Patent application title: BI-SPECIFIC BINDING MOLECULES
Inventors:
Estelle Grace Mclean (Craigavon, GB)
Paul Richard Trumper (Craigavon, GB)
Jennifer Thom (Craigavon, GB)
Timothy Harrison (Craigavon, GB)
Graham John Cotton (Craigavon, GB)
Chiara Saladino (Craigavon, GB)
Caroline Barelle (Craigavon, GB)
Andrew Porter (Craigavon, GB)
Marina Kovaleva (Craigavon, GB)
Assignees:
Almac Discovery Limited
IPC8 Class: AC07K1628FI
USPC Class:
1 1
Class name:
Publication date: 2021-10-14
Patent application number: 20210317204
Abstract:
The present invention relates to bi-specific antigen binding molecules
and associated fusion proteins and conjugates. In particular, the present
invention relates to bi-specific antigen binding molecules with
specificity for both receptor tyrosine kinase-like orphan receptor 1
(ROR1) and epidermal growth factor receptor (EGFR) and associated fusion
proteins and conjugates. In a further aspect, the present invention
relates to conjugated immunoglobulin-like shark variable novel antigen
receptors (VNARs).Claims:
1. A bi-specific antigen binding molecule comprising: (i) a receptor
tyrosine kinase-like orphan receptor 1 (ROR1) specific antigen binding
molecule comprising an amino acid sequence represented by the formula
(I): FW1-CDR1-FW2-HV2-FW3a-HV4-FW3b-CDR3-FW4 (I) wherein FW1 is a
framework region CDR1 is a CDR sequence FW2 is a framework region HV2 is
a hypervariable sequence FW3a is a framework region HV4 is a
hypervariable sequence FW3b is a framework region CDR3 is a CDR sequence
FW4 is a framework region; and (ii) an epidermal growth factor receptor
(EGFR) specific antigen binding molecule; or a functional variant
thereof.
2. The bi-specific antigen binding molecule of claim 1, wherein the ROR1-specific antigen binding molecule does not bind to receptor tyrosine kinase-like orphan receptor 2 (ROR2).
3. The bi-specific antigen binding molecule of claim 1, wherein the ROR1-specific antigen binding molecule binds to both human ROR1 and murine ROR1 (mROR1).
4. The bi-specific antigen binding molecule claim 1, wherein the ROR1-specific antigen binding molecule binds to deglycosylated ROR1.
5. The bi-specific antigen binding molecule of claim 1, wherein the ROR1-specific antigen binding molecule does not bind to a linear peptide sequence selected from: TABLE-US-00038 (SEQ ID NO: 34) YMESLHMQGEIENQI (SEQ ID NO: 35) CQPWNSQYPHTHTFTALRFP (SEQ ID NO: 36) RSTIYGSRLRIRNLDTTDTGYFQ (SEQ ID NO: 37) QCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYE
6. The bi-specific antigen binding molecule of claim 1 comprising a ROR1-specific antigen binding molecule wherein FW1 is a framework region of from 20 to 28 amino acids CDR1 is a CDR sequence selected from DTSYGLYS (SEQ ID NO: 1), GAKYGLAA (SEQ ID NO: 2), GAKYGLFA (SEQ ID NO: 3), GANYGLAA (SEQ ID NO: 4), or GANYGLAS (SEQ ID NO: 5) FW2 is a framework region of from 6 to 14 amino acids HV2 is a hypervariable sequence selected from TTDWERMSIG (SEQ ID NO: 6), SSNQERISIS (SEQ ID NO: 7), or SSNKEQISIS (SEQ ID NO: 8) FW3a is a framework region of from 6 to 10 amino acids HV4 is a hypervariable sequence selected from NKRAK (SEQ ID NO: 9), NKRTM (SEQ ID NO: 10), NKGAK (SEQ ID NO: 11), or NKGTK (SEQ ID NO: 12) FW3b is a framework region of from 17 to 24 amino acids CDR3 is a CDR sequence selected from QSGMAISTGSGHGYNWY (SEQ ID NO: 13), QSGMAIDIGSGHGYNWY (SEQ ID NO: 14), YPWAMWGQWY (SEQ ID NO: 15), VFMPQHWHPAAHWY (SEQ ID NO: 16), REARHPWLRQWY (SEQ ID NO: 17), or YPWGAGAPWLVQWY (SEQ ID NO: 18) FW4 is a framework region of from 7 to 14 amino acids or a functional variant thereof with at least 45% sequence identity thereto.
7. The bi-specific antigen binding molecule of claim 6, wherein FW1 is selected from: ASVNQTPRTATKETGESLTINCVLT (SEQ ID NO: 19), AKVDQTPRTATKETGESLTINCVLT (SEQ ID NO: 20), TRVDQTPRTATKETGESLTINCWT (SEQ ID NO: 21), TRVDQTPRTATKETGESLTINCVLT (SEQ ID NO: 22), ASVNQTPRTATKETGESLTINCWT (SEQ ID NO: 23), or TRVDQSPSSLSASVGDRVTITCVLT (SEQ ID NO: 24), FW2 is selected from: TSWFRKNPG (SEQ ID NO: 25), or TYWYRKNPG (SEQ ID NO: 26); FW3a is selected from: GRYVESV (SEQ ID NO: 27), or GRYSESV (SEQ ID NO: 28), FW3b is selected from: SFSLRIKDLTVADSATYYCKA (SEQ ID NO: 29), SFTLTISSLQPEDSATYYCRA (SEQ ID NO: 30), or SFTLTISSLQPEDFATYYCKA (SEQ ID NO: 31), and FW4 is selected from: DGAGTVLTVN (SEQ ID NO: 32), or DGAGTKVEIK (SEQ ID NO: 33); or functional variants thereof with a sequence identity of at least 45%.
