 96-well plates at 8,000 cells, 50 uL/well; add 50 uL gradient diluted antibody solution to the corresponding wells, and incubate in a 5% CO.sub.2 incubator for 1 hour at 37.degree. C.; then add 100 uL of AMP solution with a final concentration of 180 uM and incubate in a 5% CO.sub.2 at 37.degree. C. for 1 hour; then centrifuge the cell plate at 1500 rpm for 3 minutes and transfer a certain volume of culture supernatant to an opaque 96-well flat bottom plate (Costar, 3912), then add 2.times. ATP solution to make the final reaction concentration of 25 uM. Finally, add the corresponding volume of CellTiter Glo reagent at a ratio of 1:1 according to Promega's instructions. After equilibrating at room temperature for 5 minutes, read the luminescence value on a Perkin-Elmer Envision microplate reader and determine the cell CD73 enzyme activity by measuring the ATP level. GraphPad Prism software was used to generate data graphs and statistical enzyme kinetic data.
[0392] Assay 5: Fab ZAP Endocytosis Experiment
[0393] On the first day, 2000 cells/well of MDA-MB-231 cells were plated into 96-well flat bottom plates at 50 ul/well and incubated overnight at 37.degree. C. in 5% CO.sub.2; The next day, the antibodies were gradient diluted with 80 nM Fab-ZAP reagent (Advanced Targeting Systems) to a certain dose range, and incubated for 30 min at room temperature to bind Fab-ZAP to the antibody to be tested, then the antibodies were premixed, and 50 uL of the mixture were added to MDA-MB-231 cells wells, after 3 days incubation at 37.degree. C. in 5% CO2, take the cell plate and add CTG reagent (Promega) to lyse the cells for 2 minutes, and then equilibrated the plates at room temperature for 5 minutes. Luminescences were measured using Enspire microplate reader (Perkin Elmer) and cell proliferation curves were analyzed by GraphPad Prism software.
Sequence CWU
1
1
1271532PRTHomo sapiens 1Trp Glu Leu Thr Ile Leu His Thr Asn Asp Val His
Ser Arg Leu Glu1 5 10
15Gln Thr Ser Glu Asp Ser Ser Lys Cys Val Asn Ala Ser Arg Cys Met
20 25 30Gly Gly Val Ala Arg Leu Phe
Thr Lys Val Gln Gln Ile Arg Arg Ala 35 40
45Glu Pro Asn Val Leu Leu Leu Asp Ala Gly Asp Gln Tyr Gln Gly
Thr 50 55 60Ile Trp Phe Thr Val Tyr
Lys Gly Ala Glu Val Ala His Phe Met Asn65 70
75 80Ala Leu Arg Tyr Asp Ala Met Ala Leu Gly Asn
His Glu Phe Asp Asn 85 90
95Gly Val Glu Gly Leu Ile Glu Pro Leu Leu Lys Glu Ala Lys Phe Pro
100 105 110Ile Leu Ser Ala Asn Ile
Lys Ala Lys Gly Pro Leu Ala Ser Gln Ile 115 120
125Ser Gly Leu Tyr Leu Pro Tyr Lys Val Leu Pro Val Gly Asp
Glu Val 130 135 140Val Gly Ile Val Gly
Tyr Thr Ser Lys Glu Thr Pro Phe Leu Ser Asn145 150
155 160Pro Gly Thr Asn Leu Val Phe Glu Asp Glu
Ile Thr Ala Leu Gln Pro 165 170
175Glu Val Asp Lys Leu Lys Thr Leu Asn Val Asn Lys Ile Ile Ala Leu
180 185 190Gly His Ser Gly Phe
Glu Met Asp Lys Leu Ile Ala Gln Lys Val Arg 195
200 205Gly Val Asp Val Val Val Gly Gly His Ser Asn Thr
Phe Leu Tyr Thr 210 215 220Gly Asn Pro
Pro Ser Lys Glu Val Pro Ala Gly Lys Tyr Pro Phe Ile225
230 235 240Val Thr Ser Asp Asp Gly Arg
Lys Val Pro Val Val Gln Ala Tyr Ala 245
250 255Phe Gly Lys Tyr Leu Gly Tyr Leu Lys Ile Glu Phe
Asp Glu Arg Gly 260 265 270Asn
Val Ile Ser Ser His Gly Asn Pro Ile Leu Leu Asn Ser Ser Ile 275
280 285Pro Glu Asp Pro Ser Ile Lys Ala Asp
Ile Asn Lys Trp Arg Ile Lys 290 295
300Leu Asp Asn Tyr Ser Thr Gln Glu Leu Gly Lys Thr Ile Val Tyr Leu305
310 315 320Asp Gly Ser Ser
Gln Ser Cys Arg Phe Arg Glu Cys Asn Met Gly Asn 325
330 335Leu Ile Cys Asp Ala Met Ile Asn Asn Asn
Leu Arg His Thr Asp Glu 340 345
350Met Phe Trp Asn His Val Ser Met Cys Ile Leu Asn Gly Gly Gly Ile
355 360 365Arg Ser Pro Ile Asp Glu Arg
Asn Asn Gly Thr Ile Thr Trp Glu Asn 370 375
380Leu Ala Ala Val Leu Pro Phe Gly Gly Thr Phe Asp Leu Val Gln
Leu385 390 395 400Lys Gly
Ser Thr Leu Lys Lys Ala Phe Glu His Ser Val His Arg Tyr
405 410 415Gly Gln Ser Thr Gly Glu Phe
Leu Gln Val Gly Gly Ile His Val Val 420 425
430Tyr Asp Leu Ser Arg Lys Pro Gly Asp Arg Val Val Lys Leu
Asp Val 435 440 445Leu Cys Thr Lys
Cys Arg Val Pro Ser Tyr Asp Pro Leu Lys Met Asp 450
455 460Glu Val Tyr Lys Val Ile Leu Pro Asn Phe Leu Ala
Asn Gly Gly Asp465 470 475
480Gly Phe Gln Met Ile Lys Asp Glu Leu Leu Arg His Asp Ser Gly Asp
485 490 495Gln Asp Ile Asn Val
Val Ser Thr Tyr Ile Ser Lys Met Lys Val Ile 500
505 510Tyr Pro Ala Val Glu Gly Arg Ile Lys Ala His His
His His His His 515 520 525His His
His His 5302532PRTMacaca fascicularis 2Trp Glu Leu Thr Ile Leu His Thr
Asn Asp Val His Ser Arg Leu Glu1 5 10
15Gln Thr Ser Glu Asp Ser Ser Lys Cys Val Asn Ala Ser Arg
Cys Met 20 25 30Gly Gly Val
Ala Arg Leu Phe Thr Lys Val Gln Gln Ile Arg Arg Ala 35
40 45Glu Pro Asn Val Leu Leu Leu Asp Ala Gly Asp
Gln Tyr Gln Gly Thr 50 55 60Ile Trp
Phe Thr Val Tyr Lys Gly Ala Glu Val Ala His Phe Met Asn65
70 75 80Ala Leu Arg Tyr Asp Ala Met
Ala Leu Gly Asn His Glu Phe Asp Asn 85 90
95Gly Val Glu Gly Leu Ile Glu Pro Leu Leu Lys Glu Ala
Lys Phe Pro 100 105 110Ile Leu
Ser Ala Asn Ile Lys Ala Lys Gly Pro Leu Ala Ser Gln Ile 115
120 125Ser Gly Leu Tyr Leu Pro Tyr Lys Val Leu
Pro Val Gly Asp Glu Val 130 135 140Val
Gly Ile Val Gly Tyr Thr Ser Lys Glu Thr Pro Phe Leu Ser Asn145
150 155 160Pro Gly Thr Asn Leu Val
Phe Glu Asp Glu Ile Thr Ala Leu Gln Pro 165
170 175Glu Val Asp Lys Leu Lys Thr Leu Asn Val Asn Lys
Ile Ile Ala Leu 180 185 190Gly
His Ser Gly Phe Glu Thr Asp Lys Leu Ile Ala Gln Lys Val Arg 195
200 205Gly Val Asp Val Val Val Gly Gly His
Ser Asn Thr Phe Leu Tyr Thr 210 215
220Gly Asn Pro Pro Ser Lys Glu Val Pro Ala Gly Lys Tyr Pro Phe Ile225
230 235 240Val Thr Ser Asp
Asp Gly Arg Lys Val Pro Val Val Gln Ala Tyr Ala 245
250 255Phe Gly Lys Tyr Leu Gly Tyr Leu Lys Ile
Glu Phe Asp Glu Arg Gly 260 265
270Asn Val Ile Ser Ser His Gly Asn Pro Ile Leu Leu Asn Ser Ser Ile
275 280 285Pro Glu Asp Pro Ser Ile Lys
Ala Asp Ile Asn Lys Trp Arg Ile Lys 290 295
300Leu Asp Asn Tyr Ser Thr Gln Glu Leu Gly Lys Thr Ile Val Tyr
Leu305 310 315 320Asp Gly
Ser Ser Gln Ser Cys Arg Phe Arg Glu Cys Asn Met Gly Asn
325 330 335Leu Ile Cys Asp Ala Met Ile
Asn Asn Asn Leu Arg His Ala Asp Glu 340 345
350Met Phe Trp Asn His Val Ser Met Cys Ile Leu Asn Gly Gly
Gly Ile 355 360 365Arg Ser Pro Ile
Asp Glu Arg Asn Asn Gly Thr Ile Thr Trp Glu Asn 370
375 380Leu Ala Ala Val Leu Pro Phe Gly Gly Thr Phe Asp
Leu Val Gln Leu385 390 395
400Lys Gly Ser Thr Leu Lys Lys Ala Phe Glu His Ser Val His Arg Tyr
405 410 415Gly Gln Ser Thr Gly
Glu Phe Leu Gln Val Gly Gly Ile His Val Val 420
425 430Tyr Asp Leu Ser Arg Lys Pro Gly Asp Arg Val Val
Lys Leu Asp Val 435 440 445Leu Cys
Thr Lys Cys Arg Val Pro Ser Tyr Asp Pro Leu Lys Met Asp 450
455 460Glu Ile Tyr Lys Val Ile Leu Pro Asn Phe Leu
Ala Asn Gly Gly Asp465 470 475
480Gly Phe Gln Met Ile Lys Asp Glu Leu Leu Arg His Asp Ser Gly Asp
485 490 495Gln Asp Ile Asn
Val Val Ser Thr Tyr Ile Ser Lys Met Lys Val Ile 500
505 510Tyr Pro Ala Val Glu Gly Arg Ile Lys Ala His
His His His His His 515 520 525His
His His His 5303121PRTArtificial Sequencesynthetic polypeptide 3Glu
Val Gln Leu Lys Glu Ser Gly Ala Glu Leu Val Lys Pro Gly Ala1
5 10 15Ser Val Lys Ile Ser Cys Lys
Ala Thr Gly Tyr Thr Phe Thr Gly Tyr 20 25
30Trp Ile Glu Trp Val Lys Gln Arg Pro Gly Arg Gly Leu Glu
Trp Ile 35 40 45Gly Glu Ile Leu
Pro Gly Ser Asp Ile Thr Asn Tyr Asn Glu Lys Phe 50 55
60Lys Gly Lys Ala Thr Ile Thr Ala Asp Thr Ser Ser Asn
Thr Ala Tyr65 70 75
80Met Gln Leu Ser Ser Leu Thr Thr Glu Asp Ser Ala Ile Tyr Tyr Cys
85 90 95Ala Arg Arg Gly Tyr Asp
Glu Thr Gly Tyr Ala Met Asp Tyr Trp Gly 100
105 110Gln Gly Thr Ser Val Thr Val Ser Ser 115
1204363DNAArtificial Sequencesynthetic polynucleotide
4gaggtgcagc tgaaggagtc tggggctgag ctggtgaagc ctggggcctc agtgaagatt
60tcctgcaaag ctactggcta tacattcact ggctactgga tagagtgggt aaagcagagg
120cctggacgtg gccttgagtg gattggagag attttacctg gaagtgatat tactaactac
180aatgagaagt tcaagggcaa ggccacaatc actgcagata catcctccaa cacagcctac
240atgcaactca gcagcctgac aactgaggac tctgccatct attactgtgc aagaaggggt
300tacgacgaga cgggctatgc tatggactac tggggtcaag gaacctcagt cacagtctcc
360tca
36355PRTArtificial Sequencesynthetic polypeptide 5Gly Tyr Trp Ile Glu1
5617PRTArtificial Sequencesynthetic polypeptide 6Glu Ile Leu
Pro Gly Ser Asp Ile Thr Asn Tyr Asn Glu Lys Phe Lys1 5
10 15Gly712PRTArtificial Sequencesynthetic
polypeptide 7Arg Gly Tyr Asp Glu Thr Gly Tyr Ala Met Asp Tyr1
5 108111PRTArtificial Sequencesynthetic polypeptide
8Asp Ile Val Met Thr Gln Ser Pro Ala Ser Leu Ala Val Ser Leu Gly1
5 10 15Gln Arg Ala Thr Ile Ser
Cys Lys Ala Ser Gln Ser Val Asp Tyr Asp 20 25
30Gly Asp Ser Tyr Met Asn Trp Tyr Gln Gln Lys Pro Gly
Gln Pro Pro 35 40 45Lys Leu Leu
Ile His Ala Ala Ser Asn Leu Glu Ser Gly Ile Pro Ala 50
55 60Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr
Leu Asn Ile His65 70 75
80Pro Val Glu Glu Glu Asp Ala Ala Val Tyr Phe Cys Gln Gln Ser Lys
85 90 95Glu Val Pro Trp Thr Phe
Gly Glu Gly Thr Lys Leu Glu Ile Lys 100 105
1109333DNAArtificial Sequencesynthetic polynucleotide
9gacattgtga tgacccaatc tccagcttct ttggctgtgt ctctagggca gagggccacc
60atctcctgca aggccagcca aagtgttgat tatgatggtg atagctatat gaactggtac
120caacagaaac caggacagcc acccaaactc ctcatccatg ctgcatccaa tctagaatct
180gggatcccag ccaggtttag tggcagtggg tctgggacag acttcaccct caacatccat
240cctgtggagg aagaggatgc tgcagtgtat ttctgtcagc aaagtaagga ggttccgtgg
300acgttcgtgg aagggaccaa gctggaaatc aaa
3331015PRTArtificial Sequencesynthetic polypeptide 10Lys Ala Ser Gln Ser
Val Asp Tyr Asp Gly Asp Ser Tyr Met Asn1 5
10 15117PRTArtificial Sequencesynthetic polypeptide
11Ala Ala Ser Asn Leu Glu Ser1 5129PRTArtificial
Sequencesynthetic polypeptide 12Gln Gln Ser Lys Glu Val Pro Trp Thr1
513451PRTArtificial Sequencesynthetic polypeptide 13Glu Val Gln
Leu Lys Glu Ser Gly Ala Glu Leu Val Lys Pro Gly Ala1 5
10 15Ser Val Lys Ile Ser Cys Lys Ala Thr
Gly Tyr Thr Phe Thr Gly Tyr 20 25
30Trp Ile Glu Trp Val Lys Gln Arg Pro Gly Arg Gly Leu Glu Trp Ile
35 40 45Gly Glu Ile Leu Pro Gly Ser
Asp Ile Thr Asn Tyr Asn Glu Lys Phe 50 55
60Lys Gly Lys Ala Thr Ile Thr Ala Asp Thr Ser Ser Asn Thr Ala Tyr65
70 75 80Met Gln Leu Ser
Ser Leu Thr Thr Glu Asp Ser Ala Ile Tyr Tyr Cys 85
90 95Ala Arg Arg Gly Tyr Asp Glu Thr Gly Tyr
Ala Met Asp Tyr Trp Gly 100 105
110Gln Gly Thr Ser Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser
115 120 125Val Phe Pro Leu Ala Pro Ser
Ser Lys Ser Thr Ser Gly Gly Thr Ala 130 135
140Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr
Val145 150 155 160Ser Trp
Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala
165 170 175Val Leu Gln Ser Ser Gly Leu
Tyr Ser Leu Ser Ser Val Val Thr Val 180 185
190Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val
Asn His 195 200 205Lys Pro Ser Asn
Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys 210
215 220Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro
Glu Leu Leu Gly225 230 235
240Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met
245 250 255Ile Ser Arg Thr Pro
Glu Val Thr Cys Val Val Val Asp Val Ser His 260
265 270Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp
Gly Val Glu Val 275 280 285His Asn
Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr 290
295 300Arg Val Val Ser Val Leu Thr Val Leu His Gln
Asp Trp Leu Asn Gly305 310 315
320Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile
325 330 335Glu Lys Thr Ile
Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val 340
345 350Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr
Lys Asn Gln Val Ser 355 360 365Leu
Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu 370
375 380Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn
Tyr Lys Thr Thr Pro Pro385 390 395
400Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr
Val 405 410 415Asp Lys Ser
Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met 420
425 430His Glu Ala Leu His Asn His Tyr Thr Gln
Lys Ser Leu Ser Leu Ser 435 440
445Pro Gly Lys 45014218PRTArtificial Sequencesynthetic polypeptide
14Asp Ile Val Met Thr Gln Ser Pro Ala Ser Leu Ala Val Ser Leu Gly1
5 10 15Gln Arg Ala Thr Ile Ser
Cys Lys Ala Ser Gln Ser Val Asp Tyr Asp 20 25
30Gly Asp Ser Tyr Met Asn Trp Tyr Gln Gln Lys Pro Gly
Gln Pro Pro 35 40 45Lys Leu Leu
Ile His Ala Ala Ser Asn Leu Glu Ser Gly Ile Pro Ala 50
55 60Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr
Leu Asn Ile His65 70 75
80Pro Val Glu Glu Glu Asp Ala Ala Val Tyr Phe Cys Gln Gln Ser Lys
85 90 95Glu Val Pro Trp Thr Phe
Gly Glu Gly Thr Lys Leu Glu Ile Lys Arg 100
105 110Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro
Ser Asp Glu Gln 115 120 125Leu Lys
Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr 130
135 140Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp
Asn Ala Leu Gln Ser145 150 155
160Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr
165 170 175Tyr Ser Leu Ser
Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys 180
185 190His Lys Val Tyr Ala Cys Glu Val Thr His Gln
Gly Leu Ser Ser Pro 195 200 205Val
Thr Lys Ser Phe Asn Arg Gly Glu Cys 210
21515447PRTArtificial Sequencesynthetic polypeptide 15Glu Val Gln Leu Lys
Glu Ser Gly Ala Glu Leu Val Lys Pro Gly Ala1 5
10 15Ser Val Lys Ile Ser Cys Lys Ala Thr Gly Tyr
Thr Phe Thr Gly Tyr 20 25
30Trp Ile Glu Trp Val Lys Gln Arg Pro Gly Arg Gly Leu Glu Trp Ile
35 40 45Gly Glu Ile Leu Pro Gly Ser Asp
Ile Thr Asn Tyr Asn Glu Lys Phe 50 55
60Lys Gly Lys Ala Thr Ile Thr Ala Asp Thr Ser Ser Asn Thr Ala Tyr65
70 75 80Met Gln Leu Ser Ser
Leu Thr Thr Glu Asp Ser Ala Ile Tyr Tyr Cys 85
90 95Ala Arg Arg Gly Tyr Asp Glu Thr Gly Tyr Ala
Met Asp Tyr Trp Gly 100 105
110Gln Gly Thr Ser Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser
115 120 125Val Phe Pro Leu Ala Pro Cys
Ser Arg Ser Thr Ser Glu Ser Thr Ala 130 135
140Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr
Val145 150 155 160Ser Trp
Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala
165 170 175Val Leu Gln Ser Ser Gly Leu
Tyr Ser Leu Ser Ser Val Val Thr Val 180 185
190Pro Ser Ser Asn Phe Gly Thr Gln Thr Tyr Thr Cys Asn Val
Asp His 195 200 205Lys Pro Ser Asn
Thr Lys Val Asp Lys Thr Val Glu Arg Lys Cys Cys 210
215 220Val Glu Cys Pro Pro Cys Pro Ala Pro Pro Val Ala
Gly Pro Ser Val225 230 235
240Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr
245 250 255Pro Glu Val Thr Cys
Val Val Val Asp Val Ser His Glu Asp Pro Glu 260
265 270Val Gln Phe Asn Trp Tyr Val Asp Gly Val Glu Val
His Asn Ala Lys 275 280 285Thr Lys
Pro Arg Glu Glu Gln Phe Asn Ser Thr Phe Arg Val Val Ser 290
295 300Val Leu Thr Val Val His Gln Asp Trp Leu Asn
Gly Lys Glu Tyr Lys305 310 315
320Cys Lys Val Ser Asn Lys Gly Leu Pro Ala Pro Ile Glu Lys Thr Ile
325 330 335Ser Lys Thr Lys
Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro 340
345 350Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val
Ser Leu Thr Cys Leu 355 360 365Val
Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn 370
375 380Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr
Pro Pro Met Leu Asp Ser385 390 395
400Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser
Arg 405 410 415Trp Gln Gln
Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu 420
425 430His Asn His Tyr Thr Gln Lys Ser Leu Ser
Leu Ser Pro Gly Lys 435 440
44516119PRTArtificial Sequencesynthetic polypeptide 16Gln Val Gln Leu Gln
Gln Ser Gly Leu Glu Leu Val Lys Pro Gly Ala1 5
10 15Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr
Thr Phe Thr Asp Tyr 20 25
30Asn Met His Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Trp Ile
35 40 45Gly Tyr Ile Lys Pro His Asn Gly
Gly Thr Thr Tyr Asn Pro Lys Phe 50 55
60Glu Gly Lys Ala Thr Leu Thr Val Asn Lys Ser Ser Ser Thr Ala Tyr65
70 75 80Met Glu Leu Arg Ser
Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85
90 95Val Arg Cys Asp Phe Leu Tyr Trp Tyr Phe Asp
Val Trp Gly Thr Gly 100 105
110Thr Thr Val Thr Val Ser Ser 11517357DNAArtificial
Sequencesynthetic polynucleotide 17caggtccaac tgcagcagtc tggacttgag
ctggtgaagc ctggggcttc agtgaagatg 60tcctgcaagg cttctggata cacattcact
gactacaaca tgcactgggt gaagcagagc 120catggaaaga gccttgagtg gattggatat
attaagcctc acaatggtgg tactacctac 180aacccgaagt tcgagggcaa ggccacattg
actgtaaaca agtcttccag cacagcctac 240atggagctcc gcagcctgac atcggaggat
tctgcagtct attactgtgt aagatgcgat 300tttctctact ggtatttcga tgtctggggc
acagggacca cggtcaccgt ctcctca 357185PRTArtificial Sequencesynthetic
polypeptide 18Asp Tyr Asn Met His1 51917PRTArtificial
Sequencesynthetic polypeptide 19Tyr Ile Lys Pro His Asn Gly Gly Thr Thr
Tyr Asn Pro Lys Phe Glu1 5 10
15Gly2010PRTArtificial Sequencesynthetic polypeptide 20Cys Asp Phe
Leu Tyr Trp Tyr Phe Asp Val1 5
1021108PRTArtificial Sequencesynthetic polypeptide 21Asp Ile Val Met Thr
Gln Ser Pro Ala Ile Met Ser Ala Ser Leu Gly1 5
10 15Glu Arg Val Thr Met Thr Cys Thr Ala Ser Ser
Ser Val Ser Ser Ser 20 25
30Tyr Leu His Trp Tyr Gln Gln Lys Pro Gly Ser Ser Pro Lys Leu Trp
35 40 45Ile Tyr Ser Thr Ser Asn Leu Ala
Ser Gly Val Pro Gly Arg Phe Ser 50 55
60Gly Ser Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile Ser Ser Met Glu65
70 75 80Ala Glu Asp Ala Ala
Thr Tyr Tyr Cys His Gln Tyr His Arg Ser Pro 85
90 95Leu Thr Phe Gly Ala Gly Thr Lys Leu Glu Met
Lys 100 10522324DNAArtificial
Sequencesynthetic polynucleotide 22gacattgtga tgacccagtc tccagcaatc
atgtctgcat ctctagggga acgggtcacc 60atgacctgca ctgccagctc aagtgtaagt
tccagttact tgcactggta ccagcagaag 120ccaggatcct cccccaaact ctggatttat
agcacatcca acctggcttc tggagtccca 180ggtcgcttca gtggcagtgg gtctgggacc
tcttactctc tcacaatcag cagcatggag 240gctgaagatg ctgccactta ttactgccac
cagtatcatc gttccccgct cacgttcggt 300gctgggacca agctggaaat gaaa
3242312PRTArtificial Sequencesynthetic
polypeptide 23Thr Ala Ser Ser Ser Val Ser Ser Ser Tyr Leu His1
5 10247PRTArtificial Sequencesynthetic polypeptide
24Ser Thr Ser Asn Leu Ala Ser1 5259PRTArtificial
Sequencesynthetic polypeptide 25His Gln Tyr His Arg Ser Pro Leu Thr1
526449PRTArtificial Sequencesynthetic polypeptide 26Gln Val Gln
Leu Gln Gln Ser Gly Leu Glu Leu Val Lys Pro Gly Ala1 5
10 15Ser Val Lys Met Ser Cys Lys Ala Ser
Gly Tyr Thr Phe Thr Asp Tyr 20 25
30Asn Met His Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Trp Ile
35 40 45Gly Tyr Ile Lys Pro His Asn
Gly Gly Thr Thr Tyr Asn Pro Lys Phe 50 55
60Glu Gly Lys Ala Thr Leu Thr Val Asn Lys Ser Ser Ser Thr Ala Tyr65
70 75 80Met Glu Leu Arg
Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85
90 95Val Arg Cys Asp Phe Leu Tyr Trp Tyr Phe
Asp Val Trp Gly Thr Gly 100 105
110Thr Thr Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe
115 120 125Pro Leu Ala Pro Ser Ser Lys
Ser Thr Ser Gly Gly Thr Ala Ala Leu 130 135
140Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser
Trp145 150 155 160Asn Ser
Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu
165 170 175Gln Ser Ser Gly Leu Tyr Ser
Leu Ser Ser Val Val Thr Val Pro Ser 180 185
190Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His
Lys Pro 195 200 205Ser Asn Thr Lys
Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys 210
215 220Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu
Leu Gly Gly Pro225 230 235
240Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser
245 250 255Arg Thr Pro Glu Val
Thr Cys Val Val Val Asp Val Ser His Glu Asp 260
265 270Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val
Glu Val His Asn 275 280 285Ala Lys
Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val 290
295 300Val Ser Val Leu Thr Val Leu His Gln Asp Trp
Leu Asn Gly Lys Glu305 310 315
320Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys
325 330 335Thr Ile Ser Lys
Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr 340
345 350Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn
Gln Val Ser Leu Thr 355 360 365Cys
Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 370
375 380Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys
Thr Thr Pro Pro Val Leu385 390 395
400Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp
Lys 405 410 415Ser Arg Trp
Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu 420
425 430Ala Leu His Asn His Tyr Thr Gln Lys Ser
Leu Ser Leu Ser Pro Gly 435 440
445Lys27445PRTArtificial Sequencesynthetic polypeptide 27Gln Val Gln Leu
Gln Gln Ser Gly Leu Glu Leu Val Lys Pro Gly Ala1 5
10 15Ser Val Lys Met Ser Cys Lys Ala Ser Gly
Tyr Thr Phe Thr Asp Tyr 20 25
30Asn Met His Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Trp Ile
35 40 45Gly Tyr Ile Lys Pro His Asn Gly
Gly Thr Thr Tyr Asn Pro Lys Phe 50 55
60Glu Gly Lys Ala Thr Leu Thr Val Asn Lys Ser Ser Ser Thr Ala Tyr65
70 75 80Met Glu Leu Arg Ser
Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85
90 95Val Arg Cys Asp Phe Leu Tyr Trp Tyr Phe Asp
Val Trp Gly Thr Gly 100 105
110Thr Thr Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe
115 120 125Pro Leu Ala Pro Cys Ser Arg
Ser Thr Ser Glu Ser Thr Ala Ala Leu 130 135
140Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser
Trp145 150 155 160Asn Ser
Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu
165 170 175Gln Ser Ser Gly Leu Tyr Ser
Leu Ser Ser Val Val Thr Val Pro Ser 180 185
190Ser Asn Phe Gly Thr Gln Thr Tyr Thr Cys Asn Val Asp His
Lys Pro 195 200 205Ser Asn Thr Lys
Val Asp Lys Thr Val Glu Arg Lys Cys Cys Val Glu 210
215 220Cys Pro Pro Cys Pro Ala Pro Pro Val Ala Gly Pro
Ser Val Phe Leu225 230 235
240Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu
245 250 255Val Thr Cys Val Val
Val Asp Val Ser His Glu Asp Pro Glu Val Gln 260
265 270Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn
Ala Lys Thr Lys 275 280 285Pro Arg
Glu Glu Gln Phe Asn Ser Thr Phe Arg Val Val Ser Val Leu 290
295 300Thr Val Val His Gln Asp Trp Leu Asn Gly Lys
Glu Tyr Lys Cys Lys305 310 315
320Val Ser Asn Lys Gly Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys
325 330 335Thr Lys Gly Gln
Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser 340
345 350Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu
Thr Cys Leu Val Lys 355 360 365Gly
Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln 370
375 380Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro
Met Leu Asp Ser Asp Gly385 390 395
400Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp
Gln 405 410 415Gln Gly Asn
Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn 420
425 430His Tyr Thr Gln Lys Ser Leu Ser Leu Ser
Pro Gly Lys 435 440
44528215PRTArtificial Sequencesynthetic polypeptide 28Asp Ile Val Met Thr
Gln Ser Pro Ala Ile Met Ser Ala Ser Leu Gly1 5
10 15Glu Arg Val Thr Met Thr Cys Thr Ala Ser Ser
Ser Val Ser Ser Ser 20 25
30Tyr Leu His Trp Tyr Gln Gln Lys Pro Gly Ser Ser Pro Lys Leu Trp
35 40 45Ile Tyr Ser Thr Ser Asn Leu Ala
Ser Gly Val Pro Gly Arg Phe Ser 50 55
60Gly Ser Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile Ser Ser Met Glu65
70 75 80Ala Glu Asp Ala Ala
Thr Tyr Tyr Cys His Gln Tyr His Arg Ser Pro 85
90 95Leu Thr Phe Gly Ala Gly Thr Lys Leu Glu Met
Lys Arg Thr Val Ala 100 105
110Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser
115 120 125Gly Thr Ala Ser Val Val Cys
Leu Leu Asn Asn Phe Tyr Pro Arg Glu 130 135
140Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn
Ser145 150 155 160Gln Glu
Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu
165 170 175Ser Ser Thr Leu Thr Leu Ser
Lys Ala Asp Tyr Glu Lys His Lys Val 180 185
190Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val
Thr Lys 195 200 205Ser Phe Asn Arg
Gly Glu Cys 210 21529118PRTArtificial
Sequencesynthetic polypeptide 29Gln Val His Leu Gln Gln Ser Gly Ala Glu
Leu Ala Lys Pro Gly Ala1 5 10
15Ser Val Asn Leu Ser Cys Lys Ala Ser Gly Tyr Ala Phe Thr Ser Tyr
20 25 30Trp Met His Trp Val Lys
Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile 35 40
45Gly Tyr Ile Asn Pro Ser Ser Gly Leu Ala Lys Tyr Asn Gln
Lys Phe 50 55 60Lys Asp Lys Ala Thr
Leu Thr Thr Asp Lys Ser Ser Asn Thr Ala Tyr65 70
75 80Met Gln Leu Ser Ser Leu Thr Tyr Asp Asp
Ser Ala Val Tyr Tyr Cys 85 90
95Gly Arg Trp Leu Leu Ser Ala Trp Phe Ala Tyr Trp Gly Gln Gly Thr
100 105 110Leu Val Thr Val Ser
Ala 11530354DNAArtificial Sequencesynthetic polynucleotide
30caggtccacc tgcagcagtc tggggctgaa ctggcaaaac ctggggcctc agtgaacctg
60tcctgcaagg cttctggcta cgcctttact agttactgga tgcactgggt aaaacagagg
120cctggacagg gtctggaatg gattggatac attaatccta gcagtggtct tgctaagtat
180aatcagaagt tcaaagacaa ggccacattg actacagaca aatcttccaa cacagcctac
240atgcaactga gcagcctgac atatgacgac tctgcagtct attactgtgg aagatggtta
300ctttcggcct ggtttgctta ctggggccaa gggactctgg tcactgtctc tgca
354315PRTArtificial Sequencesynthetic polypeptide 31Ser Tyr Trp Met His1
53217PRTArtificial Sequencesynthetic polypeptide 32Tyr Ile
Asn Pro Ser Ser Gly Leu Ala Lys Tyr Asn Gln Lys Phe Lys1 5
10 15Asp339PRTArtificial
Sequencesynthetic polypeptide 33Trp Leu Leu Ser Ala Trp Phe Ala Tyr1
534107PRTArtificial Sequencesynthetic polypeptide 34Asp Ile Lys
Met Thr Gln Ser Pro Ser Ser Ile Tyr Ala Ser Leu Gly1 5
10 15Glu Arg Val Thr Ile Thr Cys Lys Ala
Ser Gln Gly Ile Asn Thr Tyr 20 25
30Leu Ser Trp Phe Gln Gln Lys Pro Gly Lys Ser Pro Lys Thr Leu Ile
35 40 45Tyr Arg Ala Asn Ile Leu Val
Asp Gly Val Pro Ser Arg Phe Ser Gly 50 55
60Ser Gly Ser Gly Gln Asp Tyr Ser Leu Thr Ile Asn Ser Leu Glu Tyr65
70 75 80Glu Asp Met Gly
Ile Tyr Tyr Cys Leu Gln Tyr Asp Glu Phe Pro Tyr 85
90 95Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile
Lys 100 10535321DNAArtificial
Sequencesynthetic polynucleotide 35gacatcaaga tgacccagtc tccatcttcc
atatatgcat ctctaggaga gagagtcact 60atcacttgca aggcgagtca gggcattaat
acctatttaa gctggttcca gcagaaacca 120ggaaaatctc ctaagaccct gatctatcgt
gcaaacatct tggtagatgg ggtcccatca 180aggttcagtg gcagtggatc tgggcaagat
tattctctca ccatcaacag cctggagtat 240gaagatatgg gaatttatta ttgtctacag
tatgatgagt ttccgtacac gttcggaggg 300gggaccaagc tggaaataaa a
3213611PRTArtificial Sequencesynthetic
polypeptide 36Lys Ala Ser Gln Gly Ile Asn Thr Tyr Leu Ser1
5 10377PRTArtificial Sequencesynthetic polypeptide
37Arg Ala Asn Ile Leu Val Asp1 5389PRTArtificial
Sequencesynthetic polypeptide 38Leu Gln Tyr Asp Glu Phe Pro Tyr Thr1
539444PRTArtificial Sequencesynthetic polypeptide 39Gln Val His
Leu Gln Gln Ser Gly Ala Glu Leu Ala Lys Pro Gly Ala1 5
10 15Ser Val Asn Leu Ser Cys Lys Ala Ser
Gly Tyr Ala Phe Thr Ser Tyr 20 25
30Trp Met His Trp Val Lys Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile
35 40 45Gly Tyr Ile Asn Pro Ser Ser
Gly Leu Ala Lys Tyr Asn Gln Lys Phe 50 55
60Lys Asp Lys Ala Thr Leu Thr Thr Asp Lys Ser Ser Asn Thr Ala Tyr65
70 75 80Met Gln Leu Ser
Ser Leu Thr Tyr Asp Asp Ser Ala Val Tyr Tyr Cys 85
90 95Gly Arg Trp Leu Leu Ser Ala Trp Phe Ala
Tyr Trp Gly Gln Gly Thr 100 105
110Leu Val Thr Val Ser Ala Ala Ser Thr Lys Gly Pro Ser Val Phe Pro
115 120 125Leu Ala Pro Cys Ser Arg Ser
Thr Ser Glu Ser Thr Ala Ala Leu Gly 130 135
140Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp
Asn145 150 155 160Ser Gly
Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln
165 170 175Ser Ser Gly Leu Tyr Ser Leu
Ser Ser Val Val Thr Val Pro Ser Ser 180 185
190Asn Phe Gly Thr Gln Thr Tyr Thr Cys Asn Val Asp His Lys
Pro Ser 195 200 205Asn Thr Lys Val
Asp Lys Thr Val Glu Arg Lys Cys Cys Val Glu Cys 210
215 220Pro Pro Cys Pro Ala Pro Pro Val Ala Gly Pro Ser
Val Phe Leu Phe225 230 235
240Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val
245 250 255Thr Cys Val Val Val
Asp Val Ser His Glu Asp Pro Glu Val Gln Phe 260
265 270Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala
Lys Thr Lys Pro 275 280 285Arg Glu
Glu Gln Phe Asn Ser Thr Phe Arg Val Val Ser Val Leu Thr 290
295 300Val Val His Gln Asp Trp Leu Asn Gly Lys Glu
Tyr Lys Cys Lys Val305 310 315
320Ser Asn Lys Gly Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr
325 330 335Lys Gly Gln Pro
Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg 340
345 350Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr
Cys Leu Val Lys Gly 355 360 365Phe
Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro 370
375 380Glu Asn Asn Tyr Lys Thr Thr Pro Pro Met
Leu Asp Ser Asp Gly Ser385 390 395
400Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln
Gln 405 410 415Gly Asn Val
Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His 420
425 430Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro
Gly Lys 435 44040214PRTArtificial
Sequencesynthetic polypeptide 40Asp Ile Lys Met Thr Gln Ser Pro Ser Ser
Ile Tyr Ala Ser Leu Gly1 5 10
15Glu Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Gly Ile Asn Thr Tyr
20 25 30Leu Ser Trp Phe Gln Gln
Lys Pro Gly Lys Ser Pro Lys Thr Leu Ile 35 40
45Tyr Arg Ala Asn Ile Leu Val Asp Gly Val Pro Ser Arg Phe
Ser Gly 50 55 60Ser Gly Ser Gly Gln
Asp Tyr Ser Leu Thr Ile Asn Ser Leu Glu Tyr65 70
75 80Glu Asp Met Gly Ile Tyr Tyr Cys Leu Gln
Tyr Asp Glu Phe Pro Tyr 85 90
95Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala Ala
100 105 110Pro Ser Val Phe Ile
Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly 115
120 125Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr
Pro Arg Glu Ala 130 135 140Lys Val Gln
Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145
150 155 160Glu Ser Val Thr Glu Gln Asp
Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165
170 175Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys
His Lys Val Tyr 180 185 190Ala
Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser 195
200 205Phe Asn Arg Gly Glu Cys
21041118PRTArtificial Sequencesynthetic polypeptide 41Gln Val Gln Leu Gln
Gln Ser Gly Ala Glu Leu Ala Lys Pro Gly Ala1 5
10 15Ser Val Lys Leu Ser Cys Lys Ala Ser Gly Tyr
Thr Phe Thr Ser Tyr 20 25
30Trp Met His Trp Val Lys Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile
35 40 45Gly Tyr Ile Asn Pro Ser Ser Gly
Tyr Thr Lys Ser Asn Gln Lys Phe 50 55
60Lys Asp Lys Ala Thr Leu Thr Ala Asp Lys Ser Ser Ser Thr Ala Tyr65
70 75 80Met Gln Leu Ser Ser
Leu Thr Tyr Glu Asp Ser Ala Val Tyr Tyr Cys 85
90 95Gly Arg Trp Leu Leu Ser Ala Trp Phe Ala Tyr
Trp Gly Gln Gly Thr 100 105
110Leu Val Thr Val Ser Ala 11542354DNAArtificial Sequencesynthetic