8. The bi-specific antigen binding molecule of claim 1, wherein the ROR1-specific antigen binding molecule comprises an amino acid sequence selected from: ASVNQTPRTATKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERMSIGGRYVESVNKRAKSFSLRIKDL- TVADSATYYCKAQSGMAISTGSGHGYNVVYDGAGTVLTVN (SEQ ID NO: 39); AKVDQTPRTATKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERMSIGGRYVESVNKRAKSFSLRIKDL- TVADSATYYCKAQSGMAIDIGSGHGYNWYDGAGTVLTVN (SEQ ID NO: 40); TRVDQTPRTATKETGESLTINCWTGAKYGLAATYWYRKNPGSSNQERISISGRYVESVNKRTMSFSLRIKDLT- VADSATYYCKAYPWAMWGQWYDGAGTVLTVN (SEQ ID NO: 41); TRVDQTPRTATKETGESLTINCWTGAKYGLFATYWYRKNPGSSNQERISISGRYVESVNKRTMSFSLRIKDLT- VADSATYYCKAVFMPQHWHPAAHWYDGAGTVLTVN (SEQ ID NO: 42); TRVDQTPRTATKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERMSIGGRYVESVNKGAKSFSLRIKDL- TVADSATYYCKAREARHPWLRQWYDGAGTVLTVN (SEQ ID NO: 43); ASVNQTPRTATKETGESLTINCWTGANYGLAATYWYRKNPGSSNQERISISGRYVESVNKRTMSFSLRIKDLT- VADSATYYCKAYPWGAGAPWLVQVVYDGAGTVLTVN (SEQ ID NO: 44); TRVDQSPSSLSASVGDRVTITCVLTGANYGLASTYVVYRKNPGSSNKEQISISGRYSESVNKGTKSFTLTISS- LQPEDSATYYCRAYPWGAGAPWLVQWYDGAGTKVEIK (SEQ ID NO: 45); TRVDQSPSSLSASVGDRVTITCVLTGANYGLASTYVVYRKNPGSSNQERISISGRYSESVNKRTMSFTLTISS- LQPEDSATYYCRAYPWGAGAPWLVQVVYDGAGTKVEIK (SEQ ID NO: 46); TRVDQSPSSLSASVGDRVTITCVLTDTSYGLYSTSWFRKNPGTTDWERMSIGGRYVESVNKGAKSFTLTISSL- QPEDFATYYCKAREARHPWLRQWYDGAGTKVEIK (SEQ ID NO: 47); TRVDQSPSSLSASVGDRVTITCVLTDTSYGLYSTYVVYRKNPGSSNKEQISISGRYSESVNKGTKSFTLTISS- LQPEDSATYYCRAREARHPWLRQWYDGAGTKVEIK (SEQ ID NO: 48); TRVDQSPSSLSASVGDRVTITCVLTDTSYGLYSTYVVYRKNPGTTDWERMSIGGRYSESVNKGAKSFTLTISS- LQPEDSATYYCRAREARHPWLRQWYDGAGTKVEIK (SEQ ID NO: 49); or a functional variant thereof with a sequence identity of at least 45%.
9. The bi-specific antigen binding molecule of claim 1, wherein the ROR1-specific antigen binding molecule is humanized.
10. The bi-specific antigen binding molecule of claim 1, wherein the ROR1-specific antigen binding molecule is de-immunized.
11. The bi-specific antigen binding molecule of claim 1, wherein the bi-specific antigen binding molecule is conjugated to a detectable label, dye, toxin, drug, pro-drug, radionuclide or biologically active molecule.
12. The bi-specific antigen binding molecule of claim 1, wherein the ROR1-specific antigen binding molecule selectively interacts with ROR1 protein with an affinity constant of approximately 0.01 to 50 nM, preferably 0.1 to 30 nM, even more preferably 0.1 to 10 nM.
13. The bi-specific antigen binding molecule of claim 1, wherein the bi-specific antigen binding molecule is capable of mediating killing of ROR1-expressing tumour cells.
14. The bi-specific antigen binding molecule of claim 1, wherein the bi-specific antigen binding molecule is capable of inhibiting cancer cell proliferation.
15. The bi-specific antigen binding molecule of claim 1, wherein the bi-specific antigen binding molecule is capable of being endocytosed upon binding to ROR1.
16. The bi-specific antigen binding molecule of claim 1, wherein the bi-specific antigen binding molecule is capable of down regulating ROR1 or EGFR upon binding.
17. The bi-specific antigen binding molecule of claim 1, wherein the bi-specific antigen binding molecule is capable of down regulating ROR1 or EGFR signalling.
18. A recombinant fusion protein comprising a bi-specific antigen binding molecule as claimed in claim 1.
19. A recombinant fusion protein as claimed in claim 18, in which the bi-specific antigen binding molecule is fused to one or more biologically active proteins.
20. A recombinant fusion protein as claimed in claim 19, wherein the specific antigen binding molecule is fused to one or more biologically active proteins via one or more linker domains.
21. The recombinant fusion protein as claimed in claim 19, wherein at least one biologically active protein is an immunoglobin, an immunoglobulin Fc region, an immunoglobin Fab region, a single chain Fv (scFv), a diabody, a triabody, a tetrabody, a bispecific t-cell engager (BiTE), an intein, a VNAR domain, a single domain antibody (sdAb), a VH domain, or a scaffold protein.
22. The recombinant fusion protein as claimed in claim 21, wherein at least one biologically active protein is an immunoglobulin Fc region.
23. A chimeric antigen receptor (CAR), comprising at least one bi-specific antigen binding molecule as defined in claim 1, fused or conjugated to at least one transmembrane region and at least one intracellular domain.
24. A cell comprising a chimeric antigen receptor according to claim 23, which cell is preferably an engineered T-cell.
25. A nucleic acid sequence comprising a polynucleotide sequence that encodes a bi-specific antigen binding molecule, recombinant fusion protein or chimeric antigen receptor according to claim 1.
26. A vector comprising a nucleic acid sequence as claimed in claim 25, optionally further comprising one or more regulatory sequences.
27. A host cell comprising a vector as claimed in claim 26.
28. A method for preparing a bi-specific antigen binding molecule, recombinant fusion protein or chimeric antigen receptor, comprising cultivating or maintaining a host cell comprising the polynucleotide of claim 25 under conditions such that said host cell produces the binding molecule, optionally further comprising isolating the binding molecule.
29. A pharmaceutical composition comprising the specific antigen binding molecule, recombinant fusion protein or chimeric antigen receptor of claim 1.