polynucleotide 42caggtccagc tgcagcagtc tggggctgaa ctggcaaaac ctggggcctc
agtgaagctg 60tcctgcaagg cttctggcta cacctttact agttactgga tgcactgggt
aaaacagagg 120cctggacagg gtctggaatg gattggatac attaatccta gcagtggtta
tactaagtcc 180aatcagaagt tcaaggacaa ggccacattg actgcagaca aatcctccag
cacagcctac 240atgcagctga gcagcctgac atatgaggac tctgcagtct attactgtgg
aagatggtta 300ctttcggcct ggtttgctta ctggggccaa gggactctgg tcactgtctc
tgca 354435PRTArtificial Sequencesynthetic polypeptide 43Ser Tyr
Trp Met His1 54417PRTArtificial Sequencesynthetic
polypeptide 44Tyr Ile Asn Pro Ser Ser Gly Tyr Thr Lys Ser Asn Gln Lys Phe
Lys1 5 10
15Asp459PRTArtificial Sequencesynthetic polypeptide 45Trp Leu Leu Ser Ala
Trp Phe Ala Tyr1 546107PRTArtificial Sequencesynthetic
polypeptide 46Asp Ile Arg Met Thr Gln Ser Pro Ser Ser Met Tyr Ala Ser Leu
Gly1 5 10 15Glu Arg Val
Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asn Thr Tyr 20
25 30Leu Ser Trp Phe Gln Gln Lys Pro Gly Lys
Ser Pro Lys Ser Leu Ile 35 40
45Tyr Arg Ser Asn Ile Leu Val Asp Gly Val Pro Ser Arg Phe Ser Gly 50
55 60Ser Gly Ser Gly Gln Asp Tyr Ser Leu
Thr Ile Ser Ser Leu Glu Tyr65 70 75
80Glu Asp Met Gly Ile Tyr Tyr Cys Leu Gln Tyr Asp Asp Phe
Pro Tyr 85 90 95Thr Phe
Gly Gly Gly Thr Lys Leu Glu Ile Lys 100
10547321DNAArtificial Sequencesynthetic polynucleotide 47gacatcagga
tgacccagtc tccatcttcc atgtatgcat ctctaggaga gagagtcact 60atcacttgca
aggcgagtca ggacattaat acctatttaa gctggttcca gcagaaacca 120ggaaaatctc
ctaagtccct gatctatcgc tcaaacatct tggtagatgg ggtcccatca 180agattcagtg
gcagtggatc tggtcaagat tattctctca ccatcagcag cctggagtat 240gaggatatgg
gaatttatta ttgtctacag tatgatgact ttccgtacac gttcggaggg 300gggaccaagc
tggaaataaa a
3214811PRTArtificial Sequencesynthetic polypeptide 48Lys Ala Ser Gln Asp
Ile Asn Thr Tyr Leu Ser1 5
10497PRTArtificial Sequencesynthetic polypeptide 49Arg Ser Asn Ile Leu
Val Asp1 5509PRTArtificial Sequencesynthetic polypeptide
50Leu Gln Tyr Asp Asp Phe Pro Tyr Thr1 551444PRTArtificial
Sequencesynthetic polypeptide 51Gln Val Gln Leu Gln Gln Ser Gly Ala Glu
Leu Ala Lys Pro Gly Ala1 5 10
15Ser Val Lys Leu Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr
20 25 30Trp Met His Trp Val Lys
Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile 35 40
45Gly Tyr Ile Asn Pro Ser Ser Gly Tyr Thr Lys Ser Asn Gln
Lys Phe 50 55 60Lys Asp Lys Ala Thr
Leu Thr Ala Asp Lys Ser Ser Ser Thr Ala Tyr65 70
75 80Met Gln Leu Ser Ser Leu Thr Tyr Glu Asp
Ser Ala Val Tyr Tyr Cys 85 90
95Gly Arg Trp Leu Leu Ser Ala Trp Phe Ala Tyr Trp Gly Gln Gly Thr
100 105 110Leu Val Thr Val Ser
Ala Ala Ser Thr Lys Gly Pro Ser Val Phe Pro 115
120 125Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser Thr
Ala Ala Leu Gly 130 135 140Cys Leu Val
Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn145
150 155 160Ser Gly Ala Leu Thr Ser Gly
Val His Thr Phe Pro Ala Val Leu Gln 165
170 175Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr
Val Pro Ser Ser 180 185 190Asn
Phe Gly Thr Gln Thr Tyr Thr Cys Asn Val Asp His Lys Pro Ser 195
200 205Asn Thr Lys Val Asp Lys Thr Val Glu
Arg Lys Cys Cys Val Glu Cys 210 215
220Pro Pro Cys Pro Ala Pro Pro Val Ala Gly Pro Ser Val Phe Leu Phe225
230 235 240Pro Pro Lys Pro
Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val 245
250 255Thr Cys Val Val Val Asp Val Ser His Glu
Asp Pro Glu Val Gln Phe 260 265
270Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro
275 280 285Arg Glu Glu Gln Phe Asn Ser
Thr Phe Arg Val Val Ser Val Leu Thr 290 295
300Val Val His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys
Val305 310 315 320Ser Asn
Lys Gly Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr
325 330 335Lys Gly Gln Pro Arg Glu Pro
Gln Val Tyr Thr Leu Pro Pro Ser Arg 340 345
350Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val
Lys Gly 355 360 365Phe Tyr Pro Ser
Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro 370
375 380Glu Asn Asn Tyr Lys Thr Thr Pro Pro Met Leu Asp
Ser Asp Gly Ser385 390 395
400Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln
405 410 415Gly Asn Val Phe Ser
Cys Ser Val Met His Glu Ala Leu His Asn His 420
425 430Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys
435 44052448PRTArtificial Sequencesynthetic
polypeptide 52Gln Val Gln Leu Gln Gln Ser Gly Ala Glu Leu Ala Lys Pro Gly
Ala1 5 10 15Ser Val Lys
Leu Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20
25 30Trp Met His Trp Val Lys Gln Arg Pro Gly
Gln Gly Leu Glu Trp Ile 35 40
45Gly Tyr Ile Asn Pro Ser Ser Gly Tyr Thr Lys Ser Asn Gln Lys Phe 50
55 60Lys Asp Lys Ala Thr Leu Thr Ala Asp
Lys Ser Ser Ser Thr Ala Tyr65 70 75
80Met Gln Leu Ser Ser Leu Thr Tyr Glu Asp Ser Ala Val Tyr
Tyr Cys 85 90 95Gly Arg
Trp Leu Leu Ser Ala Trp Phe Ala Tyr Trp Gly Gln Gly Thr 100
105 110Leu Val Thr Val Ser Ala Ala Ser Thr
Lys Gly Pro Ser Val Phe Pro 115 120
125Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly
130 135 140Cys Leu Val Lys Asp Tyr Phe
Pro Glu Pro Val Thr Val Ser Trp Asn145 150
155 160Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro
Ala Val Leu Gln 165 170
175Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser
180 185 190Ser Leu Gly Thr Gln Thr
Tyr Ile Cys Asn Val Asn His Lys Pro Ser 195 200
205Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp
Lys Thr 210 215 220His Thr Cys Pro Pro
Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser225 230
235 240Val Phe Leu Phe Pro Pro Lys Pro Lys Asp
Thr Leu Met Ile Ser Arg 245 250
255Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro
260 265 270Glu Val Lys Phe Asn
Trp Tyr Val Asp Gly Val Glu Val His Asn Ala 275
280 285Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr
Tyr Arg Val Val 290 295 300Ser Val Leu
Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr305
310 315 320Lys Cys Lys Val Ser Asn Lys
Ala Leu Pro Ala Pro Ile Glu Lys Thr 325
330 335Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln
Val Tyr Thr Leu 340 345 350Pro
Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys 355
360 365Leu Val Lys Gly Phe Tyr Pro Ser Asp
Ile Ala Val Glu Trp Glu Ser 370 375
380Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp385
390 395 400Ser Asp Gly Ser
Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser 405
410 415Arg Trp Gln Gln Gly Asn Val Phe Ser Cys
Ser Val Met His Glu Ala 420 425
430Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys
435 440 44553214PRTArtificial
Sequencesynthetic polypeptide 53Asp Ile Arg Met Thr Gln Ser Pro Ser Ser
Met Tyr Ala Ser Leu Gly1 5 10
15Glu Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asn Thr Tyr
20 25 30Leu Ser Trp Phe Gln Gln
Lys Pro Gly Lys Ser Pro Lys Ser Leu Ile 35 40
45Tyr Arg Ser Asn Ile Leu Val Asp Gly Val Pro Ser Arg Phe
Ser Gly 50 55 60Ser Gly Ser Gly Gln
Asp Tyr Ser Leu Thr Ile Ser Ser Leu Glu Tyr65 70
75 80Glu Asp Met Gly Ile Tyr Tyr Cys Leu Gln
Tyr Asp Asp Phe Pro Tyr 85 90
95Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala Ala
100 105 110Pro Ser Val Phe Ile
Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly 115
120 125Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr
Pro Arg Glu Ala 130 135 140Lys Val Gln
Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145
150 155 160Glu Ser Val Thr Glu Gln Asp
Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165
170 175Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys
His Lys Val Tyr 180 185 190Ala
Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser 195
200 205Phe Asn Arg Gly Glu Cys
21054119PRTArtificial Sequencesynthetic polypeptide 54Gln Val Gln Leu Lys
Glu Ser Gly Pro Gly Leu Val Ala Pro Ser Gln1 5
10 15Ser Leu Ser Ile Thr Cys Thr Val Ser Gly Phe
Ser Leu Thr Asn Tyr 20 25
30Gly Val His Trp Val Arg Gln Pro Pro Gly Lys Gly Leu Glu Trp Leu
35 40 45Gly Val Ile Trp Ala Gly Gly Ser
Thr Asn Tyr Asn Ser Ala Leu Met 50 55
60Ser Arg Leu Ser Ile Ser Lys Asp Asn Ser Lys Ser Gln Leu Phe Leu65
70 75 80Lys Met Asn Ser Leu
Gln Ala Asp Asp Thr Ala Met Tyr Tyr Cys Ala 85
90 95Arg Glu Arg Gly Ser Ser Trp Gly Thr Met Asp
Tyr Trp Gly Gln Gly 100 105
110Thr Ser Val Thr Val Ser Ser 11555357DNAArtificial
Sequencesynthetic polynucleotide 55caggtgcagc tgaaggagtc aggacctggc
ctggtggcgc cctcacagag cctgtccatc 60acttgcactg tctctgggtt ttcattaacc
aactatggtg tacactgggt tcgccagcct 120ccaggaaagg gtctggagtg gctgggagta
atatgggctg gtggaagcac aaattataat 180tcggctctca tgtccagact gagcatcagc
aaagacaact ccaagagcca acttttctta 240aaaatgaaca gtctgcaagc tgatgacaca
gccatgtact actgtgccag agagaggggt 300agtagctggg ggactatgga ctactggggt
caaggaacct cagtcactgt ctcctca 357565PRTArtificial Sequencesynthetic
polypeptide 56Asn Tyr Gly Val His1 55716PRTArtificial
Sequencesynthetic polypeptide 57Val Ile Trp Ala Gly Gly Ser Thr Asn Tyr
Asn Ser Ala Leu Met Ser1 5 10
155811PRTArtificial Sequencesynthetic polypeptide 58Glu Arg Gly Ser
Ser Trp Gly Thr Met Asp Tyr1 5
1059106PRTArtificial Sequencesynthetic polypeptide 59Gln Ile Val Leu Thr
Gln Ser Pro Ala Ile Met Ser Ala Ser Pro Gly1 5
10 15Glu Lys Val Thr Met Thr Cys Ser Ala Ser Ser
Arg Val Ser Tyr Met 20 25
30His Trp Tyr Gln Gln Lys Ser Gly Thr Ser Pro Lys Arg Trp Ile Tyr
35 40 45Asp Thr Ser Gln Leu Ala Ser Gly
Val Pro Ala Arg Phe Ser Gly Ser 50 55
60Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile Ser Ser Met Glu Ala Glu65
70 75 80Asp Ala Ala Thr Tyr
Tyr Cys Gln Gln Trp Ser Ser Asn Pro Tyr Thr 85
90 95Phe Gly Gly Gly Thr Lys Leu Glu Met Arg
100 10560318DNAArtificial Sequencesynthetic
polynucleotide 60caaattgttc tcacccagtc tccagcaatc atgtctgcat ctccagggga
gaaggtcacc 60atgacctgca gtgccagctc acgtgtaagt tacatgcact ggtaccagca
gaagtcaggc 120acctccccca aaagatggat ttatgacaca tcccaactgg cttctggagt
ccctgctcgc 180ttcagtggca gtgggtctgg gacctcttac tctctcacaa tcagcagcat
ggaggctgaa 240gatgctgcca cttattactg ccagcagtgg agtagtaacc catacacgtt
cggagggggg 300accaagctgg aaatgaga
3186110PRTArtificial Sequencesynthetic polypeptide 61Ser Ala
Ser Ser Arg Val Ser Tyr Met His1 5
10627PRTArtificial Sequencesynthetic polypeptide 62Asp Thr Ser Gln Leu
Ala Ser1 5639PRTArtificial Sequencesynthetic polypeptide
63Gln Gln Trp Ser Ser Asn Pro Tyr Thr1 564445PRTArtificial
Sequencesynthetic polypeptide 64Gln Val Gln Leu Lys Glu Ser Gly Pro Gly
Leu Val Ala Pro Ser Gln1 5 10
15Ser Leu Ser Ile Thr Cys Thr Val Ser Gly Phe Ser Leu Thr Asn Tyr
20 25 30Gly Val His Trp Val Arg
Gln Pro Pro Gly Lys Gly Leu Glu Trp Leu 35 40
45Gly Val Ile Trp Ala Gly Gly Ser Thr Asn Tyr Asn Ser Ala
Leu Met 50 55 60Ser Arg Leu Ser Ile
Ser Lys Asp Asn Ser Lys Ser Gln Leu Phe Leu65 70
75 80Lys Met Asn Ser Leu Gln Ala Asp Asp Thr
Ala Met Tyr Tyr Cys Ala 85 90
95Arg Glu Arg Gly Ser Ser Trp Gly Thr Met Asp Tyr Trp Gly Gln Gly
100 105 110Thr Ser Val Thr Val
Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe 115
120 125Pro Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser
Thr Ala Ala Leu 130 135 140Gly Cys Leu
Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp145
150 155 160Asn Ser Gly Ala Leu Thr Ser
Gly Val His Thr Phe Pro Ala Val Leu 165
170 175Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val
Thr Val Pro Ser 180 185 190Ser
Asn Phe Gly Thr Gln Thr Tyr Thr Cys Asn Val Asp His Lys Pro 195
200 205Ser Asn Thr Lys Val Asp Lys Thr Val
Glu Arg Lys Cys Cys Val Glu 210 215
220Cys Pro Pro Cys Pro Ala Pro Pro Val Ala Gly Pro Ser Val Phe Leu225
230 235 240Phe Pro Pro Lys
Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu 245
250 255Val Thr Cys Val Val Val Asp Val Ser His
Glu Asp Pro Glu Val Gln 260 265
270Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys
275 280 285Pro Arg Glu Glu Gln Phe Asn
Ser Thr Phe Arg Val Val Ser Val Leu 290 295
300Thr Val Val His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys
Lys305 310 315 320Val Ser
Asn Lys Gly Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys
325 330 335Thr Lys Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr Leu Pro Pro Ser 340 345
350Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu
Val Lys 355 360 365Gly Phe Tyr Pro
Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln 370
375 380Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Met Leu
Asp Ser Asp Gly385 390 395
400Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln
405 410 415Gln Gly Asn Val Phe
Ser Cys Ser Val Met His Glu Ala Leu His Asn 420
425 430His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly
Lys 435 440 44565213PRTArtificial
Sequencesynthetic polypeptide 65Gln Ile Val Leu Thr Gln Ser Pro Ala Ile
Met Ser Ala Ser Pro Gly1 5 10
15Glu Lys Val Thr Met Thr Cys Ser Ala Ser Ser Arg Val Ser Tyr Met
20 25 30His Trp Tyr Gln Gln Lys
Ser Gly Thr Ser Pro Lys Arg Trp Ile Tyr 35 40
45Asp Thr Ser Gln Leu Ala Ser Gly Val Pro Ala Arg Phe Ser
Gly Ser 50 55 60Gly Ser Gly Thr Ser
Tyr Ser Leu Thr Ile Ser Ser Met Glu Ala Glu65 70
75 80Asp Ala Ala Thr Tyr Tyr Cys Gln Gln Trp
Ser Ser Asn Pro Tyr Thr 85 90
95Phe Gly Gly Gly Thr Lys Leu Glu Met Arg Arg Thr Val Ala Ala Pro
100 105 110Ser Val Phe Ile Phe
Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr 115
120 125Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro
Arg Glu Ala Lys 130 135 140Val Gln Trp
Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu145
150 155 160Ser Val Thr Glu Gln Asp Ser
Lys Asp Ser Thr Tyr Ser Leu Ser Ser 165
170 175Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His
Lys Val Tyr Ala 180 185 190Cys
Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe 195
200 205Asn Arg Gly Glu Cys
21066119PRTArtificial Sequencesynthetic polypeptide 66Gln Val Gln Leu Val
Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5
10 15Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr
Thr Phe Thr Asp Tyr 20 25
30Asn Met His Trp Val Arg Gln Ser Pro Gly Lys Ser Leu Glu Trp Ile
35 40 45Gly Tyr Ile Lys Pro His Asn Ala
Gly Thr Thr Tyr Asn Pro Lys Phe 50 55
60Glu Gly Arg Ala Thr Leu Thr Val Asp Thr Ser Ala Ser Thr Ala Tyr65
70 75 80Met Glu Leu Ser Ser
Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Val Arg Ser Asp Phe Leu Tyr Trp Tyr Phe Asp
Val Trp Gly Gln Gly 100 105
110Thr Thr Val Thr Val Ser Ser 11567119PRTArtificial
Sequencesynthetic polypeptide 67Gln Val Gln Leu Val Gln Ser Gly Ala Glu
Val Lys Lys Pro Gly Ala1 5 10
15Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr
20 25 30Asn Met His Trp Val Lys
Gln Ser His Gly Lys Ser Leu Glu Trp Ile 35 40
45Gly Tyr Ile Lys Pro His Asn Ala Gly Thr Thr Tyr Asn Pro
Lys Phe 50 55 60Glu Gly Arg Ala Thr
Leu Thr Val Asp Thr Ser Ala Ser Thr Ala Tyr65 70
75 80Met Glu Leu Arg Ser Leu Arg Ser Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90
95Val Arg Ser Asp Phe Leu Tyr Trp Tyr Phe Asp Val Trp Gly Gln Gly
100 105 110Thr Thr Val Thr Val
Ser Ser 11568108PRTArtificial Sequencesynthetic polypeptide 68Asp
Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1
5 10 15Asp Arg Val Thr Ile Thr Cys
Thr Ala Ser Ser Ser Val Ser Ser Ser 20 25
30Tyr Leu His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys
Leu Leu 35 40 45Ile Tyr Ser Thr
Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser 50 55
60Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser
Ser Leu Gln65 70 75
80Pro Glu Asp Phe Ala Thr Tyr Tyr Cys His Gln Tyr His Arg Ser Pro
85 90 95Leu Thr Phe Gly Ala Gly
Thr Lys Leu Glu Ile Lys 100
10569108PRTArtificial Sequencesynthetic polypeptide 69Asp Ile Gln Met Thr
Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5
10 15Asp Arg Val Thr Ile Thr Cys Thr Ala Ser Ser
Ser Val Ser Ser Ser 20 25
30Tyr Leu His Trp Tyr Gln Gln Lys Pro Gly Ser Ala Pro Lys Leu Trp
35 40 45Ile Tyr Ser Thr Ser Asn Leu Ala
Ser Gly Val Pro Ser Arg Phe Ser 50 55
60Gly Ser Gly Ser Gly Thr Asp Tyr Thr Leu Thr Ile Ser Ser Leu Gln65
70 75 80Pro Glu Asp Phe Ala
Thr Tyr Tyr Cys His Gln Tyr His Arg Ser Pro 85
90 95Leu Thr Phe Gly Ala Gly Thr Lys Leu Glu Ile
Lys 100 10570108PRTArtificial
Sequencesynthetic polypeptide 70Asp Ile Val Met Thr Gln Ser Pro Ser Ser
Leu Ser Ala Ser Val Gly1 5 10
15Asp Arg Val Thr Ile Thr Cys Thr Ala Ser Ser Ser Val Ser Ser Ser
20 25 30Tyr Leu His Trp Tyr Gln
Gln Lys Pro Gly Ser Ser Pro Lys Leu Trp 35 40
45Ile Tyr Ser Thr Ser Asn Leu Ala Ser Gly Val Pro Gly Arg
Phe Ser 50 55 60Gly Ser Gly Ser Gly
Thr Asp Tyr Thr Leu Thr Ile Ser Ser Leu Gln65 70
75 80Pro Glu Asp Phe Ala Thr Tyr Tyr Cys His
Gln Tyr His Arg Ser Pro 85 90
95Leu Thr Phe Gly Ala Gly Thr Lys Leu Glu Ile Lys 100
10571449PRTArtificial Sequencesynthetic polypeptide 71Gln Val
Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5
10 15Ser Val Lys Met Ser Cys Lys Ala
Ser Gly Tyr Thr Phe Thr Asp Tyr 20 25
30Asn Met His Trp Val Arg Gln Ser Pro Gly Lys Ser Leu Glu Trp
Ile 35 40 45Gly Tyr Ile Lys Pro
His Asn Ala Gly Thr Thr Tyr Asn Pro Lys Phe 50 55
60Glu Gly Arg Ala Thr Leu Thr Val Asp Thr Ser Ala Ser Thr
Ala Tyr65 70 75 80Met
Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Val Arg Ser Asp Phe Leu Tyr
Trp Tyr Phe Asp Val Trp Gly Gln Gly 100 105
110Thr Thr Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser
Val Phe 115 120 125Pro Leu Ala Pro
Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu 130
135 140Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val
Thr Val Ser Trp145 150 155
160Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu
165 170 175Gln Ser Ser Gly Leu
Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser 180
185 190Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val
Asn His Lys Pro 195 200 205Ser Asn
Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys 210
215 220Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu
Leu Leu Gly Gly Pro225 230 235
240Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser
245 250 255Arg Thr Pro Glu
Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 260
265 270Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly
Val Glu Val His Asn 275 280 285Ala
Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val 290
295 300Val Ser Val Leu Thr Val Leu His Gln Asp
Trp Leu Asn Gly Lys Glu305 310 315
320Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu
Lys 325 330 335Thr Ile Ser
Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr 340
345 350Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys
Asn Gln Val Ser Leu Thr 355 360
365Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 370
375 380Ser Asn Gly Gln Pro Glu Asn Asn
Tyr Lys Thr Thr Pro Pro Val Leu385 390
395 400Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu
Thr Val Asp Lys 405 410
415Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu
420 425 430Ala Leu His Asn His Tyr
Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 435 440
445Lys72449PRTArtificial Sequencesynthetic polypeptide 72Gln
Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1
5 10 15Ser Val Lys Met Ser Cys Lys
Ala Ser Gly Tyr Thr Phe Thr Asp Tyr 20 25
30Asn Met His Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu
Trp Ile 35 40 45Gly Tyr Ile Lys
Pro His Asn Ala Gly Thr Thr Tyr Asn Pro Lys Phe 50 55
60Glu Gly Arg Ala Thr Leu Thr Val Asp Thr Ser Ala Ser
Thr Ala Tyr65 70 75
80Met Glu Leu Arg Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Val Arg Ser Asp Phe Leu
Tyr Trp Tyr Phe Asp Val Trp Gly Gln Gly 100
105 110Thr Thr Val Thr Val Ser Ser Ala Ser Thr Lys Gly
Pro Ser Val Phe 115 120 125Pro Leu
Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu 130
135 140Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro
Val Thr Val Ser Trp145 150 155
160Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu
165 170 175Gln Ser Ser Gly
Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser 180
185 190Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn
Val Asn His Lys Pro 195 200 205Ser
Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys 210
215 220Thr His Thr Cys Pro Pro Cys Pro Ala Pro
Glu Leu Leu Gly Gly Pro225 230 235
240Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile
Ser 245 250 255Arg Thr Pro
Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 260
265 270Pro Glu Val Lys Phe Asn Trp Tyr Val Asp
Gly Val Glu Val His Asn 275 280
285Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val 290
295 300Val Ser Val Leu Thr Val Leu His
Gln Asp Trp Leu Asn Gly Lys Glu305 310
315 320Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala
Pro Ile Glu Lys 325 330
335Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
340 345 350Leu Pro Pro Ser Arg Asp
Glu Leu Thr Lys Asn Gln Val Ser Leu Thr 355 360
365Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu
Trp Glu 370 375 380Ser Asn Gly Gln Pro
Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu385 390
395 400Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser
Lys Leu Thr Val Asp Lys 405 410
415Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu
420 425 430Ala Leu His Asn His
Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 435
440 445Lys73215PRTArtificial Sequencesynthetic
polypeptide 73Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val
Gly1 5 10 15Asp Arg Val
Thr Ile Thr Cys Thr Ala Ser Ser Ser Val Ser Ser Ser 20
25 30Tyr Leu His Trp Tyr Gln Gln Lys Pro Gly
Lys Ala Pro Lys Leu Leu 35 40
45Ile Tyr Ser Thr Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser 50
55 60Gly Ser Gly Ser Gly Thr Asp Phe Thr
Leu Thr Ile Ser Ser Leu Gln65 70 75
80Pro Glu Asp Phe Ala Thr Tyr Tyr Cys His Gln Tyr His Arg
Ser Pro 85 90 95Leu Thr
Phe Gly Ala Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala 100
105 110Ala Pro Ser Val Phe Ile Phe Pro Pro
Ser Asp Glu Gln Leu Lys Ser 115 120
125Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu
130 135 140Ala Lys Val Gln Trp Lys Val
Asp Asn Ala Leu Gln Ser Gly Asn Ser145 150
155 160Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser
Thr Tyr Ser Leu 165 170
175Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val
180 185 190Tyr Ala Cys Glu Val Thr
His Gln Gly Leu Ser Ser Pro Val Thr Lys 195 200
205Ser Phe Asn Arg Gly Glu Cys 210
21574215PRTArtificial Sequencesynthetic polypeptide 74Asp Ile Gln Met Thr
Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5
10 15Asp Arg Val Thr Ile Thr Cys Thr Ala Ser Ser
Ser Val Ser Ser Ser 20 25
30Tyr Leu His Trp Tyr Gln Gln Lys Pro Gly Ser Ala Pro Lys Leu Trp
35 40 45Ile Tyr Ser Thr Ser Asn Leu Ala
Ser Gly Val Pro Ser Arg Phe Ser 50 55
60Gly Ser Gly Ser Gly Thr Asp Tyr Thr Leu Thr Ile Ser Ser Leu Gln65
70 75 80Pro Glu Asp Phe Ala
Thr Tyr Tyr Cys His Gln Tyr His Arg Ser Pro 85
90 95Leu Thr Phe Gly Ala Gly Thr Lys Leu Glu Ile
Lys Arg Thr Val Ala 100 105
110Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser
115 120 125Gly Thr Ala Ser Val Val Cys
Leu Leu Asn Asn Phe Tyr Pro Arg Glu 130 135
140Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn
Ser145 150 155 160Gln Glu
Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu
165 170 175Ser Ser Thr Leu Thr Leu Ser
Lys Ala Asp Tyr Glu Lys His Lys Val 180 185
190Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val
Thr Lys 195 200 205Ser Phe Asn Arg
Gly Glu Cys 210 21575215PRTArtificial
Sequencesynthetic polypeptide 75Asp Ile Val Met Thr Gln Ser Pro Ser Ser
Leu Ser Ala Ser Val Gly1 5 10
15Asp Arg Val Thr Ile Thr Cys Thr Ala Ser Ser Ser Val Ser Ser Ser
20 25 30Tyr Leu His Trp Tyr Gln
Gln Lys Pro Gly Ser Ser Pro Lys Leu Trp 35 40
45Ile Tyr Ser Thr Ser Asn Leu Ala Ser Gly Val Pro Gly Arg
Phe Ser 50 55 60Gly Ser Gly Ser Gly
Thr Asp Tyr Thr Leu Thr Ile Ser Ser Leu Gln65 70
75 80Pro Glu Asp Phe Ala Thr Tyr Tyr Cys His
Gln Tyr His Arg Ser Pro 85 90
95Leu Thr Phe Gly Ala Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala
100 105 110Ala Pro Ser Val Phe
Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser 115
120 125Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe
Tyr Pro Arg Glu 130 135 140Ala Lys Val
Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser145
150 155 160Gln Glu Ser Val Thr Glu Gln
Asp Ser Lys Asp Ser Thr Tyr Ser Leu 165
170 175Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu
Lys His Lys Val 180 185 190Tyr
Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys 195
200 205Ser Phe Asn Arg Gly Glu Cys 210
21576118PRTArtificial Sequencesynthetic polypeptide 76Gln
Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1
5 10 15Ser Val Lys Val Ser Cys Lys
Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25
30Trp Met His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu
Trp Met 35 40 45Gly Tyr Ile Asn
Pro Ser Ser Gly Tyr Thr Lys Ser Asn Gln Lys Phe 50 55
60Lys Asp Arg Val Thr Met Thr Ala Asp Thr Ser Thr Ser
Thr Ala Tyr65 70 75
80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Gly Arg Trp Leu Leu Ser
Ala Trp Phe Ala Tyr Trp Gly Gln Gly Thr 100
105 110Leu Val Thr Val Ser Ser
11577118PRTArtificial Sequencesynthetic polypeptide 77Gln Val Gln Leu Val
Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5
10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr
Thr Phe Thr Ser Tyr 20 25
30Trp Met His Trp Val Arg Gln Arg Pro Gly Gln Gly Leu Glu Trp Met
35 40 45Gly Tyr Ile Asn Pro Ser Ser Gly
Tyr Thr Lys Ser Asn Gln Lys Phe 50 55
60Lys Asp Arg Val Thr Leu Thr Ala Asp Thr Ser Thr Ser Thr Ala Tyr65
70 75 80Met Glu Leu Ser Ser
Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Gly Arg Trp Leu Leu Ser Ala Trp Phe Ala Tyr
Trp Gly Gln Gly Thr 100 105
110Leu Val Thr Val Ser Ser 11578118PRTArtificial Sequencesynthetic
polypeptide 78Gln Val Gln Leu Gln Gln Ser Gly Ala Glu Val Lys Lys Pro Gly
Ala1 5 10 15Ser Val Lys
Leu Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20
25 30Trp Met His Trp Val Arg Gln Arg Pro Gly
Gln Gly Leu Glu Trp Ile 35 40
45Gly Tyr Ile Asn Pro Ser Ser Gly Tyr Thr Lys Ser Asn Gln Lys Phe 50
55 60Lys Asp Arg Ala Thr Leu Thr Ala Asp
Thr Ser Thr Ser Thr Ala Tyr65 70 75
80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr
Tyr Cys 85 90 95Gly Arg
Trp Leu Leu Ser Ala Trp Phe Ala Tyr Trp Gly Gln Gly Thr 100
105 110Leu Val Thr Val Ser Ser
11579107PRTArtificial Sequencesynthetic polypeptide 79Asp Ile Gln Met Thr
Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5
10 15Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln
Asp Ile Asn Thr Tyr 20 25
30Leu Ser Trp Phe Gln Gln Lys Pro Gly Lys Ala Pro Lys Ser Leu Ile
35 40 45Tyr Arg Ser Asn Ile Leu Val Asp
Gly Val Pro Ser Arg Phe Ser Gly 50 55
60Ser Gly Ser Gly Gln Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65
70 75 80Glu Asp Phe Ala Ile
Tyr Tyr Cys Leu Gln Tyr Asp Asp Phe Pro Tyr 85
90 95Thr Phe Gly Gln Gly Thr Lys Leu Glu Ile Lys
100 10580107PRTArtificial Sequencesynthetic
polypeptide 80Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val
Gly1 5 10 15Asp Arg Val
Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asn Thr Tyr 20
25 30Leu Ser Trp Phe Gln Gln Lys Pro Gly Lys
Ser Pro Lys Ser Leu Ile 35 40
45Tyr Arg Ser Asn Ile Leu Val Asp Gly Val Pro Ser Arg Phe Ser Gly 50
55 60Ser Gly Ser Gly Gln Asp Tyr Thr Leu
Thr Ile Ser Ser Leu Gln Pro65 70 75
80Glu Asp Phe Ala Ile Tyr Tyr Cys Leu Gln Tyr Asp Asp Phe
Pro Tyr 85 90 95Thr Phe
Gly Gln Gly Thr Lys Leu Glu Ile Lys 100
10581448PRTArtificial Sequencesynthetic polypeptide 81Gln Val Gln Leu Val
Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5
10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr
Thr Phe Thr Ser Tyr 20 25
30Trp Met His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met
35 40 45Gly Tyr Ile Asn Pro Ser Ser Gly
Tyr Thr Lys Ser Asn Gln Lys Phe 50 55
60Lys Asp Arg Val Thr Met Thr Ala Asp Thr Ser Thr Ser Thr Ala Tyr65
70 75 80Met Glu Leu Ser Ser
Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Gly Arg Trp Leu Leu Ser Ala Trp Phe Ala Tyr
Trp Gly Gln Gly Thr 100 105
110Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro
115 120 125Leu Ala Pro Ser Ser Lys Ser
Thr Ser Gly Gly Thr Ala Ala Leu Gly 130 135
140Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp
Asn145 150 155 160Ser Gly
Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln
165 170 175Ser Ser Gly Leu Tyr Ser Leu
Ser Ser Val Val Thr Val Pro Ser Ser 180 185
190Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys
Pro Ser 195 200 205Asn Thr Lys Val
Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr 210
215 220His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu
Gly Gly Pro Ser225 230 235
240Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg
245 250 255Thr Pro Glu Val Thr
Cys Val Val Val Asp Val Ser His Glu Asp Pro 260
265 270Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu
Val His Asn Ala 275 280 285Lys Thr
Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 290
295 300Ser Val Leu Thr Val Leu His Gln Asp Trp Leu
Asn Gly Lys Glu Tyr305 310 315
320Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr
325 330 335Ile Ser Lys Ala
Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 340
345 350Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln
Val Ser Leu Thr Cys 355 360 365Leu
Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 370
375 380Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr
Thr Pro Pro Val Leu Asp385 390 395
400Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys
Ser 405 410 415Arg Trp Gln
Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala 420
425 430Leu His Asn His Tyr Thr Gln Lys Ser Leu
Ser Leu Ser Pro Gly Lys 435 440
44582448PRTArtificial Sequencesynthetic polypeptide 82Gln Val Gln Leu Val
Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5
10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr
Thr Phe Thr Ser Tyr 20 25
30Trp Met His Trp Val Arg Gln Arg Pro Gly Gln Gly Leu Glu Trp Met
35 40 45Gly Tyr Ile Asn Pro Ser Ser Gly
Tyr Thr Lys Ser Asn Gln Lys Phe 50 55
60Lys Asp Arg Val Thr Leu Thr Ala Asp Thr Ser Thr Ser Thr Ala Tyr65
70 75 80Met Glu Leu Ser Ser
Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Gly Arg Trp Leu Leu Ser Ala Trp Phe Ala Tyr
Trp Gly Gln Gly Thr 100 105
110Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro
115 120 125Leu Ala Pro Ser Ser Lys Ser
Thr Ser Gly Gly Thr Ala Ala Leu Gly 130 135
140Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp
Asn145 150 155 160Ser Gly
Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln
165 170 175Ser Ser Gly Leu Tyr Ser Leu
Ser Ser Val Val Thr Val Pro Ser Ser 180 185
190Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys
Pro Ser 195 200 205Asn Thr Lys Val
Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr 210
215 220His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu
Gly Gly Pro Ser225 230 235
240Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg
245 250 255Thr Pro Glu Val Thr
Cys Val Val Val Asp Val Ser His Glu Asp Pro 260
265 270Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu
Val His Asn Ala 275 280 285Lys Thr
Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 290
295 300Ser Val Leu Thr Val Leu His Gln Asp Trp Leu
Asn Gly Lys Glu Tyr305 310 315
320Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr
325 330 335Ile Ser Lys Ala
Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 340
345 350Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln
Val Ser Leu Thr Cys 355 360 365Leu
Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 370
375 380Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr
Thr Pro Pro Val Leu Asp385 390 395
400Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys
Ser 405 410 415Arg Trp Gln
Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala 420
425 430Leu His Asn His Tyr Thr Gln Lys Ser Leu
Ser Leu Ser Pro Gly Lys 435 440
44583448PRTArtificial Sequencesynthetic polypeptide 83Gln Val Gln Leu Gln
Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5
10 15Ser Val Lys Leu Ser Cys Lys Ala Ser Gly Tyr
Thr Phe Thr Ser Tyr 20 25
30Trp Met His Trp Val Arg Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile
35 40 45Gly Tyr Ile Asn Pro Ser Ser Gly
Tyr Thr Lys Ser Asn Gln Lys Phe 50 55
60Lys Asp Arg Ala Thr Leu Thr Ala Asp Thr Ser Thr Ser Thr Ala Tyr65
70 75 80Met Glu Leu Ser Ser
Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Gly Arg Trp Leu Leu Ser Ala Trp Phe Ala Tyr
Trp Gly Gln Gly Thr 100 105
110Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro
115 120 125Leu Ala Pro Ser Ser Lys Ser
Thr Ser Gly Gly Thr Ala Ala Leu Gly 130 135
140Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp
Asn145 150 155 160Ser Gly
Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln
165 170 175Ser Ser Gly Leu Tyr Ser Leu
Ser Ser Val Val Thr Val Pro Ser Ser 180 185
190Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys
Pro Ser 195 200 205Asn Thr Lys Val
Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr 210
215 220His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu
Gly Gly Pro Ser225 230 235
240Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg
245 250 255Thr Pro Glu Val Thr
Cys Val Val Val Asp Val Ser His Glu Asp Pro 260
265 270Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu
Val His Asn Ala 275 280 285Lys Thr
Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 290
295 300Ser Val Leu Thr Val Leu His Gln Asp Trp Leu
Asn Gly Lys Glu Tyr305 310 315
320Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr
325 330 335Ile Ser Lys Ala
Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 340
345 350Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln
Val Ser Leu Thr Cys 355 360 365Leu
Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 370
375 380Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr
Thr Pro Pro Val Leu Asp385 390 395
400Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys
Ser 405 410 415Arg Trp Gln
Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala 420
425 430Leu His Asn His Tyr Thr Gln Lys Ser Leu
Ser Leu Ser Pro Gly Lys 435 440
44584214PRTArtificial Sequencesynthetic polypeptide 84Asp Ile Gln Met Thr
Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5
10 15Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln
Asp Ile Asn Thr Tyr 20 25
30Leu Ser Trp Phe Gln Gln Lys Pro Gly Lys Ala Pro Lys Ser Leu Ile
35 40 45Tyr Arg Ser Asn Ile Leu Val Asp
Gly Val Pro Ser Arg Phe Ser Gly 50 55
60Ser Gly Ser Gly Gln Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65
70 75 80Glu Asp Phe Ala Ile
Tyr Tyr Cys Leu Gln Tyr Asp Asp Phe Pro Tyr 85
90 95Thr Phe Gly Gln Gly Thr Lys Leu Glu Ile Lys
Arg Thr Val Ala Ala 100 105
110Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly
115 120 125Thr Ala Ser Val Val Cys Leu
Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135
140Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser
Gln145 150 155 160Glu Ser
Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser
165 170 175Ser Thr Leu Thr Leu Ser Lys
Ala Asp Tyr Glu Lys His Lys Val Tyr 180 185
190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr
Lys Ser 195 200 205Phe Asn Arg Gly
Glu Cys 21085214PRTArtificial Sequencesynthetic polypeptide 85Asp Ile
Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5
10 15Asp Arg Val Thr Ile Thr Cys Lys
Ala Ser Gln Asp Ile Asn Thr Tyr 20 25
30Leu Ser Trp Phe Gln Gln Lys Pro Gly Lys Ser Pro Lys Ser Leu
Ile 35 40 45Tyr Arg Ser Asn Ile
Leu Val Asp Gly Val Pro Ser Arg Phe Ser Gly 50 55
60Ser Gly Ser Gly Gln Asp Tyr Thr Leu Thr Ile Ser Ser Leu
Gln Pro65 70 75 80Glu
Asp Phe Ala Ile Tyr Tyr Cys Leu Gln Tyr Asp Asp Phe Pro Tyr
85 90 95Thr Phe Gly Gln Gly Thr Lys
Leu Glu Ile Lys Arg Thr Val Ala Ala 100 105
110Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys
Ser Gly 115 120 125Thr Ala Ser Val
Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130
135 140Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser
Gly Asn Ser Gln145 150 155
160Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser
165 170 175Ser Thr Leu Thr Leu
Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr 180
185 190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro
Val Thr Lys Ser 195 200 205Phe Asn
Arg Gly Glu Cys 21086442PRTArtificial Sequencesynthetic polypeptide
86Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1
5 10 15Ser Val Lys Val Ser Cys
Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25
30Trp Met His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu
Glu Trp Met 35 40 45Gly Tyr Ile
Asn Pro Ser Ser Gly Tyr Thr Lys Ser Asn Gln Lys Phe 50
55 60Lys Asp Arg Val Thr Met Thr Ala Asp Thr Ser Thr
Ser Thr Ala Tyr65 70 75
80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Gly Arg Trp Leu Leu Ser
Ala Trp Phe Ala Tyr Trp Gly Gln Gly Thr 100
105 110Leu Val Thr Val Ser Ser Ala Lys Thr Thr Pro Pro
Ser Val Tyr Pro 115 120 125Leu Ala
Pro Gly Ser Ala Ala Gln Thr Asn Ser Met Val Thr Leu Gly 130
135 140Cys Leu Val Lys Gly Tyr Phe Pro Glu Pro Val
Thr Val Thr Trp Asn145 150 155
160Ser Gly Ser Leu Ser Ser Gly Val His Thr Phe Pro Ala Val Leu Gln
165 170 175Ser Asp Leu Tyr
Thr Leu Ser Ser Ser Val Thr Val Pro Ser Ser Thr 180
185 190Trp Pro Ser Glu Thr Val Thr Cys Asn Val Ala
His Pro Ala Ser Ser 195 200 205Thr
Lys Val Asp Lys Lys Ile Val Pro Arg Asp Cys Gly Cys Lys Pro 210
215 220Cys Ile Cys Thr Val Pro Glu Val Ser Ser
Val Phe Ile Phe Pro Pro225 230 235
240Lys Pro Lys Asp Val Leu Thr Ile Thr Leu Thr Pro Lys Val Thr
Cys 245 250 255Val Val Val
Asp Ile Ser Lys Asp Asp Pro Glu Val Gln Phe Ser Trp 260
265 270Phe Val Asp Asp Val Glu Val His Thr Ala
Gln Thr Gln Pro Arg Glu 275 280
285Glu Gln Phe Asn Ser Thr Phe Arg Ser Val Ser Glu Leu Pro Ile Met 290
295 300His Gln Asp Trp Leu Asn Gly Lys
Glu Phe Lys Cys Arg Val Asn Ser305 310
315 320Ala Ala Phe Pro Ala Pro Ile Glu Lys Thr Ile Ser
Lys Thr Lys Gly 325 330
335Arg Pro Lys Ala Pro Gln Val Tyr Thr Ile Pro Pro Pro Lys Glu Gln
340 345 350Met Ala Lys Asp Lys Val
Ser Leu Thr Cys Met Ile Thr Asp Phe Phe 355 360
365Pro Glu Asp Ile Thr Val Glu Trp Gln Trp Asn Gly Gln Pro
Ala Glu 370 375 380Asn Tyr Lys Asn Thr
Gln Pro Ile Met Asp Thr Asp Gly Ser Tyr Phe385 390
395 400Val Tyr Ser Lys Leu Asn Val Gln Lys Ser
Asn Trp Glu Ala Gly Asn 405 410
415Thr Phe Thr Cys Ser Val Leu His Glu Gly Leu His Asn His His Thr
420 425 430Glu Lys Ser Leu Ser
His Ser Pro Gly Lys 435 44087442PRTArtificial
Sequencesynthetic polypeptide 87Gln Val Gln Leu Gln Gln Ser Gly Ala Glu
Val Lys Lys Pro Gly Ala1 5 10
15Ser Val Lys Leu Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr
20 25 30Trp Met His Trp Val Arg
Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile 35 40
45Gly Tyr Ile Asn Pro Ser Ser Gly Tyr Thr Lys Ser Asn Gln
Lys Phe 50 55 60Lys Asp Arg Ala Thr
Leu Thr Ala Asp Thr Ser Thr Ser Thr Ala Tyr65 70
75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90
95Gly Arg Trp Leu Leu Ser Ala Trp Phe Ala Tyr Trp Gly Gln Gly Thr
100 105 110Leu Val Thr Val Ser
Ser Ala Lys Thr Thr Pro Pro Ser Val Tyr Pro 115
120 125Leu Ala Pro Gly Ser Ala Ala Gln Thr Asn Ser Met
Val Thr Leu Gly 130 135 140Cys Leu Val
Lys Gly Tyr Phe Pro Glu Pro Val Thr Val Thr Trp Asn145
150 155 160Ser Gly Ser Leu Ser Ser Gly
Val His Thr Phe Pro Ala Val Leu Gln 165
170 175Ser Asp Leu Tyr Thr Leu Ser Ser Ser Val Thr Val
Pro Ser Ser Thr 180 185 190Trp
Pro Ser Glu Thr Val Thr Cys Asn Val Ala His Pro Ala Ser Ser 195
200 205Thr Lys Val Asp Lys Lys Ile Val Pro
Arg Asp Cys Gly Cys Lys Pro 210 215
220Cys Ile Cys Thr Val Pro Glu Val Ser Ser Val Phe Ile Phe Pro Pro225
230 235 240Lys Pro Lys Asp
Val Leu Thr Ile Thr Leu Thr Pro Lys Val Thr Cys 245
250 255Val Val Val Asp Ile Ser Lys Asp Asp Pro
Glu Val Gln Phe Ser Trp 260 265
270Phe Val Asp Asp Val Glu Val His Thr Ala Gln Thr Gln Pro Arg Glu
275 280 285Glu Gln Phe Asn Ser Thr Phe
Arg Ser Val Ser Glu Leu Pro Ile Met 290 295
300His Gln Asp Trp Leu Asn Gly Lys Glu Phe Lys Cys Arg Val Asn
Ser305 310 315 320Ala Ala
Phe Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly
325 330 335Arg Pro Lys Ala Pro Gln Val
Tyr Thr Ile Pro Pro Pro Lys Glu Gln 340 345
350Met Ala Lys Asp Lys Val Ser Leu Thr Cys Met Ile Thr Asp
Phe Phe 355 360 365Pro Glu Asp Ile
Thr Val Glu Trp Gln Trp Asn Gly Gln Pro Ala Glu 370
375 380Asn Tyr Lys Asn Thr Gln Pro Ile Met Asp Thr Asp
Gly Ser Tyr Phe385 390 395
400Val Tyr Ser Lys Leu Asn Val Gln Lys Ser Asn Trp Glu Ala Gly Asn
405 410 415Thr Phe Thr Cys Ser
Val Leu His Glu Gly Leu His Asn His His Thr 420
425 430Glu Lys Ser Leu Ser His Ser Pro Gly Lys
435 44088214PRTArtificial Sequencesynthetic polypeptide
88Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1
5 10 15Asp Arg Val Thr Ile Thr
Cys Lys Ala Ser Gln Asp Ile Asn Thr Tyr 20 25
30Leu Ser Trp Phe Gln Gln Lys Pro Gly Lys Ala Pro Lys
Ser Leu Ile 35 40 45Tyr Arg Ser
Asn Ile Leu Val Asp Gly Val Pro Ser Arg Phe Ser Gly 50
55 60Ser Gly Ser Gly Gln Asp Phe Thr Leu Thr Ile Ser
Ser Leu Gln Pro65 70 75
80Glu Asp Phe Ala Ile Tyr Tyr Cys Leu Gln Tyr Asp Asp Phe Pro Tyr
85 90 95Thr Phe Gly Gln Gly Thr
Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala 100
105 110Pro Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln
Leu Thr Ser Gly 115 120 125Gly Ala
Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile 130
135 140Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg
Gln Asn Gly Val Leu145 150 155
160Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser
165 170 175Ser Thr Leu Thr
Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr 180
185 190Thr Cys Glu Ala Thr His Lys Thr Ser Thr Ser
Pro Ile Val Lys Ser 195 200 205Phe
Asn Arg Asn Glu Cys 21089214PRTArtificial Sequencesynthetic
polypeptide 89Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val
Gly1 5 10 15Asp Arg Val
Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asn Thr Tyr 20
25 30Leu Ser Trp Phe Gln Gln Lys Pro Gly Lys
Ser Pro Lys Ser Leu Ile 35 40
45Tyr Arg Ser Asn Ile Leu Val Asp Gly Val Pro Ser Arg Phe Ser Gly 50
55 60Ser Gly Ser Gly Gln Asp Tyr Thr Leu
Thr Ile Ser Ser Leu Gln Pro65 70 75
80Glu Asp Phe Ala Ile Tyr Tyr Cys Leu Gln Tyr Asp Asp Phe
Pro Tyr 85 90 95Thr Phe
Gly Gln Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala 100
105 110Pro Thr Val Ser Ile Phe Pro Pro Ser
Ser Glu Gln Leu Thr Ser Gly 115 120
125Gly Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile
130 135 140Asn Val Lys Trp Lys Ile Asp
Gly Ser Glu Arg Gln Asn Gly Val Leu145 150
155 160Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr
Tyr Ser Met Ser 165 170
175Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr
180 185 190Thr Cys Glu Ala Thr His
Lys Thr Ser Thr Ser Pro Ile Val Lys Ser 195 200
205Phe Asn Arg Asn Glu Cys 21090448PRTArtificial
Sequencesynthetic polypeptide 90Gln Val Gln Leu Val Gln Ser Gly Ala Glu
Val Lys Lys Pro Gly Ala1 5 10
15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr
20 25 30Trp Met His Trp Val Arg
Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40
45Gly Tyr Ile Asn Pro Ser Ser Gly Tyr Thr Lys Ser Asn Gln
Lys Phe 50 55 60Lys Asp Arg Val Thr
Met Thr Ala Asp Thr Ser Thr Ser Thr Ala Tyr65 70
75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90
95Gly Arg Trp Leu Leu Ser Ala Trp Phe Ala Tyr Trp Gly Gln Gly Thr
100 105 110Leu Val Thr Val Ser
Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro 115
120 125Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr
Ala Ala Leu Gly 130 135 140Cys Leu Val
Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn145
150 155 160Ser Gly Ala Leu Thr Ser Gly
Val His Thr Phe Pro Ala Val Leu Gln 165
170 175Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr
Val Pro Ser Ser 180 185 190Ser
Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser 195
200 205Asn Thr Lys Val Asp Lys Arg Val Glu
Pro Lys Ser Cys Asp Lys Thr 210 215
220His Thr Cys Pro Pro Cys Pro Ala Pro Glu Phe Glu Gly Gly Pro Ser225
230 235 240Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg 245
250 255Thr Pro Glu Val Thr Cys Val Val Val Asp
Val Ser His Glu Asp Pro 260 265
270Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala
275 280 285Lys Thr Lys Pro Arg Glu Glu
Gln Tyr Asn Ser Thr Tyr Arg Val Val 290 295
300Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu
Tyr305 310 315 320Lys Cys
Lys Val Ser Asn Lys Ala Leu Pro Ala Ser Ile Glu Lys Thr
325 330 335Ile Ser Lys Ala Lys Gly Gln
Pro Arg Glu Pro Gln Val Tyr Thr Leu 340 345
350Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu
Thr Cys 355 360 365Leu Val Lys Gly
Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 370
375 380Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro
Pro Val Leu Asp385 390 395
400Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser
405 410 415Arg Trp Gln Gln Gly
Asn Val Phe Ser Cys Ser Val Met His Glu Ala 420
425 430Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu
Ser Pro Gly Lys 435 440
44591448PRTArtificial Sequencesynthetic polypeptide 91Gln Val Gln Leu Gln
Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5
10 15Ser Val Lys Leu Ser Cys Lys Ala Ser Gly Tyr
Thr Phe Thr Ser Tyr 20 25
30Trp Met His Trp Val Arg Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile
35 40 45Gly Tyr Ile Asn Pro Ser Ser Gly
Tyr Thr Lys Ser Asn Gln Lys Phe 50 55
60Lys Asp Arg Ala Thr Leu Thr Ala Asp Thr Ser Thr Ser Thr Ala Tyr65
70 75 80Met Glu Leu Ser Ser
Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Gly Arg Trp Leu Leu Ser Ala Trp Phe Ala Tyr
Trp Gly Gln Gly Thr 100 105
110Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro
115 120 125Leu Ala Pro Ser Ser Lys Ser
Thr Ser Gly Gly Thr Ala Ala Leu Gly 130 135
140Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp
Asn145 150 155 160Ser Gly
Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln
165 170 175Ser Ser Gly Leu Tyr Ser Leu
Ser Ser Val Val Thr Val Pro Ser Ser 180 185
190Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys
Pro Ser 195 200 205Asn Thr Lys Val
Asp Lys Arg Val Glu Pro Lys Ser Cys Asp Lys Thr 210
215 220His Thr Cys Pro Pro Cys Pro Ala Pro Glu Phe Glu
Gly Gly Pro Ser225 230 235
240Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg
245 250 255Thr Pro Glu Val Thr
Cys Val Val Val Asp Val Ser His Glu Asp Pro 260
265 270Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu
Val His Asn Ala 275 280 285Lys Thr
Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 290
295 300Ser Val Leu Thr Val Leu His Gln Asp Trp Leu
Asn Gly Lys Glu Tyr305 310 315
320Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Ser Ile Glu Lys Thr
325 330 335Ile Ser Lys Ala
Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 340
345 350Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln
Val Ser Leu Thr Cys 355 360 365Leu
Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 370
375 380Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr
Thr Pro Pro Val Leu Asp385 390 395
400Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys
Ser 405 410 415Arg Trp Gln
Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala 420
425 430Leu His Asn His Tyr Thr Gln Lys Ser Leu
Ser Leu Ser Pro Gly Lys 435 440
44592357DNAArtificial Sequencesynthetic polynucleotide 92caggtgcagc
tggtgcagag cggcgccgag gtgaagaagc ccggcgccag cgtgaagatg 60agctgcaagg
ccagcggcta caccttcacc gactacaaca tgcactgggt gagacagagc 120cccggcaaga
gcctggagtg gatcggctac atcaagcccc acaacgccgg caccacctac 180aaccccaagt
tcgagggcag agccaccctg accgtggaca ccagcgccag caccgcctac 240atggagctga
gcagcctgag aagcgaggac accgccgtgt actactgcgt aagaagcgac 300ttcctgtact
ggtacttcga cgtgtggggc cagggcacca ccgtgaccgt gtcctca
35793357DNAArtificial Sequencesynthetic polynucleotide 93caggtgcagc
tggtgcagag cggcgccgag gtgaagaagc ccggcgccag cgtgaagatg 60agctgcaagg
ccagcggcta caccttcacc gactacaaca tgcactgggt gaagcagagc 120cacggcaaga
gcctggagtg gatcggctac atcaagcccc acaacgccgg caccacctac 180aaccccaagt
tcgagggcag agccaccctg accgtggaca ccagcgccag caccgcctac 240atggagctga
gaagcctgag aagcgaggac accgccgtgt actactgcgt aagaagcgat 300tttctctact
ggtatttcga tgtctggggc cagggcacca ccgtgaccgt gtcctca
35794324DNAArtificial Sequencesynthetic polynucleotide 94gacatccaga
tgacccagag ccccagcagc ctgagcgcca gcgtgggcga cagagtgacc 60atcacctgca
ccgccagcag cagcgtgagc agcagctacc tgcactggta ccagcagaag 120cccggcaagg
cccccaagct gctgatctac agcaccagca acctggccag cggcgtgccc 180agcagattca
gcggcagcgg cagcggcacc gacttcaccc tgaccatcag cagcctgcag 240cccgaggact
tcgccaccta ctactgccac cagtatcatc gttccccgct cacgttcggc 300gccggcacca
agctggagat caag
32495324DNAArtificial Sequencesynthetic polynucleotide 95gacatccaga
tgacccagag ccccagcagc ctgagcgcca gcgtgggcga cagagtgacc 60atcacctgca
ccgccagcag cagcgtgagc agcagctacc tgcactggta ccagcagaag 120cccggcagcg
cccccaagct gtggatctac agcaccagca acctggccag cggcgtgccc 180agcagattca
gcggcagcgg cagcggcacc gactacaccc tgaccatcag cagcctgcag 240cccgaggact
tcgccaccta ctactgccac cagtatcatc gttccccgct cacgttcggc 300gccggcacca
agctggagat caag
32496324DNAArtificial Sequencesynthetic polynucleotide 96gacatcgtga
tgacccagag ccccagcagc ctgagcgcca gcgtgggcga cagagtgacc 60atcacctgca
ccgccagcag cagcgtgagc agcagctacc tgcactggta ccagcagaag 120cccggcagca
gccccaagct gtggatctac agcaccagca acctggccag cggcgtgccc 180ggcagattca
gcggcagcgg cagcggcacc gactacaccc tgaccatcag cagcctgcag 240cccgaggact
tcgccaccta ctactgccac cagtatcatc gttccccgct cacgttcggc 300gccggcacca
agctggagat caag
324971347DNAArtificial Sequencesynthetic polynucleotide 97caggtgcagc
tggtgcagag cggcgccgag gtgaagaagc ccggcgccag cgtgaagatg 60agctgcaagg
ccagcggcta caccttcacc gactacaaca tgcactgggt gagacagagc 120cccggcaaga
gcctggagtg gatcggctac atcaagcccc acaacgccgg caccacctac 180aaccccaagt
tcgagggcag agccaccctg accgtggaca ccagcgccag caccgcctac 240atggagctga
gcagcctgag aagcgaggac accgccgtgt actactgcgt aagaagcgac 300ttcctgtact
ggtacttcga cgtgtggggc cagggcacca ccgtgaccgt gtcctcagct 360agcaccaagg
gcccatcggt cttccccctg gcaccctcct ccaagagcac ctctgggggc 420acagcggccc
tgggctgcct ggtcaaggac tacttccccg aaccggtgac ggtgtcgtgg 480aactcaggcg
ccctgaccag cggcgtgcac accttcccgg ctgtcctaca gtcctcagga 540ctctactccc
tcagcagcgt ggtgaccgtg ccctccagca gcttgggcac ccagacctac 600atctgcaacg
tgaatcacaa gcccagcaac accaaggtgg acaagaaagt tgagcccaaa 660tcttgtgaca
aaactcacac atgcccaccg tgcccagcac ctgaactcct ggggggaccg 720tcagtcttcc
tcttcccccc aaaacccaag gacaccctca tgatctcccg gacccctgag 780gtcacatgcg
tggtggtgga cgtgagccac gaagaccctg aggtcaagtt caactggtac 840gtggacggcg
tggaggtgca taatgccaag acaaagccgc gggaggagca gtacaacagc 900acgtaccgtg
tggtcagcgt cctcaccgtc ctgcaccagg actggctgaa tggcaaggag 960tacaagtgca
aggtctccaa caaagccctc ccagccccca tcgagaaaac catctccaaa 1020gccaaagggc
agccccgaga accacaggtg tacaccctgc ccccatcccg ggatgagttg 1080accaagaacc
aggtcagcct gacctgcctg gtcaaaggct tctatcccag cgacatcgcc 1140gtggagtggg
agagcaatgg gcagccggag aacaactaca agaccacgcc tcccgtgctg 1200gactccgacg
gctccttctt cctctacagc aagctcaccg tggacaagag caggtggcag 1260caggggaacg
tcttctcatg ctccgtgatg catgaggctc tgcacaacca ctacacgcag 1320aagagcctct
ccctgtctcc gggtaaa
1347981347DNAArtificial Sequencesynthetic polynucleotide 98caggtgcagc
tggtgcagag cggcgccgag gtgaagaagc ccggcgccag cgtgaagatg 60agctgcaagg
ccagcggcta caccttcacc gactacaaca tgcactgggt gaagcagagc 120cacggcaaga
gcctggagtg gatcggctac atcaagcccc acaacgccgg caccacctac 180aaccccaagt
tcgagggcag agccaccctg accgtggaca ccagcgccag caccgcctac 240atggagctga
gaagcctgag aagcgaggac accgccgtgt actactgcgt aagaagcgat 300tttctctact
ggtatttcga tgtctggggc cagggcacca ccgtgaccgt gtcctcagct 360agcaccaagg
gcccatcggt cttccccctg gcaccctcct ccaagagcac ctctgggggc 420acagcggccc
tgggctgcct ggtcaaggac tacttccccg aaccggtgac ggtgtcgtgg 480aactcaggcg
ccctgaccag cggcgtgcac accttcccgg ctgtcctaca gtcctcagga 540ctctactccc
tcagcagcgt ggtgaccgtg ccctccagca gcttgggcac ccagacctac 600atctgcaacg
tgaatcacaa gcccagcaac accaaggtgg acaagaaagt tgagcccaaa 660tcttgtgaca
aaactcacac atgcccaccg tgcccagcac ctgaactcct ggggggaccg 720tcagtcttcc
tcttcccccc aaaacccaag gacaccctca tgatctcccg gacccctgag 780gtcacatgcg
tggtggtgga cgtgagccac gaagaccctg aggtcaagtt caactggtac 840gtggacggcg
tggaggtgca taatgccaag acaaagccgc gggaggagca gtacaacagc 900acgtaccgtg
tggtcagcgt cctcaccgtc ctgcaccagg actggctgaa tggcaaggag 960tacaagtgca
aggtctccaa caaagccctc ccagccccca tcgagaaaac catctccaaa 1020gccaaagggc
agccccgaga accacaggtg tacaccctgc ccccatcccg ggatgagttg 1080accaagaacc
aggtcagcct gacctgcctg gtcaaaggct tctatcccag cgacatcgcc 1140gtggagtggg
agagcaatgg gcagccggag aacaactaca agaccacgcc tcccgtgctg 1200gactccgacg
gctccttctt cctctacagc aagctcaccg tggacaagag caggtggcag 1260caggggaacg
tcttctcatg ctccgtgatg catgaggctc tgcacaacca ctacacgcag 1320aagagcctct
ccctgtctcc gggtaaa
134799645DNAArtificial Sequencesynthetic polynucleotide 99gacatccaga
tgacccagag ccccagcagc ctgagcgcca gcgtgggcga cagagtgacc 60atcacctgca
ccgccagcag cagcgtgagc agcagctacc tgcactggta ccagcagaag 120cccggcaagg
cccccaagct gctgatctac agcaccagca acctggccag cggcgtgccc 180agcagattca
gcggcagcgg cagcggcacc gacttcaccc tgaccatcag cagcctgcag 240cccgaggact
tcgccaccta ctactgccac cagtatcatc gttccccgct cacgttcggc 300gccggcacca
agctggagat caagcgtacg gtggctgcac catctgtctt catcttcccg 360ccatctgatg
agcagttgaa atctggaact gcctctgttg tgtgcctgct gaataacttc 420tatcccagag
aggccaaagt acagtggaag gtggataacg ccctccaatc gggtaactcc 480caggagagtg
tcacagagca ggacagcaag gacagcacct acagcctcag cagcaccctg 540acgctgagca
aagcagacta cgagaaacac aaagtctacg cctgcgaagt cacccatcag 600ggcctgagct
cgcccgtcac aaagagcttc aacaggggag agtgt
645100645DNAArtificial Sequencesynthetic polynucleotide 100gacatccaga
tgacccagag ccccagcagc ctgagcgcca gcgtgggcga cagagtgacc 60atcacctgca
ccgccagcag cagcgtgagc agcagctacc tgcactggta ccagcagaag 120cccggcagcg
cccccaagct gtggatctac agcaccagca acctggccag cggcgtgccc 180agcagattca
gcggcagcgg cagcggcacc gactacaccc tgaccatcag cagcctgcag 240cccgaggact
tcgccaccta ctactgccac cagtatcatc gttccccgct cacgttcggc 300gccggcacca
agctggagat caagcgtacg gtggctgcac catctgtctt catcttcccg 360ccatctgatg
agcagttgaa atctggaact gcctctgttg tgtgcctgct gaataacttc 420tatcccagag
aggccaaagt acagtggaag gtggataacg ccctccaatc gggtaactcc 480caggagagtg
tcacagagca ggacagcaag gacagcacct acagcctcag cagcaccctg 540acgctgagca
aagcagacta cgagaaacac aaagtctacg cctgcgaagt cacccatcag 600ggcctgagct
cgcccgtcac aaagagcttc aacaggggag agtgt
645101645DNAArtificial Sequencesynthetic polynucleotide 101gacatcgtga
tgacccagag ccccagcagc ctgagcgcca gcgtgggcga cagagtgacc 60atcacctgca
ccgccagcag cagcgtgagc agcagctacc tgcactggta ccagcagaag 120cccggcagca
gccccaagct gtggatctac agcaccagca acctggccag cggcgtgccc 180ggcagattca
gcggcagcgg cagcggcacc gactacaccc tgaccatcag cagcctgcag 240cccgaggact
tcgccaccta ctactgccac cagtatcatc gttccccgct cacgttcggc 300gccggcacca
agctggagat caagcgtacg gtggctgcac catctgtctt catcttcccg 360ccatctgatg
agcagttgaa atctggaact gcctctgttg tgtgcctgct gaataacttc 420tatcccagag
aggccaaagt acagtggaag gtggataacg ccctccaatc gggtaactcc 480caggagagtg
tcacagagca ggacagcaag gacagcacct acagcctcag cagcaccctg 540acgctgagca
aagcagacta cgagaaacac aaagtctacg cctgcgaagt cacccatcag 600ggcctgagct
cgcccgtcac aaagagcttc aacaggggag agtgt
645102354DNAArtificial Sequencesynthetic polynucleotide 102caggtgcagc
tggtgcagag cggcgccgag gtgaagaagc ccggcgccag cgtgaaggtg 60agctgcaagg
ccagcggcta caccttcacc agctactgga tgcactgggt gagacaggcc 120cccggccagg
gcctggagtg gatgggctac atcaacccca gcagcggcta caccaagagc 180aaccagaagt
tcaaggacag agtgaccatg accgccgaca ccagcaccag caccgcctac 240atggagctga
gcagcctgag aagcgaggac accgccgtgt actactgcgg aagatggtta 300ctttcggcct
ggtttgctta ctggggccag ggcaccctgg tgaccgtgag cagc
354103354DNAArtificial Sequencesynthetic polynucleotide 103caggtgcagc
tggtgcagag cggcgccgag gtgaagaagc ccggcgccag cgtgaaggtg 60agctgcaagg
ccagcggcta caccttcacc agctactgga tgcactgggt gagacagaga 120cccggccagg
gcctggagtg gatgggctac atcaacccca gcagcggcta caccaagagc 180aaccagaagt
tcaaggacag agtgaccctg accgccgaca ccagcaccag caccgcctac 240atggagctga
gcagcctgag aagcgaggac accgccgtgt actactgcgg cagatggctg 300ctgagcgcct
ggttcgccta ctggggccag ggcaccctgg tgaccgtgag cagc
354104354DNAArtificial Sequencesynthetic polynucleotide 104caggtgcagc
tgcagcagag cggcgccgag gtgaagaagc ccggcgccag cgtgaagctg 60agctgcaagg
ccagcggcta caccttcacc agctactgga tgcactgggt gagacagaga 120cccggccagg
gcctggagtg gatcggctac atcaacccca gcagcggcta caccaagagc 180aaccagaagt
tcaaggacag agccaccctg accgccgaca ccagcaccag caccgcctac 240atggagctga
gcagcctgag aagcgaggac accgccgtgt actactgcgg cagatggctg 300ctgagcgcct
ggttcgccta ctggggccag ggcaccctgg tgaccgtgag cagc
354105321DNAArtificial Sequencesynthetic polynucleotide 105gacatccaga
tgacccagag ccccagcagc ctgagcgcca gcgtgggcga cagagtgacc 60atcacctgca
aggccagcca ggacatcaac acctacctga gctggttcca gcagaagccc 120ggcaaggccc
ccaagagcct gatctacaga agcaacatcc tggtggacgg cgtgcccagc 180agattcagcg
gcagcggcag cggccaggac ttcaccctga ccatcagcag cctgcagccc 240gaggacttcg
ccatctacta ctgcctacag tatgatgact ttccgtacac gttcggccag 300ggcaccaagc
tggagatcaa g
321106321DNAArtificial Sequencesynthetic polynucleotide 106gacatccaga
tgacccagag ccccagcagc ctgagcgcca gcgtgggcga cagagtgacc 60atcacctgca
aggccagcca ggacatcaac acctacctga gctggttcca gcagaagccc 120ggcaagagcc
ccaagagcct gatctacaga agcaacatcc tggtggacgg cgtgcccagc 180agattcagcg
gcagcggcag cggccaggac tacaccctga ccatcagcag cctgcagccc 240gaggacttcg
ccatctacta ctgcctacag tatgatgact ttccgtacac gttcggccag 300ggcaccaagc
tggagatcaa g
3211071344DNAArtificial Sequencesynthetic polynucleotide 107caggtgcagc
tggtgcagag cggcgccgag gtgaagaagc ccggcgccag cgtgaaggtg 60agctgcaagg
ccagcggcta caccttcacc agctactgga tgcactgggt gagacaggcc 120cccggccagg
gcctggagtg gatgggctac atcaacccca gcagcggcta caccaagagc 180aaccagaagt
tcaaggacag agtgaccatg accgccgaca ccagcaccag caccgcctac 240atggagctga
gcagcctgag aagcgaggac accgccgtgt actactgcgg aagatggtta 300ctttcggcct
ggtttgctta ctggggccag ggcaccctgg tgaccgtgag cagcgctagc 360accaagggcc
catcggtctt ccccctggca ccctcctcca agagcacctc tgggggcaca 420gcggccctgg
gctgcctggt caaggactac ttccccgaac cggtgacggt gtcgtggaac 480tcaggcgccc
tgaccagcgg cgtgcacacc ttcccggctg tcctacagtc ctcaggactc 540tactccctca
gcagcgtggt gaccgtgccc tccagcagct tgggcaccca gacctacatc 600tgcaacgtga
atcacaagcc cagcaacacc aaggtggaca agaaagttga gcccaaatct 660tgtgacaaaa
ctcacacatg cccaccgtgc ccagcacctg aactcctggg gggaccgtca 720gtcttcctct
tccccccaaa acccaaggac accctcatga tctcccggac ccctgaggtc 780acatgcgtgg
tggtggacgt gagccacgaa gaccctgagg tcaagttcaa ctggtacgtg 840gacggcgtgg
aggtgcataa tgccaagaca aagccgcggg aggagcagta caacagcacg 900taccgtgtgg
tcagcgtcct caccgtcctg caccaggact ggctgaatgg caaggagtac 960aagtgcaagg
tctccaacaa agccctccca gcccccatcg agaaaaccat ctccaaagcc 1020aaagggcagc
cccgagaacc acaggtgtac accctgcccc catcccggga tgagttgacc 1080aagaaccagg
tcagcctgac ctgcctggtc aaaggcttct atcccagcga catcgccgtg 1140gagtgggaga
gcaatgggca gccggagaac aactacaaga ccacgcctcc cgtgctggac 1200tccgacggct
ccttcttcct ctacagcaag ctcaccgtgg acaagagcag gtggcagcag 1260gggaacgtct
tctcatgctc cgtgatgcat gaggctctgc acaaccacta cacgcagaag 1320agcctctccc
tgtctccggg taaa
13441081344DNAArtificial Sequencesynthetic polynucleotide 108caggtgcagc
tggtgcagag cggcgccgag gtgaagaagc ccggcgccag cgtgaaggtg 60agctgcaagg
ccagcggcta caccttcacc agctactgga tgcactgggt gagacagaga 120cccggccagg
gcctggagtg gatgggctac atcaacccca gcagcggcta caccaagagc 180aaccagaagt
tcaaggacag agtgaccctg accgccgaca ccagcaccag caccgcctac 240atggagctga
gcagcctgag aagcgaggac accgccgtgt actactgcgg cagatggctg 300ctgagcgcct
ggttcgccta ctggggccag ggcaccctgg tgaccgtgag cagcgctagc 360accaagggcc
catcggtctt ccccctggca ccctcctcca agagcacctc tgggggcaca 420gcggccctgg
gctgcctggt caaggactac ttccccgaac cggtgacggt gtcgtggaac 480tcaggcgccc
tgaccagcgg cgtgcacacc ttcccggctg tcctacagtc ctcaggactc 540tactccctca
gcagcgtggt gaccgtgccc tccagcagct tgggcaccca gacctacatc 600tgcaacgtga
atcacaagcc cagcaacacc aaggtggaca agaaagttga gcccaaatct 660tgtgacaaaa
ctcacacatg cccaccgtgc ccagcacctg aactcctggg gggaccgtca 720gtcttcctct
tccccccaaa acccaaggac accctcatga tctcccggac ccctgaggtc 780acatgcgtgg
tggtggacgt gagccacgaa gaccctgagg tcaagttcaa ctggtacgtg 840gacggcgtgg
aggtgcataa tgccaagaca aagccgcggg aggagcagta caacagcacg 900taccgtgtgg
tcagcgtcct caccgtcctg caccaggact ggctgaatgg caaggagtac 960aagtgcaagg
tctccaacaa agccctccca gcccccatcg agaaaaccat ctccaaagcc 1020aaagggcagc
cccgagaacc acaggtgtac accctgcccc catcccggga tgagttgacc 1080aagaaccagg
tcagcctgac ctgcctggtc aaaggcttct atcccagcga catcgccgtg 1140gagtgggaga
gcaatgggca gccggagaac aactacaaga ccacgcctcc cgtgctggac 1200tccgacggct
ccttcttcct ctacagcaag ctcaccgtgg acaagagcag gtggcagcag 1260gggaacgtct
tctcatgctc cgtgatgcat gaggctctgc acaaccacta cacgcagaag 1320agcctctccc