30. (canceled)
31. (canceled)
32. (canceled)
33. (canceled)
34. (canceled)
35. A method of treatment of a disease in a patient in need of treatment comprising administration to said patient of a therapeutically effective dosage of a bi-specific antigen binding molecule, recombinant fusion protein or chimeric antigen receptor of claim 1 or a pharmaceutical composition of claim 29.
36. The method of claim 35, wherein the disease is cancer.
37. The method of claim 36 wherein the cancer is a ROR1-positive cancer type.
38. The method of claim 36, wherein the cancer is selected from the group comprising blood cancers such as lymphomas and leukaemias, chronic lymphocytic leukaemia (CLL), mantle cell lymphoma (MCL), B-cell acute lymphoblastic leukaemia (B-ALL), marginal zone lymphoma (MZL), non-Hodgkin lymphomas (NHL), acute myeloid leukemia (AML) and solid tumours including neuroblastoma, renal cancer, lung cancer, colon cancer, ovarian cancer, pancreatic cancer, breast cancer, skin cancer, uterine cancer, prostate cancer, thyroid cancer, Head and Neck cancer, bladder cancer, stomach cancer or liver cancer.
39. A method of assaying for the presence of a target analyte in a sample, comprising the addition of a detectably labelled bi-specific antigen binding molecule of claim 1 to the sample and detecting the binding of the molecule to the target analyte.
40. A method of imaging a site of disease in a subject, comprising administration of a detectably labelled bi-specific antigen binding molecule as claimed in claim 1 to a subject.
41. A method of diagnosis of a disease or medical condition in a subject comprising administration of a bi-specific antigen binding molecule as claimed in claim 1.
42. An antibody, antibody fragment or antigen-binding molecule that competes for binding to ROR1 with the ROR1-specific antigen binding molecule of claims 1; or a ROR1 and EGFR bi-specific antibody, ROR1 and EGFR bi-specific antibody fragment or ROR1 and EGFR bi-specific antigen-binding molecule that competes for binding to ROR1 and/or EGFR with the bi-specific antigen binding molecule of claim 1.
43. A kit for diagnosing a subject suffering from cancer, or a pre-disposition thereto, or for providing a prognosis of the subject's condition, the kit comprising detection means for detecting the concentration of antigen present in a sample from a test subject, wherein the detection means comprises a bi-specific antigen binding molecule as defined in claim 1, being optionally derivatized, wherein presence of antigen in the sample suggests that the subject suffers from cancer.
44. The kit according to claim 43, wherein the antigen comprises ROR1 protein, more preferably an extracellular domain thereof.
45. The kit according to claim 43, wherein the kit is used to identify the presence or absence of ROR1-positive cells in the sample, or determine the concentration thereof in the sample.
46. The kit according to claim 43, wherein the kit comprises a positive control and/or a negative control against which the assay is compared.
47. The kit according to claim 43, wherein the kit further comprises a label which may be detected.
48. A method for diagnosing a subject suffering from cancer, or a pre-disposition thereto, or for providing a prognosis of the subject's condition, the method comprising detecting the concentration of antigen present in a sample obtained from a subject, wherein the detection is achieved using a bi-specific antigen binding molecule as defined in claim 1, being optionally derivatized, and wherein presence of antigen in the sample suggests that the subject suffers from cancer.
49. A method of killing or inhibiting the growth of a cell expressing ROR1 in vitro or in a patient, which method comprises administering to the cell a pharmaceutically effective amount or dose of bi-specific antigen binding molecule as defined in claim 1.
50. The method of claim 49, wherein the cell expressing ROR1 is a cancer cell.
51. The method according to either claim 49, wherein the ROR1 is human ROR1.
52. A method of killing or inhibiting the growth of a cell expressing EGFR in vitro or in a patient, which method comprises administering to the cell a pharmaceutically effective amount or dose of bi-specific antigen binding molecule as defined in claim 1.
53. The method of claim 52, wherein the cell expressing EGFR is a cancer cell.
54. A method of killing or inhibiting the growth of a cell expressing ROR1 and EGFR in vitro or in a patient, which method comprises administering to the cell a pharmaceutically effective amount or dose of bi-specific antigen binding molecule as defined in claim 1.
55. The method of claim 54, wherein the cell expressing ROR1 and EGFR is a cancer cell.
56. A bi-specific antigen binding molecule comprising an amino acid sequence represented by the formula (II): Xb-X-Xa-FW1-CDR1-FW2-HV2-FW3a-HV4-FW3b-CDR3-FW4-Ya-Y-Yb (II) wherein FW1 is a framework region CDR1 is a CDR sequence FW2 is a framework region HV2 is a hypervariable sequence FW3a is a framework region HV4 is a hypervariable sequence FW3b is a framework region CDR3 is a CDR sequence FW4 is a framework region wherein Xa, Xb, Ya and Yb are either absent or an EGFR-specific binding molecule, wherein at least one of Xa, Xb, Ya and Yb is an EGFR-specific binding molecule, X and Y are optional amino acid sequences, wherein the bi-specific antigen binding molecule is conjugated to a second moiety.
57. The bi-specific antigen binding molecule of claim 56, wherein X or Y are individually either absent or selected from the group comprising an immunoglobulin, an immunoglobulin Fc region, an immunoglobulin Fab region, a single chain Fv (scFv), a diabody, a triabody, a tetrabody, a bispecific t-cell engager (BiTE), an intein, a VNAR domain, a single domain antibody (sdAb), a VH domain, or a scaffold protein.
58. The bi-specific antigen binding molecule of claim 56, wherein the conjugation is via a cysteine residue in the amino acid sequence of the specific antigen binding molecule.
59. The bi-specific antigen binding molecule of claim 56, wherein the conjugation is via a thiol, aminoxy or hydrazinyl moiety incorporated at the N-terminus or C-terminus of the amino acid sequence of the specific antigen binding molecule.
60. The bi-specific antigen binding molecule of claim 56, wherein the second moiety is selected from the group comprising an immunoglobulin, an immunoglobulin Fc region, an immunoglobulin Fab region, a single chain Fv (scFv), a diabody, a triabody, a tetrabody, a bispecific t-cell engager (BiTE), an intein, a VNAR domain, a single domain antibody (sdAb), a VH domain, or a scaffold protein.
61. The bi-specific antigen binding molecule of claim 56, wherein the second moiety is selected from the group comprising detectable label, dye, toxin, drug, pro-drug, radionuclide or biologically active molecule.
62. The bi-specific antigen binding molecule according to claim 56, wherein the second moiety is at least one toxin selected from the group comprising: maytansinoids, auristatins, anthracyclins, preferably PNU-derived anthracyclins amanitin derivatives, preferably .quadrature.-amanitin derivatives calicheamicins, tubulysins duocarmycins radioisotopes--such as an alpha-emitting radionuclide, such as 227 Th and 225 Ac label liposomes comprising a toxic payload, protein toxins taxanes pyrrolbenzodiazepines and/or indolinobenzodiazepine pseudodimers and/or spliceosome inhibitors CDK11 inhibitors Pyridinobenzodiazepines
63. The bi-specific antigen binding molecule according to claim 56, wherein the specific antigen binding molecule is a receptor tyrosine kinase-like orphan receptor 1 (ROR1) specific antigen binding molecule.
64. The bi-specific antigen binding molecule according to claim 63, wherein the ROR1-specific antigen binding molecule does not bind to receptor tyrosine kinase-like orphan receptor 2 (ROR2).
65. The bi-specific antigen binding molecule according to claim 63, wherein the ROR1-specific antigen binding molecule binds to both human ROR1 and murine ROR1 (mROR1).
66. The bi-specific antigen binding molecule according to claim 63, wherein the ROR1-specific antigen binding molecule binds to deglycosylated ROR1.
67. The bi-specific antigen binding molecule according to claim 63, wherein the ROR1-specific antigen binding molecule does not bind to a linear peptide sequence selected from: TABLE-US-00039 (SEQ ID NO: 34) YMESLHMQGEIENQI (SEQ ID NO: 35) CQPWNSQYPHTHTFTALRFP (SEQ ID NO: 36) RSTIYGSRLRIRNLDTTDTGYFQ (SEQ ID NO: 37) QCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYE
68. The bi-specific antigen binding molecule according to claim 63, wherein: FW1 is a framework region of from 20 to 28 amino acids CDR1 is a CDR sequence selected from DTSYGLYS (SEQ ID NO: 1), GAKYGLAA (SEQ ID NO: 2), GAKYGLFA (SEQ ID NO: 3), GANYGLAA (SEQ ID NO: 4), or GANYGLAS (SEQ ID NO: 5) FW2 is a framework region of from 6 to 14 amino acids HV2 is a hypervariable sequence selected from TTDWERMSIG (SEQ ID NO: 6), SSNQERISIS (SEQ ID NO: 7), or SSNKEQISIS (SEQ ID NO: 8) FW3a is a framework region of from 6 to 10 amino acids HV4 is a hypervariable sequence selected from NKRAK (SEQ ID NO: 9), NKRTM (SEQ ID NO: 10), NKGAK (SEQ ID NO: 11), or NKGTK (SEQ ID NO: 12) FW3b is a framework region of from 17 to 24 amino acids CDR3 is a CDR sequence selected from QSGMAISTGSGHGYNWY (SEQ ID NO: 13), QSGMAIDIGSGHGYNWY (SEQ ID NO: 14), YPWAMWGQWY (SEQ ID NO: 15), VFMPQHWHPAAHWY (SEQ ID NO: 16), REARHPWLRQWY (SEQ ID NO: 17), or YPWGAGAPWLVQWY (SEQ ID NO: 18) FW4 is a framework region of from 7 to 14 amino acids or a functional variant thereof with at least 45% sequence identity thereto,
69. The bi-specific antigen binding molecule according to claim 63, wherein FW1 is selected from ASVNQTPRTATKETGESLTINCVLT (SEQ ID NO: 19), AKVDQTPRTATKETGESLTINCVLT (SEQ ID NO: 20), TRVDQTPRTATKETGESLTINCWT (SEQ ID NO: 21), TRVDQTPRTATKETGESLTINCVLT (SEQ ID NO: 22), ASVNQTPRTATKETGESLTINCWT (SEQ ID NO: 23), or TRVDQSPSSLSASVGDRVTITCVLT (SEQ ID NO: 24), FW2 is selected from TSWFRKNPG (SEQ ID NO: 25), or TYWYRKNPG (SEQ ID NO: 26), FW3a is selected from GRYVESV (SEQ ID NO: 27), or GRYSESV (SEQ ID NO: 28), FW3b is selected from SFSLRIKDLTVADSATYYCKA (SEQ ID NO: 29), SFTLTISSLQPEDSATYYCRA (SEQ ID NO: 30), or SFTLTISSLQPEDFATYYCKA (SEQ ID NO: 31), and FW4 is selected from DGAGTVLTVN (SEQ ID NO: 32), or DGAGTKVEIK (SEQ ID NO: 33), or functional variants thereof with a sequence identity of at least 45%.
70. The bi-specific antigen binding molecule according to claim 63, wherein the ROR1-specific antigen binding molecule comprises an amino acid sequence selected from ASVNQTPRTATKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERMSIGGRYVESVNKRAKSFSLRIKDL- TVADSATYYCKAQSGMAISTGSGHGYNVVYDGAGTVLTVN (SEQ ID NO: 39); AKVDQTPRTATKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERMSIGGRYVESVNKRAKSFSLRIKDL- TVADSATYYCKAQSGMAIDIGSGHGYNWYDGAGTVLTVN (SEQ ID NO: 40); TRVDQTPRTATKETGESLTINCWTGAKYGLAATYWYRKNPGSSNQERISISGRYVESVNKRTMSFSLRIKDLT- VADSATYYCKAYPWAMWGQWYDGAGTVLTVN (SEQ ID NO: 41); TRVDQTPRTATKETGESLTINCWTGAKYGLFATYWYRKNPGSSNQERISISGRYVESVNKRTMSFSLRIKDLT- VADSATYYCKAVFMPQHWHPAAHWYDGAGTVLTVN (SEQ ID NO: 42); TRVDQTPRTATKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERMSIGGRYVESVNKGAKSFSLRIKDL- TVADSATYYCKAREARHPWLRQWYDGAGTVLTVN (SEQ ID NO: 43); ASVNQTPRTATKETGESLTINCWTGANYGLAATYWYRKNPGSSNQERISISGRYVESVNKRTMSFSLRIKDLT- VADSATYYCKAYPWGAGAPWLVQVVYDGAGTVLTVN (SEQ ID NO: 44); TRVDQSPSSLSASVGDRVTITCVLTGANYGLASTYVVYRKNPGSSNKEQISISGRYSESVNKGTKSFTLTISS- LQPEDSATYYCRAYPWGAGAPWLVQWYDGAGTKVEIK (SEQ ID NO: 45); TRVDQSPSSLSASVGDRVTITCVLTGANYGLASTYVVYRKNPGSSNQERISISGRYSESVNKRTMSFTLTISS- LQPEDSATYYCRAYPWGAGAPWLVQVVYDGAGTKVEIK (SEQ ID NO: 46); TRVDQSPSSLSASVGDRVTITCVLTDTSYGLYSTSWFRKNPGTTDWERMSIGGRYVESVNKGAKSFTLTISSL- QPEDFATYYCKAREARHPWLRQWYDGAGTKVEIK (SEQ ID NO: 47); TRVDQSPSSLSASVGDRVTITCVLTDTSYGLYSTYVVYRKNPGSSNKEQISISGRYSESVNKGTKSFTLTISS- LQPEDSATYYCRAREARHPWLRQWYDGAGTKVEIK (SEQ ID NO: 48); TRVDQSPSSLSASVGDRVTITCVLTDTSYGLYSTYWYRKNPGTTDWERMSIGGRYSESVNKGAKSFTLTISSL- QPEDSATYYCRAREARHPWLRQWYDGAGTKVEIK (SEQ ID NO: 49); or a functional variant thereof with a sequence identity of at least 45%.
71. The bi-specific antigen binding molecule according to claim 63, wherein the ROR1-specific antigen binding molecule is humanized.
72. The bi-specific antigen binding molecule according to claim 63, wherein the ROR1-specific antigen binding molecule is de-immunized.
73. The bi-specific antigen binding molecule according to claim 56, wherein the EGFR-specific antigen binding molecule is selected from the group comprising an immunoglobulin, an immunoglobulin Fab region, a single chain Fv (scFv), a diabody, a triabody, a tetrabody, a bispecific t-cell engager (BiTE), an intein, a VNAR domain, a single domain antibody (sdAb), a VH domain, or a scaffold protein.
Description:
FIELD OF INVENTION
[0001] The present invention relates to bi-specific antigen binding molecules and associated fusion proteins and conjugates. In particular, the present invention relates to bi-specific antigen binding molecules with specificity for both receptor tyrosine kinase-like orphan receptor 1 (ROR1) and epidermal growth factor receptor (EGFR) and associated fusion proteins and conjugates. In a further aspect, the present invention relates to conjugated immunoglobulin-like shark variable novel antigen receptors (VNARs).
BACKGROUND
[0002] Receptor tyrosine kinase-like orphan receptor 1 (ROR1) is a 937 amino acid glycosylated type I single pass transmembrane protein. The extracellular region consists of three distinct domains composing an N-terminal immunoglobulin domain (Ig), followed by a cysteine rich fizzled domain (fz) which in turn is linked to the membrane proximal kringle domain (kr). The intracellular region of the protein contains a pseudo kinase domain followed by two Ser/Thr rich domains which are interspersed by a proline-rich region, and this same overall domain architecture is conserved in the closely related family member ROR2, with which it shares high sequence identity. (Rebagay G et al, Frontiers Oncology, 2012, 2, Borcherding N et al Protein Cell, 2014, 5, 496-502).
[0003] ROR1 is expressed during embryonic development, where it is prominently expressed in neural crest cells and in the necrotic and interdigital zones in the later stages of development. However, its expression is quickly silenced after birth, and is largely absent in normal adult tissue (Fukada PNAS, 2012, Baskar et al Clin. Cancer Res., 2008, 14, 396, Broome H E et al, Leuk. Res., 2011, 35, 1390; Balakrishnan A et al, Clin. Cancer. Res. 2017, 23, 3061-3071).
[0004] ROR1 expression has been observed at both the mRNA and protein level across a broad range of solid tumours and haematological malignancies including lung, breast, pancreatic, ovarian, colon, head and neck and prostate cancers, melanoma and renal cell carcinoma (Zhang S et al Am J. Pathol., 2012, 181, 1903-1910), breast cancer (Zhang S et al PLoS One 2012, 7, e31127; Oxford Biotherapeutics patent application WO2011054007) and Chronic lymphocytic leukemia (CLL) and acute lymphoblastic leukemia AML (Fukuda T et al, Proc Natl Acad Sci USA. 2008, 105, 3047-3052; Baskar S et al, Clin Cancer Res., 2008, 14, 396-404; Daneshmanesh A H et al, Int J Cancer. 2008, 123, 1190-1195; Dave H et al, PLOS ONE, 2012, 7, e52655).
[0005] Additionally, increased ROR1 expression is reported to correlate with poor clinical outcomes for a number of cancer indications including breast cancer (Chien H P et al, Virchows Arch., 2016, 468, 589-595; Zhang), ovarian cancer (Zhang H et al, Sci Rep., 2014, 4:5811. doi: 10.1038/srep05811), colorectal cancer (Zhou J K et al, Oncotarget, 2017, 8, 32864-32872), lung adenocarcinoma (Zheng Y Z et al, Sci Rep., 2016, 6, 36447) and CLL (Cui B et al, Blood, 2016, 128, 2931-2940).
[0006] Consistent with ROR1's expression pattern and the link to poor clinical prognosis, a functional role for ROR1 in tumourigenesis and disease progression has been demonstrated for a number of different cancer indications. ROR1 promotes epithelial-mesenchymal transition and metastasis in models of breast cancer (Cui B et al Cancer Res, 2013, 73, 3649-3660) and spheroid formation and tumour engraftment in models of ovarian cancer (Zhang S et al, Proc Natl Acad Sci., 2014, 11, 17266-17271). ROR1 is a transcript target of the NKX2-1/TTF-1 lineage survival factor oncogene in lung adenocarcinoma, where it sustains EGFR signalling and represses pro-apoptotic signalling and an EGF induced interaction between ROR1 and EGFR has been observed (Yamaguchi T et al, Cancer Cell, 2012, 21, 348-361; Ida L et al, Cancer Science, 2016, 107, 155-161). Whilst co-expression of EGFR and ROR1 mRNA has been noted from mining breast cancer gene expression database (Peng H et al, J. Mol. Biol, 2017, 429, 2954-2973). ROR1 has also been shown to act as a scaffold to sustain caveolae structures and by-pass signalling mechanism that confer resistance to EGFR tyrosine kinase inhibitors (Yamaguchi T et al, Nat Commun., 2016, 7, 10060). Signalling through an ROR1-HER3 complex modulates the Hippo-YAP pathway and promotes breast cancer bone metastasis (Li C et al, Nature Cell Biol., 19, 1206-119) and the protein can promote Met-driven tumourigenesis (Gentile A et al, Cancer Res., 2011, 71, 3132-3140). Whilst in CLL, ROR1 has been reported to hetero-oligomerise with ROR2 in response to Wnt5a to transduce signalling and enhance proliferation and migration (Yu J et al, J. Clin. Invest., 2016, 2, 585-598)
[0007] Given the functional role of ROR1 in cancer pathology and the general lack of expression on normal adult tissue, this oncofetal protein is an attractive target for cancer therapy. Antibodies to ROR1 have been described in the literature WO2021097313 (4A5 kipps), WO2014031174 (UC961), WO2016187220 (Five Prime) WO2010124188 (2A2), WO2012075158 (R11, R12), WO2011054007 (Oxford Bio), WO2011079902 (Bioinvent) WO2017127664, WO2017127664 (NBE Therapeutics, SCRIPPS), WO2016094847 (Emergent), WO2017127499), and a humanised murine anti-ROR1 antibody, UC961, has entered clinical trials for relapsed or refractory chronic lymphocytic leukemia. Chimeric antigen receptor T-cells targeting ROR1 have also been reported (Hudecek M et al, Clin. Cancer Res., 2013, 19, 3153-64) and preclinical primate studies with UC961 and with CAR-T cells targeting ROR1 showed no overt toxicity, which is consistent with the general lack of expression of the protein on adult tissue (Choi M et al, Clinical Lymphoma, myeloma & leukemia, 2015, S167; Berger C et al, Cancer Immunol. Res., 2015, 3, 206).
[0008] The epidermal growth factor receptor (EGFR) is a member of the ErbB family of receptor tyrosine kinases. It is a 170 kDa transmembrane protein composed of four extracellular domains, a transmembrane region, an intracellular tyrosine kinase domain and a carboxy-terminal tail. The normal function of EGFR relates to regulation of epithelial tissue development, but it is also associated with a number of pathological states. In particular, overexpression of EGFR has been associated with a number of cancers. Accordingly, it is an important drug target and many therapeutic approaches have been applied. In addition to a number of small molecule-based EGFR inhibitors, such as gefitinib, erlotinib, afatinib, brigatinib, icotinib, and osimertinib a number of antibodies to EGFR have been developed. Anti-EGFR antibodies cetuximab, panitumumab, zalutumumab, nimotuzumab, and matuzumab. These antibodies block the extracellular ligand binding domain, preventing ligand binding and subsequent activation of the tyrosine kinase domain. Single domain antibodies (sdAb) that show competitive binding with cetuximab or matuzumab have also been developed.
[0009] Single domain binding molecules can be derived from an array of proteins from distinct species. The immunoglobulin isotope novel antigen receptor (IgNAR) is a homodimeric heavy-chain complex originally found in the serum of the nurse shark (Ginglymostoma cirratum) and other sharks and ray species. IgNARs do not contain light chains and are distinct from the typical immunoglobulin structure. Each molecule consists of a single-variable domain (VNAR) and five constant domains (CNAR). The nomenclature in the literature refers to IgNARs as immunoglobulin isotope novel antigen receptors or immunoglobulin isotope new antigen receptors and the terms are synonymous.
[0010] There are three main defined types of shark IgNAR known as I, II and III (Kovalena et al, Exp Opin Biol Ther 2014 14(10) 1527-1539). These have been categorized based on the position of non-canonical cysteine residues which are under strong selective pressure and are therefore rarely replaced.
[0011] All three types have the classical immunoglobulin canonical cysteines at positions 35 and 107 that stabilize the standard immunoglobulin fold, together with an invariant tryptophan at position 36. There is no defined CDR2 as such, but regions of sequence variation that compare more closely to TCR HV2 and HV4 have been defined in framework 2 and 3 respectively. Type I has germline encoded cysteine residues in framework 2 and framework 4 and an even number of additional cysteines within CDR3. Crystal structure studies of a Type I IgNAR isolated against and in complex with lysozyme enabled the contribution of these cysteine residues to be determined. Both the framework 2 and 4 cysteines form disulphide bridges with those in CDR3 forming a tightly packed structure within which the CDR3 loop is held tightly down towards the HV2 region. To date Type I IgNARs have only been identified in nurse sharks--all other elasmobranchs, including members of the same order have only Type II or variations of this type.
[0012] Type II IgNAR are defined as having a cysteine residue in CDR1 and CDR3 which form intramolecular disulphide bonds that hold these two regions in close proximity, resulting in a protruding CDR3 that is conducive to binding pockets or grooves. Type I sequences typically have longer CDR3s than type II with an average of 21 and 15 residues respectively. This is believed to be due to a strong selective pressure for two or more cysteine residues in Type I CDR3 to associate with their framework 2 and 4 counterparts. Studies into the accumulation of somatic mutations show that there are a greater number of mutations in CDR1 of type II than type I, whereas HV2 regions of Type I show greater sequence variation than Type II. This evidence correlates well with the determined positioning of these regions within the antigen binding sites. A third IgNAR type known as Type III has been identified in neonates. This member of the IgNAR family lacks diversity within CDR3 due to the germline fusion of the D1 and D2 regions (which form CDR3) with the V-gene. Almost all known clones have a CDR3 length of 15 residues with little or no sequence diversity.
[0013] Another structural type of VNAR, termed type (IIb or IV), has only two canonical cysteine residues (in framework 1 and framework 3b regions). So far, this type has been found primarily in dogfish sharks (Liu, J. L., et al. Mol. Immunol. 2007. 44(7): p. 1775-1783; Kovalenko O. V., et al. J Biol Chem. 2013. 288(24): p. 17408-19) and was also isolated from semisynthetic V-NAR libraries derived from wobbegong sharks (Streltsov, V. A. et al. (2004) Proc. Natl. Acad. Sci. U.S.A. 101(34): p. 12444-12449).
SUMMARY OF INVENTION
[0014] The present invention generally relates to bi-specific antigen binding molecules. Specifically, the present invention relates to bi-specific molecules having the ability to bind to both ROR1 and EGFR.
[0015] In a first aspect, there is provided a bi-specific antigen binding molecule comprising:
[0016] (i) a receptor tyrosine kinase-like orphan receptor 1 (ROR1) specific antigen binding molecule comprising an amino acid sequence represented by the formula (I):
FW1-CDR1-FW2-HV2-FW3a-HV4-FW3b-CDR3-FW4 (I)
[0017] wherein
[0018] FW1 is a framework region
[0019] CDR1 is a CDR sequence
[0020] FW2 is a framework region
[0021] HV2 is a hypervariable sequence
[0022] FW3a is a framework region
[0023] HV4 is a hypervariable sequence
[0024] FW3b is a framework region
[0025] CDR3 is a CDR sequence
[0026] FW4 is a framework region
[0027] ; and
[0028] (ii) an epidermal growth factor receptor (EGFR) specific antigen binding molecule.
[0029] Framework region FW1 is preferably from 20 to 28 amino acids in length, more preferably from 22 to 26 amino acids in length, still more preferably from 23 to 25 amino acids in length. In certain preferred embodiments, FW1 is 26 amino acids in length. In other preferred embodiments, FW1 is 25 amino acids in length. In still other preferred embodiments, FW1 is 24 amino acids in length.
[0030] CDR region CDR1 is preferably from 7 to 11 amino acids in length, more preferably from 8 to 10 amino acids in length. In certain preferred embodiments, CDR1 is 9 amino acids in length. In other preferred embodiments, CDR1 is 8 amino acids in length.
[0031] Framework region FW2 is preferably from 6 to 14 amino acids in length, more preferably from 8 to 12 amino acids in length. In certain preferred embodiments, FW2 is 12 amino acids in length. In other preferred embodiments, FW2 is 10 amino acids in length. In other preferred embodiments, FW2 is 9 amino acids in length. In other preferred embodiments, FW2 is 8 amino acids in length.
[0032] Hypervariable sequence HV2 is preferably from 4 to 11 amino acids in length, more preferably from 5 to 10 amino acids in length. In certain preferred embodiments, HV2 is 10 amino acids in length. In certain preferred embodiments, HV2 is 9 amino acids in length. In other preferred embodiments, HV2 is 6 amino acids in length.
[0033] Framework region FW3a is preferably from 6 to 10 amino acids in length, more preferably from 7 to 9 amino acids in length. In certain preferred embodiments, FW3a is 8 amino acids in length. In certain preferred embodiments, FW3a is 7 amino acids in length.
[0034] Hypervariable sequence HV4 is preferably from 3 to 7 amino acids in length, more preferably from 4 to 6 amino acids in length. In certain preferred embodiments, HV4 is 5 amino acids in length. In other preferred embodiments, HV4 is 4 amino acids in length.
[0035] Framework region FW3b is preferably from 17 to 24 amino acids in length, more preferably from 18 to 23 amino acids in length, still more preferably from 19 to 22 amino acids in length. In certain preferred embodiments, FW3b is 21 amino acids in length. In other preferred embodiments, FW3b is 20 amino acids in length.
[0036] CDR region CDR3 is preferably from 8 to 21 amino acids in length, more preferably from 9 to 20 amino acids in length, still more preferably from 10 to 19 amino acids in length. In certain preferred embodiments, CDR3 is 17 amino acids in length. In other preferred embodiments, CDR3 is 14 amino acids in length. In still other preferred embodiments, CDR3 is 12 amino acids in length. In yet other preferred embodiments, CDR3 is 10 amino acids in length.
[0037] Framework region FW4 is preferably from 7 to 14 amino acids in length, more preferably from 8 to 13 amino acids in length, still more preferably from 9 to 12 amino acids in length. In certain preferred embodiments, FW4 is 12 amino acids in length. In other preferred embodiments, FW4 is 11 amino acids in length. In still other preferred embodiments, FW4 is 10 amino acids in length. In yet other preferred embodiments, FW4 is 9 amino acids in length.
[0038] Preferably, the ROR1-specific antigen binding molecule does not bind to receptor tyrosine kinase-like orphan receptor 2 (ROR2). More preferably, the ROR1-specific antigen binding molecule binds to both human ROR1 and murine ROR1 (mROR1). Yet more preferably, the ROR1-specific antigen binding molecule binds to deglycosylated ROR1.
[0039] Certain ROR1-specific antigen binding molecules of the invention do not bind to a linear peptide sequence selected from:
TABLE-US-00001 (SEQ ID NO: 34) YMESLHMQGEIENQI (SEQ ID NO: 35) CQPWNSQYPHTHTFTALRFP (SEQ ID NO: 36) RSTIYGSRLRIRNLDTTDTGYFQ (SEQ ID NO: 37) QCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYE
[0040] In preferred embodiments of the ROR1-specific antigen binding molecule:
[0041] FW1 is a framework region of from 20 to 28 amino acids
[0042] CDR1 is a CDR sequence selected from DTSYGLYS (SEQ ID NO: 1), GAKYGLAA (SEQ ID NO: 2), GAKYGLFA (SEQ ID NO: 3), GANYGLAA (SEQ ID NO: 4), or GANYGLAS (SEQ ID NO: 5)
[0043] FW2 is a framework region of from 6 to 14 amino acids
[0044] HV2 is a hypervariable sequence selected TTDWERMSIG (SEQ ID NO: 6), SSNQERISIS (SEQ ID NO: 7), or SSNKEQISIS (SEQ ID NO: 8)
[0045] FW3a is a framework region of from 6 to 10 amino acids
[0046] HV4 is a hypervariable sequence selected from NKRAK (SEQ ID NO: 9), NKRTM (SEQ ID NO: 10), NKGAK (SEQ ID NO: 11), or NKGTK (SEQ ID NO: 12)
[0047] FW3b is a framework region of from 17 to 24 amino acids
[0048] CDR3 is a CDR sequence selected from QSGMAISTGSGHGYNWY (SEQ ID NO: 13), QSGMAIDIGSGHGYNWY (SEQ ID NO: 14), YPWAMWGQWY (SEQ ID NO: 15), VFMPQHWHPAAHWY (SEQ ID NO: 16), REARHPWLRQWY (SEQ ID NO: 17), or YPWGAGAPWLVQWY (SEQ ID NO: 18)
[0049] FW4 is a framework region of from 7 to 14 amino acids
[0050] or a functional variant with at least 45% sequence identity thereto.
[0051] In other preferred embodiments of the ROR1-specific antigen binding molecule, FW1 is selected from: ASVNQTPRTATKETGESLTINCVLT (SEQ ID NO: 19), AKVDQTPRTATKETGESLTINCVLT (SEQ ID NO: 20), TRVDQTPRTATKETGESLTINCWT (SEQ ID NO: 21), TRVDQTPRTATKETGESLTINCVLT (SEQ ID NO: 22), ASVNQTPRTATKETGESLTINCWT (SEQ ID NO: 23), or TRVDQSPSSLSASVGDRVTITCVLT (SEQ ID NO: 24), FW2 is selected from: TSWFRKNPG (SEQ ID NO: 25), or TYWYRKNPG (SEQ ID NO: 26), FW3a is selected from: GRYVESV (SEQ ID NO: 27), or GRYSESV (SEQ ID NO: 28), FW3b is selected from: SFSLRIKDLTVADSATYYCKA (SEQ ID NO: 29), SFTLTISSLQPEDSATYYCRA (SEQ ID NO: 30), or SFTLTISSLQPEDFATYYCKA (SEQ ID NO: 31), and FW4 is selected from DGAGTVLTVN (SEQ ID NO: 32), or DGAGTKVEIK (SEQ ID NO: 33), or functional variants thereof with a sequence identity of at least 45%.
[0052] All possible combinations and permutations of the framework regions, complementarity determining regions and hypervariable regions listed above are explicitly contemplated herein.
[0053] Sequence identity referenced in relation to the molecules of the invention may be judged at the level of individual CDRs, HVs or FWs, or it may be judged over the length of the entire molecule. The CDR, HV and FW sequences described may also be longer or shorter, whether that be by addition or deletion of amino acids at the N- or C-terminal ends of the sequence or by insertion or deletion of amino acids with a sequence.
[0054] In a preferred embodiment of the ROR1-specific antigen binding molecule, FW1 is ASVNQTPRTATKETGESLTINCVLT (SEQ ID NO: 19); CDR1 is DTSYGLYS (SEQ ID NO: 1); FW2 is TSWFRKNPG (SEQ ID NO: 25); HV2 is TTDWERMSIG (SEQ ID NO: 6); FW3a is GRYVESV (SEQ ID NO: 27); HV4 is NKRAK (SEQ ID NO: 9); FW3b is SFSLRIKDLTVADSATYYCKA (SEQ ID NO: 29); CDR3 is QSGMAISTGSGHGYNWY (SEQ ID NO: 13); and FW4 is DGAGTVLTVN (SEQ ID NO: 32); or functional variants thereof with a sequence identity of at least 45%.
[0055] In another preferred embodiment of the ROR1-specific antigen binding molecule, FW1 is AKVDQTPRTATKETGESLTINCVLT (SEQ ID NO: 20); CDR1 is DTSYGLYS (SEQ ID NO: 1); FW2 is TSWFRKNPG (SEQ ID NO: 25); HV2 is TTDWERMSIG (SEQ ID NO: 6); FW3a is GRYVESV (SEQ ID NO: 27); HV4 is NKRAK (SEQ ID NO: 9); FW3b is SFSLRIKDLTVADSATYYCKA (SEQ ID NO: 29); CDR3 is QSGMAIDIGSGHGYNWY (SEQ ID NO: 14); and FW4 is DGAGTVLTVN (SEQ ID NO: 32); or functional variants thereof with a sequence identity of at least 45%.
[0056] In another preferred embodiment of the ROR1-specific antigen binding molecule, FW1 is TRVDQTPRTATKETGESLTINCWT (SEQ ID NO: 21); CDR1 is GAKYGLAA (SEQ ID NO: 2); FW2 is TYWYRKNPG (SEQ ID NO: 26); HV2 is SSNQERISIS (SEQ ID NO: 7); FW3a is GRYVESV (SEQ ID NO: 27); HV4 is NKRTM (SEQ ID NO: 10); FW3b is SFSLRIKDLTVADSATYYCKA (SEQ ID NO: 29); CDR3 is YPWAMWGQWY (SEQ ID NO: 15); and FW4 is DGAGTVLTVN (SEQ ID NO: 32); or functional variants thereof with a sequence identity of at least 45%.
[0057] In another preferred embodiment of the ROR1-specific antigen binding molecule, FW1 is TRVDQTPRTATKETGESLTINCWT (SEQ ID NO: 21); CDR1 is GAKYGLFA (SEQ ID NO: 3); FW2 is TYWYRKNPG (SEQ ID NO: 26); HV2 is SSNQERISIS (SEQ ID NO: 7); FW3a is GRYVESV (SEQ ID NO: 27); HV4 is NKRTM (SEQ ID NO: 10); FW3b is SFSLRIKDLTVADSATYYCKA (SEQ ID NO: 29); CDR3 is VFMPQHWHPAAHWY (SEQ ID NO: 16); and FW4 is DGAGTVLTVN (SEQ ID NO: 32); or functional variants thereof with a sequence identity of at least 45