tgtctccggg taaa
13441091344DNAArtificial Sequencesynthetic polynucleotide 109caggtgcagc
tgcagcagag cggcgccgag gtgaagaagc ccggcgccag cgtgaagctg 60agctgcaagg
ccagcggcta caccttcacc agctactgga tgcactgggt gagacagaga 120cccggccagg
gcctggagtg gatcggctac atcaacccca gcagcggcta caccaagagc 180aaccagaagt
tcaaggacag agccaccctg accgccgaca ccagcaccag caccgcctac 240atggagctga
gcagcctgag aagcgaggac accgccgtgt actactgcgg cagatggctg 300ctgagcgcct
ggttcgccta ctggggccag ggcaccctgg tgaccgtgag cagcgctagc 360accaagggcc
catcggtctt ccccctggca ccctcctcca agagcacctc tgggggcaca 420gcggccctgg
gctgcctggt caaggactac ttccccgaac cggtgacggt gtcgtggaac 480tcaggcgccc
tgaccagcgg cgtgcacacc ttcccggctg tcctacagtc ctcaggactc 540tactccctca
gcagcgtggt gaccgtgccc tccagcagct tgggcaccca gacctacatc 600tgcaacgtga
atcacaagcc cagcaacacc aaggtggaca agaaagttga gcccaaatct 660tgtgacaaaa
ctcacacatg cccaccgtgc ccagcacctg aactcctggg gggaccgtca 720gtcttcctct
tccccccaaa acccaaggac accctcatga tctcccggac ccctgaggtc 780acatgcgtgg
tggtggacgt gagccacgaa gaccctgagg tcaagttcaa ctggtacgtg 840gacggcgtgg
aggtgcataa tgccaagaca aagccgcggg aggagcagta caacagcacg 900taccgtgtgg
tcagcgtcct caccgtcctg caccaggact ggctgaatgg caaggagtac 960aagtgcaagg
tctccaacaa agccctccca gcccccatcg agaaaaccat ctccaaagcc 1020aaagggcagc
cccgagaacc acaggtgtac accctgcccc catcccggga tgagttgacc 1080aagaaccagg
tcagcctgac ctgcctggtc aaaggcttct atcccagcga catcgccgtg 1140gagtgggaga
gcaatgggca gccggagaac aactacaaga ccacgcctcc cgtgctggac 1200tccgacggct
ccttcttcct ctacagcaag ctcaccgtgg acaagagcag gtggcagcag 1260gggaacgtct
tctcatgctc cgtgatgcat gaggctctgc acaaccacta cacgcagaag 1320agcctctccc
tgtctccggg taaa
1344110642DNAArtificial Sequencesynthetic polynucleotide 110gacatccaga
tgacccagag ccccagcagc ctgagcgcca gcgtgggcga cagagtgacc 60atcacctgca
aggccagcca ggacatcaac acctacctga gctggttcca gcagaagccc 120ggcaaggccc
ccaagagcct gatctacaga agcaacatcc tggtggacgg cgtgcccagc 180agattcagcg
gcagcggcag cggccaggac ttcaccctga ccatcagcag cctgcagccc 240gaggacttcg
ccatctacta ctgcctacag tatgatgact ttccgtacac gttcggccag 300ggcaccaagc
tggagatcaa gcgtacggtg gctgcaccat ctgtcttcat cttcccgcca 360tctgatgagc
agttgaaatc tggaactgcc tctgttgtgt gcctgctgaa taacttctat 420cccagagagg
ccaaagtaca gtggaaggtg gataacgccc tccaatcggg taactcccag 480gagagtgtca
cagagcagga cagcaaggac agcacctaca gcctcagcag caccctgacg 540ctgagcaaag
cagactacga gaaacacaaa gtctacgcct gcgaagtcac ccatcagggc 600ctgagctcgc
ccgtcacaaa gagcttcaac aggggagagt gt
642111642DNAArtificial Sequencesynthetic polynucleotide 111gacatccaga
tgacccagag ccccagcagc ctgagcgcca gcgtgggcga cagagtgacc 60atcacctgca
aggccagcca ggacatcaac acctacctga gctggttcca gcagaagccc 120ggcaagagcc
ccaagagcct gatctacaga agcaacatcc tggtggacgg cgtgcccagc 180agattcagcg
gcagcggcag cggccaggac tacaccctga ccatcagcag cctgcagccc 240gaggacttcg
ccatctacta ctgcctacag tatgatgact ttccgtacac gttcggccag 300ggcaccaagc
tggagatcaa gcgtacggtg gctgcaccat ctgtcttcat cttcccgcca 360tctgatgagc
agttgaaatc tggaactgcc tctgttgtgt gcctgctgaa taacttctat 420cccagagagg
ccaaagtaca gtggaaggtg gataacgccc tccaatcggg taactcccag 480gagagtgtca
cagagcagga cagcaaggac agcacctaca gcctcagcag caccctgacg 540ctgagcaaag
cagactacga gaaacacaaa gtctacgcct gcgaagtcac ccatcagggc 600ctgagctcgc
ccgtcacaaa gagcttcaac aggggagagt gt
6421121326DNAArtificial Sequencesynthetic polynucleotide 112caggtgcagc
tggtgcagag cggcgccgag gtgaagaagc ccggcgccag cgtgaaggtg 60agctgcaagg
ccagcggcta caccttcacc agctactgga tgcactgggt gagacaggcc 120cccggccagg
gcctggagtg gatgggctac atcaacccca gcagcggcta caccaagagc 180aaccagaagt
tcaaggacag agtgaccatg accgccgaca ccagcaccag caccgcctac 240atggagctga
gcagcctgag aagcgaggac accgccgtgt actactgcgg aagatggtta 300ctttcggcct
ggtttgctta ctggggccag ggcaccctgg tgaccgtgag cagcgccaag 360accacccctc
cttccgtgta tcctctggct ccaggatccg ccgctcagac aaactccatg 420gtgaccctgg
gttgcctggt gaagggctac ttccctgagc cagtgaccgt gacttggaac 480tccggctctc
tgtcttccgg agtgcacaca tttccagccg tgctgcagag cgacctgtac 540acactgtcct
cctccgtgac cgtgccttct tccacttggc cttccgagac cgtgacttgc 600aacgtggccc
acccagcctc ttctaccaag gtggacaaga agatcgtccc ccgggattgc 660ggttgcaagc
cttgcatttg caccgtgccc gaggtgtcct ccgtgttcat cttccctccc 720aagcctaagg
acgtgctgac catcaccctg acccccaaag tgacttgcgt ggtggtggac 780atctctaagg
acgaccccga ggtgcagttc tcttggttcg tggacgacgt ggaggtgcac 840acagctcaga
cacagccccg ggaggagcag ttcaactcca ccttccggag cgtgtccgag 900ctgcccatca
tgcaccagga ttggctgaac ggcaaggagt tcaagtgccg cgtgaacagc 960gccgcttttc
cagcccctat cgagaagacc atctccaaga ccaagggcag gcccaaggct 1020cctcaggtgt
acaccatccc tccccctaag gagcagatgg ccaaggacaa ggtgtccctg 1080acttgcatga
tcaccgactt cttccccgag gacatcacag tcgagtggca gtggaacggc 1140cagccagccg
agaactacaa gaacacccag cccatcatgg ataccgacgg ctcttacttc 1200gtgtactcca
agctgaacgt gcagaagtcc aattgggagg ccggcaacac cttcacttgc 1260tccgtgctgc
acgagggact gcataaccac cacaccgaga agtccctgtc ccactctccc 1320ggcaag
13261131326DNAArtificial Sequencesynthetic polynucleotide 113caggtgcagc
tgcagcagag cggcgccgag gtgaagaagc ccggcgccag cgtgaagctg 60agctgcaagg
ccagcggcta caccttcacc agctactgga tgcactgggt gagacagaga 120cccggccagg
gcctggagtg gatcggctac atcaacccca gcagcggcta caccaagagc 180aaccagaagt
tcaaggacag agccaccctg accgccgaca ccagcaccag caccgcctac 240atggagctga
gcagcctgag aagcgaggac accgccgtgt actactgcgg cagatggctg 300ctgagcgcct
ggttcgccta ctggggccag ggcaccctgg tgaccgtgag cagcgccaag 360accacccctc
cttccgtgta tcctctggct ccaggatccg ccgctcagac aaactccatg 420gtgaccctgg
gttgcctggt gaagggctac ttccctgagc cagtgaccgt gacttggaac 480tccggctctc
tgtcttccgg agtgcacaca tttccagccg tgctgcagag cgacctgtac 540acactgtcct
cctccgtgac cgtgccttct tccacttggc cttccgagac cgtgacttgc 600aacgtggccc
acccagcctc ttctaccaag gtggacaaga agatcgtccc ccgggattgc 660ggttgcaagc
cttgcatttg caccgtgccc gaggtgtcct ccgtgttcat cttccctccc 720aagcctaagg
acgtgctgac catcaccctg acccccaaag tgacttgcgt ggtggtggac 780atctctaagg
acgaccccga ggtgcagttc tcttggttcg tggacgacgt ggaggtgcac 840acagctcaga
cacagccccg ggaggagcag ttcaactcca ccttccggag cgtgtccgag 900ctgcccatca
tgcaccagga ttggctgaac ggcaaggagt tcaagtgccg cgtgaacagc 960gccgcttttc
cagcccctat cgagaagacc atctccaaga ccaagggcag gcccaaggct 1020cctcaggtgt
acaccatccc tccccctaag gagcagatgg ccaaggacaa ggtgtccctg 1080acttgcatga
tcaccgactt cttccccgag gacatcacag tcgagtggca gtggaacggc 1140cagccagccg
agaactacaa gaacacccag cccatcatgg ataccgacgg ctcttacttc 1200gtgtactcca
agctgaacgt gcagaagtcc aattgggagg ccggcaacac cttcacttgc 1260tccgtgctgc
acgagggact gcataaccac cacaccgaga agtccctgtc ccactctccc 1320ggcaag
1326114642DNAArtificial Sequencesynthetic polynucleotide 114gacatccaga
tgacccagag ccccagcagc ctgagcgcca gcgtgggcga cagagtgacc 60atcacctgca
aggccagcca ggacatcaac acctacctga gctggttcca gcagaagccc 120ggcaaggccc
ccaagagcct gatctacaga agcaacatcc tggtggacgg cgtgcccagc 180agattcagcg
gcagcggcag cggccaggac ttcaccctga ccatcagcag cctgcagccc 240gaggacttcg
ccatctacta ctgcctacag tatgatgact ttccgtacac gttcggccag 300ggcaccaagc
tggagatcaa gagagccgac gccgctccta cagtgtctat cttcccccct 360tcttccgagc
agctgacctc tggaggagcc tccgtcgtgt gtttcctcaa caacttctac 420cccaaggaca
tcaacgtcaa gtggaagatc gacggctccg agaggcagaa cggcgtgctg 480aactcttgga
ccgaccagga ctccaaggac tccacctact ccatgtcctc caccctgacc 540ctgaccaagg
acgagtacga gcggcacaac tcctacactt gcgaggctac ccacaagacc 600tctacctccc
ccatcgtgaa gagcttcaac cgcaacgagt gt
642115642DNAArtificial Sequencesynthetic polynucleotide 115gacatccaga
tgacccagag ccccagcagc ctgagcgcca gcgtgggcga cagagtgacc 60atcacctgca
aggccagcca ggacatcaac acctacctga gctggttcca gcagaagccc 120ggcaagagcc
ccaagagcct gatctacaga agcaacatcc tggtggacgg cgtgcccagc 180agattcagcg
gcagcggcag cggccaggac tacaccctga ccatcagcag cctgcagccc 240gaggacttcg
ccatctacta ctgcctacag tatgatgact ttccgtacac gttcggccag 300ggcaccaagc
tggagatcaa gagagccgac gccgctccta cagtgtctat cttcccccct 360tcttccgagc
agctgacctc tggaggagcc tccgtcgtgt gtttcctcaa caacttctac 420cccaaggaca
tcaacgtcaa gtggaagatc gacggctccg agaggcagaa cggcgtgctg 480aactcttgga
ccgaccagga ctccaaggac tccacctact ccatgtcctc caccctgacc 540ctgaccaagg
acgagtacga gcggcacaac tcctacactt gcgaggctac ccacaagacc 600tctacctccc
ccatcgtgaa gagcttcaac cgcaacgagt gt
6421161344DNAArtificial Sequencesynthetic polynucleotide 116caggtgcagc
tggtgcagag cggcgccgag gtgaagaagc ccggcgccag cgtgaaggtg 60agctgcaagg
ccagcggcta caccttcacc agctactgga tgcactgggt gagacaggcc 120cccggccagg
gcctggagtg gatgggctac atcaacccca gcagcggcta caccaagagc 180aaccagaagt
tcaaggacag agtgaccatg accgccgaca ccagcaccag caccgcctac 240atggagctga
gcagcctgag aagcgaggac accgccgtgt actactgcgg aagatggtta 300ctttcggcct
ggtttgctta ctggggccag ggcaccctgg tgaccgtgag cagcgctagc 360acaaaaggac
cttccgtgtt tcctctggct ccttcttcta agtctaccag cggaggaaca 420gcagctctgg
gttgtctggt gaaagattac ttcccagagc cagtgacagt gtcttggaat 480tcaggagctc
tgacatcagg agtgcataca tttccagcag tgctgcagtc ttcaggtctg 540tattctctgt
cctcagtggt gacagtgcct tcttcttctc tgggaaccca gacctacatc 600tgtaacgtga
accacaagcc ttccaacacc aaggtggata agagagtgga gcccaagtct 660tgcgataaga
cccatacttg ccctccttgt ccagctccag aatttgaagg aggaccatca 720gtgttcctgt
ttcctcctaa gcctaaggac accctgatga tctcccggac cccagaagtg 780acttgtgtgg
tggtggacgt gtctcacgaa gatcccgagg tgaagttcaa ttggtacgtg 840gacggagtgg
aagtgcataa cgctaagaca aagcctagag aggagcagta caactccaca 900tacagagtgg
tgtcagtgct gacagtgctg catcaggatt ggctgaacgg aaaggagtac 960aagtgcaagg
tgtctaacaa ggctctgcca gcttctatcg agaagaccat ctccaaggct 1020aagggacagc
ctagagaacc tcaggtgtac accctgcctc cttcccggga ggagatgaca 1080aagaaccagg
tctctctgac ttgtctggtg aagggctttt acccttccga catcgccgtg 1140gaatgggaat
ctaacggaca gccagagaac aactacaaga ccacacctcc agtgctggat 1200tccgacggct
ccttcttcct gtactccaag ctgaccgtgg ataaatctcg ttggcagcag 1260ggaaacgtgt
tctcttgtag cgtgatgcac gaagctctgc acaatcacta cacccagaag 1320tccctgtctc
tgtctccagg aaaa
13441171344DNAArtificial Sequencesynthetic polynucleotide 117caggtgcagc
tgcagcagag cggcgccgag gtgaagaagc ccggcgccag cgtgaagctg 60agctgcaagg
ccagcggcta caccttcacc agctactgga tgcactgggt gagacagaga 120cccggccagg
gcctggagtg gatcggctac atcaacccca gcagcggcta caccaagagc 180aaccagaagt
tcaaggacag agccaccctg accgccgaca ccagcaccag caccgcctac 240atggagctga
gcagcctgag aagcgaggac accgccgtgt actactgcgg cagatggctg 300ctgagcgcct
ggttcgccta ctggggccag ggcaccctgg tgaccgtgag cagcgctagc 360acaaaaggac
cttccgtgtt tcctctggct ccttcttcta agtctaccag cggaggaaca 420gcagctctgg
gttgtctggt gaaagattac ttcccagagc cagtgacagt gtcttggaat 480tcaggagctc
tgacatcagg agtgcataca tttccagcag tgctgcagtc ttcaggtctg 540tattctctgt
cctcagtggt gacagtgcct tcttcttctc tgggaaccca gacctacatc 600tgtaacgtga
accacaagcc ttccaacacc aaggtggata agagagtgga gcccaagtct 660tgcgataaga
cccatacttg ccctccttgt ccagctccag aatttgaagg aggaccatca 720gtgttcctgt
ttcctcctaa gcctaaggac accctgatga tctcccggac cccagaagtg 780acttgtgtgg
tggtggacgt gtctcacgaa gatcccgagg tgaagttcaa ttggtacgtg 840gacggagtgg
aagtgcataa cgctaagaca aagcctagag aggagcagta caactccaca 900tacagagtgg
tgtcagtgct gacagtgctg catcaggatt ggctgaacgg aaaggagtac 960aagtgcaagg
tgtctaacaa ggctctgcca gcttctatcg agaagaccat ctccaaggct 1020aagggacagc
ctagagaacc tcaggtgtac accctgcctc cttcccggga ggagatgaca 1080aagaaccagg
tctctctgac ttgtctggtg aagggctttt acccttccga catcgccgtg 1140gaatgggaat
ctaacggaca gccagagaac aactacaaga ccacacctcc agtgctggat 1200tccgacggct
ccttcttcct gtactccaag ctgaccgtgg ataaatctcg ttggcagcag 1260ggaaacgtgt
tctcttgtag cgtgatgcac gaagctctgc acaatcacta cacccagaag 1320tccctgtctc
tgtctccagg aaaa
1344118442PRTArtificial Sequencesynthetic polypeptide 118Gln Val His Leu
Gln Gln Ser Gly Ala Glu Leu Ala Lys Pro Gly Ala1 5
10 15Ser Val Asn Leu Ser Cys Lys Ala Ser Gly
Tyr Ala Phe Thr Ser Tyr 20 25
30Trp Met His Trp Val Lys Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile
35 40 45Gly Tyr Ile Asn Pro Ser Ser Gly
Leu Ala Lys Tyr Asn Gln Lys Phe 50 55
60Lys Asp Lys Ala Thr Leu Thr Thr Asp Lys Ser Ser Asn Thr Ala Tyr65
70 75 80Met Gln Leu Ser Ser
Leu Thr Tyr Asp Asp Ser Ala Val Tyr Tyr Cys 85
90 95Gly Arg Trp Leu Leu Ser Ala Trp Phe Ala Tyr
Trp Gly Gln Gly Thr 100 105
110Leu Val Thr Val Ser Ala Ala Lys Thr Thr Pro Pro Ser Val Tyr Pro
115 120 125Leu Ala Pro Gly Ser Ala Ala
Gln Thr Asn Ser Met Val Thr Leu Gly 130 135
140Cys Leu Val Lys Gly Tyr Phe Pro Glu Pro Val Thr Val Thr Trp
Asn145 150 155 160Ser Gly
Ser Leu Ser Ser Gly Val His Thr Phe Pro Ala Val Leu Gln
165 170 175Ser Asp Leu Tyr Thr Leu Ser
Ser Ser Val Thr Val Pro Ser Ser Thr 180 185
190Trp Pro Ser Glu Thr Val Thr Cys Asn Val Ala His Pro Ala
Ser Ser 195 200 205Thr Lys Val Asp
Lys Lys Ile Val Pro Arg Asp Cys Gly Cys Lys Pro 210
215 220Cys Ile Cys Thr Val Pro Glu Val Ser Ser Val Phe
Ile Phe Pro Pro225 230 235
240Lys Pro Lys Asp Val Leu Thr Ile Thr Leu Thr Pro Lys Val Thr Cys
245 250 255Val Val Val Asp Ile
Ser Lys Asp Asp Pro Glu Val Gln Phe Ser Trp 260
265 270Phe Val Asp Asp Val Glu Val His Thr Ala Gln Thr
Gln Pro Arg Glu 275 280 285Glu Gln
Phe Asn Ser Thr Phe Arg Ser Val Ser Glu Leu Pro Ile Met 290
295 300His Gln Asp Trp Leu Asn Gly Lys Glu Phe Lys
Cys Arg Val Asn Ser305 310 315
320Ala Ala Phe Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly
325 330 335Arg Pro Lys Ala
Pro Gln Val Tyr Thr Ile Pro Pro Pro Lys Glu Gln 340
345 350Met Ala Lys Asp Lys Val Ser Leu Thr Cys Met
Ile Thr Asp Phe Phe 355 360 365Pro
Glu Asp Ile Thr Val Glu Trp Gln Trp Asn Gly Gln Pro Ala Glu 370
375 380Asn Tyr Lys Asn Thr Gln Pro Ile Met Asp
Thr Asp Gly Ser Tyr Phe385 390 395
400Val Tyr Ser Lys Leu Asn Val Gln Lys Ser Asn Trp Glu Ala Gly
Asn 405 410 415Thr Phe Thr
Cys Ser Val Leu His Glu Gly Leu His Asn His His Thr 420
425 430Glu Lys Ser Leu Ser His Ser Pro Gly Lys
435 440119214PRTArtificial Sequencesynthetic
polypeptide 119Asp Ile Lys Met Thr Gln Ser Pro Ser Ser Ile Tyr Ala Ser
Leu Gly1 5 10 15Glu Arg
Val Thr Ile Thr Cys Lys Ala Ser Gln Gly Ile Asn Thr Tyr 20
25 30Leu Ser Trp Phe Gln Gln Lys Pro Gly
Lys Ser Pro Lys Thr Leu Ile 35 40
45Tyr Arg Ala Asn Ile Leu Val Asp Gly Val Pro Ser Arg Phe Ser Gly 50
55 60Ser Gly Ser Gly Gln Asp Tyr Ser Leu
Thr Ile Asn Ser Leu Glu Tyr65 70 75
80Glu Asp Met Gly Ile Tyr Tyr Cys Leu Gln Tyr Asp Glu Phe
Pro Tyr 85 90 95Thr Phe
Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala 100
105 110Pro Thr Val Ser Ile Phe Pro Pro Ser
Ser Glu Gln Leu Thr Ser Gly 115 120
125Gly Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile
130 135 140Asn Val Lys Trp Lys Ile Asp
Gly Ser Glu Arg Gln Asn Gly Val Leu145 150
155 160Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr
Tyr Ser Met Ser 165 170
175Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr
180 185 190Thr Cys Glu Ala Thr His
Lys Thr Ser Thr Ser Pro Ile Val Lys Ser 195 200
205Phe Asn Arg Asn Glu Cys 210120442PRTArtificial
Sequencesynthetic polypeptide 120Gln Val Gln Leu Gln Gln Ser Gly Ala Glu
Leu Ala Lys Pro Gly Ala1 5 10
15Ser Val Lys Leu Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr
20 25 30Trp Met His Trp Val Lys
Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile 35 40
45Gly Tyr Ile Asn Pro Ser Ser Gly Tyr Thr Lys Ser Asn Gln
Lys Phe 50 55 60Lys Asp Lys Ala Thr
Leu Thr Ala Asp Lys Ser Ser Ser Thr Ala Tyr65 70
75 80Met Gln Leu Ser Ser Leu Thr Tyr Glu Asp
Ser Ala Val Tyr Tyr Cys 85 90
95Gly Arg Trp Leu Leu Ser Ala Trp Phe Ala Tyr Trp Gly Gln Gly Thr
100 105 110Leu Val Thr Val Ser
Ala Ala Lys Thr Thr Pro Pro Ser Val Tyr Pro 115
120 125Leu Ala Pro Gly Ser Ala Ala Gln Thr Asn Ser Met
Val Thr Leu Gly 130 135 140Cys Leu Val
Lys Gly Tyr Phe Pro Glu Pro Val Thr Val Thr Trp Asn145
150 155 160Ser Gly Ser Leu Ser Ser Gly
Val His Thr Phe Pro Ala Val Leu Gln 165
170 175Ser Asp Leu Tyr Thr Leu Ser Ser Ser Val Thr Val
Pro Ser Ser Thr 180 185 190Trp
Pro Ser Glu Thr Val Thr Cys Asn Val Ala His Pro Ala Ser Ser 195
200 205Thr Lys Val Asp Lys Lys Ile Val Pro
Arg Asp Cys Gly Cys Lys Pro 210 215
220Cys Ile Cys Thr Val Pro Glu Val Ser Ser Val Phe Ile Phe Pro Pro225
230 235 240Lys Pro Lys Asp
Val Leu Thr Ile Thr Leu Thr Pro Lys Val Thr Cys 245
250 255Val Val Val Asp Ile Ser Lys Asp Asp Pro
Glu Val Gln Phe Ser Trp 260 265
270Phe Val Asp Asp Val Glu Val His Thr Ala Gln Thr Gln Pro Arg Glu
275 280 285Glu Gln Phe Asn Ser Thr Phe
Arg Ser Val Ser Glu Leu Pro Ile Met 290 295
300His Gln Asp Trp Leu Asn Gly Lys Glu Phe Lys Cys Arg Val Asn
Ser305 310 315 320Ala Ala
Phe Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly
325 330 335Arg Pro Lys Ala Pro Gln Val
Tyr Thr Ile Pro Pro Pro Lys Glu Gln 340 345
350Met Ala Lys Asp Lys Val Ser Leu Thr Cys Met Ile Thr Asp
Phe Phe 355 360 365Pro Glu Asp Ile
Thr Val Glu Trp Gln Trp Asn Gly Gln Pro Ala Glu 370
375 380Asn Tyr Lys Asn Thr Gln Pro Ile Met Asp Thr Asp
Gly Ser Tyr Phe385 390 395
400Val Tyr Ser Lys Leu Asn Val Gln Lys Ser Asn Trp Glu Ala Gly Asn
405 410 415Thr Phe Thr Cys Ser
Val Leu His Glu Gly Leu His Asn His His Thr 420
425 430Glu Lys Ser Leu Ser His Ser Pro Gly Lys
435 440121214PRTArtificial Sequencesynthetic polypeptide
121Asp Ile Arg Met Thr Gln Ser Pro Ser Ser Met Tyr Ala Ser Leu Gly1
5 10 15Glu Arg Val Thr Ile Thr
Cys Lys Ala Ser Gln Asp Ile Asn Thr Tyr 20 25
30Leu Ser Trp Phe Gln Gln Lys Pro Gly Lys Ser Pro Lys
Ser Leu Ile 35 40 45Tyr Arg Ser
Asn Ile Leu Val Asp Gly Val Pro Ser Arg Phe Ser Gly 50
55 60Ser Gly Ser Gly Gln Asp Tyr Ser Leu Thr Ile Ser
Ser Leu Glu Tyr65 70 75
80Glu Asp Met Gly Ile Tyr Tyr Cys Leu Gln Tyr Asp Asp Phe Pro Tyr
85 90 95Thr Phe Gly Gly Gly Thr
Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala 100
105 110Pro Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln
Leu Thr Ser Gly 115 120 125Gly Ala
Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile 130
135 140Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg
Gln Asn Gly Val Leu145 150 155
160Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser
165 170 175Ser Thr Leu Thr
Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr 180
185 190Thr Cys Glu Ala Thr His Lys Thr Ser Thr Ser
Pro Ile Val Lys Ser 195 200 205Phe
Asn Arg Asn Glu Cys 210122443PRTArtificial Sequencesynthetic
polypeptide 122Gln Val Gln Leu Lys Glu Ser Gly Pro Gly Leu Val Ala Pro
Ser Gln1 5 10 15Ser Leu
Ser Ile Thr Cys Thr Val Ser Gly Phe Ser Leu Thr Asn Tyr 20
25 30Gly Val His Trp Val Arg Gln Pro Pro
Gly Lys Gly Leu Glu Trp Leu 35 40
45Gly Val Ile Trp Ala Gly Gly Ser Thr Asn Tyr Asn Ser Ala Leu Met 50
55 60Ser Arg Leu Ser Ile Ser Lys Asp Asn
Ser Lys Ser Gln Leu Phe Leu65 70 75
80Lys Met Asn Ser Leu Gln Ala Asp Asp Thr Ala Met Tyr Tyr
Cys Ala 85 90 95Arg Glu
Arg Gly Ser Ser Trp Gly Thr Met Asp Tyr Trp Gly Gln Gly 100
105 110Thr Ser Val Thr Val Ser Ser Ala Lys
Thr Thr Pro Pro Ser Val Tyr 115 120
125Pro Leu Ala Pro Gly Ser Ala Ala Gln Thr Asn Ser Met Val Thr Leu
130 135 140Gly Cys Leu Val Lys Gly Tyr
Phe Pro Glu Pro Val Thr Val Thr Trp145 150
155 160Asn Ser Gly Ser Leu Ser Ser Gly Val His Thr Phe
Pro Ala Val Leu 165 170
175Gln Ser Asp Leu Tyr Thr Leu Ser Ser Ser Val Thr Val Pro Ser Ser
180 185 190Thr Trp Pro Ser Glu Thr
Val Thr Cys Asn Val Ala His Pro Ala Ser 195 200
205Ser Thr Lys Val Asp Lys Lys Ile Val Pro Arg Asp Cys Gly
Cys Lys 210 215 220Pro Cys Ile Cys Thr
Val Pro Glu Val Ser Ser Val Phe Ile Phe Pro225 230
235 240Pro Lys Pro Lys Asp Val Leu Thr Ile Thr
Leu Thr Pro Lys Val Thr 245 250
255Cys Val Val Val Asp Ile Ser Lys Asp Asp Pro Glu Val Gln Phe Ser
260 265 270Trp Phe Val Asp Asp
Val Glu Val His Thr Ala Gln Thr Gln Pro Arg 275
280 285Glu Glu Gln Phe Asn Ser Thr Phe Arg Ser Val Ser
Glu Leu Pro Ile 290 295 300Met His Gln
Asp Trp Leu Asn Gly Lys Glu Phe Lys Cys Arg Val Asn305
310 315 320Ser Ala Ala Phe Pro Ala Pro
Ile Glu Lys Thr Ile Ser Lys Thr Lys 325
330 335Gly Arg Pro Lys Ala Pro Gln Val Tyr Thr Ile Pro
Pro Pro Lys Glu 340 345 350Gln
Met Ala Lys Asp Lys Val Ser Leu Thr Cys Met Ile Thr Asp Phe 355
360 365Phe Pro Glu Asp Ile Thr Val Glu Trp
Gln Trp Asn Gly Gln Pro Ala 370 375
380Glu Asn Tyr Lys Asn Thr Gln Pro Ile Met Asp Thr Asp Gly Ser Tyr385
390 395 400Phe Val Tyr Ser
Lys Leu Asn Val Gln Lys Ser Asn Trp Glu Ala Gly 405
410 415Asn Thr Phe Thr Cys Ser Val Leu His Glu
Gly Leu His Asn His His 420 425
430Thr Glu Lys Ser Leu Ser His Ser Pro Gly Lys 435
440123213PRTArtificial Sequencesynthetic polypeptide 123Gln Ile Val Leu
Thr Gln Ser Pro Ala Ile Met Ser Ala Ser Pro Gly1 5
10 15Glu Lys Val Thr Met Thr Cys Ser Ala Ser
Ser Arg Val Ser Tyr Met 20 25
30His Trp Tyr Gln Gln Lys Ser Gly Thr Ser Pro Lys Arg Trp Ile Tyr
35 40 45Asp Thr Ser Gln Leu Ala Ser Gly
Val Pro Ala Arg Phe Ser Gly Ser 50 55
60Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile Ser Ser Met Glu Ala Glu65
70 75 80Asp Ala Ala Thr Tyr
Tyr Cys Gln Gln Trp Ser Ser Asn Pro Tyr Thr 85
90 95Phe Gly Gly Gly Thr Lys Leu Glu Met Arg Arg
Ala Asp Ala Ala Pro 100 105
110Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly
115 120 125Ala Ser Val Val Cys Phe Leu
Asn Asn Phe Tyr Pro Lys Asp Ile Asn 130 135
140Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu
Asn145 150 155 160Ser Trp
Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser
165 170 175Thr Leu Thr Leu Thr Lys Asp
Glu Tyr Glu Arg His Asn Ser Tyr Thr 180 185
190Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys
Ser Phe 195 200 205Asn Arg Asn Glu
Cys 210124444PRTArtificial Sequencesynthetic polypeptide 124Gln Val
Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5
10 15Ser Val Lys Val Ser Cys Lys Ala
Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25
30Trp Met His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp
Met 35 40 45Gly Tyr Ile Asn Pro
Ser Ser Gly Tyr Thr Lys Ser Asn Gln Lys Phe 50 55
60Lys Asp Arg Val Thr Met Thr Ala Asp Thr Ser Thr Ser Thr
Ala Tyr65 70 75 80Met
Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Gly Arg Trp Leu Leu Ser Ala
Trp Phe Ala Tyr Trp Gly Gln Gly Thr 100 105
110Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val
Phe Pro 115 120 125Leu Ala Pro Cys
Ser Arg Ser Thr Ser Glu Ser Thr Ala Ala Leu Gly 130
135 140Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr
Val Ser Trp Asn145 150 155
160Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln
165 170 175Ser Ser Gly Leu Tyr
Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser 180
185 190Asn Phe Gly Thr Gln Thr Tyr Thr Cys Asn Val Asp
His Lys Pro Ser 195 200 205Asn Thr
Lys Val Asp Lys Thr Val Glu Arg Lys Cys Cys Val Glu Cys 210
215 220Pro Pro Cys Pro Ala Pro Pro Val Ala Gly Pro
Ser Val Phe Leu Phe225 230 235
240Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val
245 250 255Thr Cys Val Val
Val Asp Val Ser His Glu Asp Pro Glu Val Gln Phe 260
265 270Asn Trp Tyr Val Asp Gly Val Glu Val His Asn
Ala Lys Thr Lys Pro 275 280 285Arg
Glu Glu Gln Phe Asn Ser Thr Phe Arg Val Val Ser Val Leu Thr 290
295 300Val Val His Gln Asp Trp Leu Asn Gly Lys
Glu Tyr Lys Cys Lys Val305 310 315
320Ser Asn Lys Gly Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys
Thr 325 330 335Lys Gly Gln
Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg 340
345 350Glu Glu Met Thr Lys Asn Gln Val Ser Leu
Thr Cys Leu Val Lys Gly 355 360
365Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro 370
375 380Glu Asn Asn Tyr Lys Thr Thr Pro
Pro Met Leu Asp Ser Asp Gly Ser385 390
395 400Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser
Arg Trp Gln Gln 405 410
415Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His
420 425 430Tyr Thr Gln Lys Ser Leu
Ser Leu Ser Pro Gly Lys 435 440125445PRTArtificial
Sequencesynthetic polypeptide 125Gln Val Gln Leu Val Gln Ser Gly Ala Glu
Val Lys Lys Pro Gly Ala1 5 10
15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr
20 25 30Trp Met His Trp Val Arg
Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40
45Gly Tyr Ile Asn Pro Ser Ser Gly Tyr Thr Lys Ser Asn Gln
Lys Phe 50 55 60Lys Asp Arg Val Thr
Met Thr Ala Asp Thr Ser Thr Ser Thr Ala Tyr65 70
75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90
95Gly Arg Trp Leu Leu Ser Ala Trp Phe Ala Tyr Trp Gly Gln Gly Thr
100 105 110Leu Val Thr Val Ser
Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro 115
120 125Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser Thr
Ala Ala Leu Gly 130 135 140Cys Leu Val
Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn145
150 155 160Ser Gly Ala Leu Thr Ser Gly
Val His Thr Phe Pro Ala Val Leu Gln 165
170 175Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr
Val Pro Ser Ser 180 185 190Ser
Leu Gly Thr Lys Thr Tyr Thr Cys Asn Val Asp His Lys Pro Ser 195
200 205Asn Thr Lys Val Asp Lys Arg Val Glu
Ser Lys Tyr Gly Pro Pro Cys 210 215
220Pro Pro Cys Pro Ala Pro Glu Phe Leu Gly Gly Pro Ser Val Phe Leu225
230 235 240Phe Pro Pro Lys
Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu 245
250 255Val Thr Cys Val Val Val Asp Val Ser Gln
Glu Asp Pro Glu Val Gln 260 265
270Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys
275 280 285Pro Arg Glu Glu Gln Phe Asn
Ser Thr Tyr Arg Val Val Ser Val Leu 290 295
300Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys
Lys305 310 315 320Val Ser
Asn Lys Gly Leu Pro Ser Ser Ile Glu Lys Thr Ile Ser Lys
325 330 335Ala Lys Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr Leu Pro Pro Ser 340 345
350Gln Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu
Val Lys 355 360 365Gly Phe Tyr Pro
Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln 370
375 380Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu
Asp Ser Asp Gly385 390 395
400Ser Phe Phe Leu Tyr Ser Arg Leu Thr Val Asp Lys Ser Arg Trp Gln
405 410 415Glu Gly Asn Val Phe
Ser Cys Ser Val Met His Glu Ala Leu His Asn 420
425 430His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Leu Gly
Lys 435 440 445126444PRTArtificial
Sequencesynthetic polypeptide 126Gln Val Gln Leu Gln Gln Ser Gly Ala Glu
Val Lys Lys Pro Gly Ala1 5 10
15Ser Val Lys Leu Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr
20 25 30Trp Met His Trp Val Arg
Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile 35 40
45Gly Tyr Ile Asn Pro Ser Ser Gly Tyr Thr Lys Ser Asn Gln
Lys Phe 50 55 60Lys Asp Arg Ala Thr
Leu Thr Ala Asp Thr Ser Thr Ser Thr Ala Tyr65 70
75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90
95Gly Arg Trp Leu Leu Ser Ala Trp Phe Ala Tyr Trp Gly Gln Gly Thr
100 105 110Leu Val Thr Val Ser
Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro 115
120 125Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser Thr
Ala Ala Leu Gly 130 135 140Cys Leu Val
Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn145
150 155 160Ser Gly Ala Leu Thr Ser Gly
Val His Thr Phe Pro Ala Val Leu Gln 165
170 175Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr
Val Pro Ser Ser 180 185 190Asn
Phe Gly Thr Gln Thr Tyr Thr Cys Asn Val Asp His Lys Pro Ser 195
200 205Asn Thr Lys Val Asp Lys Thr Val Glu
Arg Lys Cys Cys Val Glu Cys 210 215
220Pro Pro Cys Pro Ala Pro Pro Val Ala Gly Pro Ser Val Phe Leu Phe225
230 235 240Pro Pro Lys Pro
Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val 245
250 255Thr Cys Val Val Val Asp Val Ser His Glu
Asp Pro Glu Val Gln Phe 260 265
270Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro
275 280 285Arg Glu Glu Gln Phe Asn Ser
Thr Phe Arg Val Val Ser Val Leu Thr 290 295
300Val Val His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys
Val305 310 315 320Ser Asn
Lys Gly Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr
325 330 335Lys Gly Gln Pro Arg Glu Pro
Gln Val Tyr Thr Leu Pro Pro Ser Arg 340 345
350Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val
Lys Gly 355 360 365Phe Tyr Pro Ser
Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro 370
375 380Glu Asn Asn Tyr Lys Thr Thr Pro Pro Met Leu Asp
Ser Asp Gly Ser385 390 395
400Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln
405 410 415Gly Asn Val Phe Ser
Cys Ser Val Met His Glu Ala Leu His Asn His 420
425 430Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys
435 440127445PRTArtificial Sequencesynthetic
polypeptide 127Gln Val Gln Leu Gln Gln Ser Gly Ala Glu Val Lys Lys Pro
Gly Ala1 5 10 15Ser Val
Lys Leu Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20
25 30Trp Met His Trp Val Arg Gln Arg Pro
Gly Gln Gly Leu Glu Trp Ile 35 40
45Gly Tyr Ile Asn Pro Ser Ser Gly Tyr Thr Lys Ser Asn Gln Lys Phe 50
55 60Lys Asp Arg Ala Thr Leu Thr Ala Asp
Thr Ser Thr Ser Thr Ala Tyr65 70 75
80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr
Tyr Cys 85 90 95Gly Arg
Trp Leu Leu Ser Ala Trp Phe Ala Tyr Trp Gly Gln Gly Thr 100
105 110Leu Val Thr Val Ser Ser Ala Ser Thr
Lys Gly Pro Ser Val Phe Pro 115 120
125Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser Thr Ala Ala Leu Gly
130 135 140Cys Leu Val Lys Asp Tyr Phe
Pro Glu Pro Val Thr Val Ser Trp Asn145 150
155 160Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro
Ala Val Leu Gln 165 170
175Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser
180 185 190Ser Leu Gly Thr Lys Thr
Tyr Thr Cys Asn Val Asp His Lys Pro Ser 195 200
205Asn Thr Lys Val Asp Lys Arg Val Glu Ser Lys Tyr Gly Pro
Pro Cys 210 215 220Pro Pro Cys Pro Ala
Pro Glu Phe Leu Gly Gly Pro Ser Val Phe Leu225 230
235 240Phe Pro Pro Lys Pro Lys Asp Thr Leu Met
Ile Ser Arg Thr Pro Glu 245 250
255Val Thr Cys Val Val Val Asp Val Ser Gln Glu Asp Pro Glu Val Gln
260 265 270Phe Asn Trp Tyr Val
Asp Gly Val Glu Val His Asn Ala Lys Thr Lys 275
280 285Pro Arg Glu Glu Gln Phe Asn Ser Thr Tyr Arg Val
Val Ser Val Leu 290 295 300Thr Val Leu
His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys305
310 315 320Val Ser Asn Lys Gly Leu Pro
Ser Ser Ile Glu Lys Thr Ile Ser Lys 325
330 335Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
Leu Pro Pro Ser 340 345 350Gln
Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys 355
360 365Gly Phe Tyr Pro Ser Asp Ile Ala Val
Glu Trp Glu Ser Asn Gly Gln 370 375
380Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly385
390 395 400Ser Phe Phe Leu
Tyr Ser Arg Leu Thr Val Asp Lys Ser Arg Trp Gln 405
410 415Glu Gly Asn Val Phe Ser Cys Ser Val Met
His Glu Ala Leu His Asn 420 425
430His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Leu Gly Lys 435
440 445
User Contributions:
Comment about this patent or add new information about this topic: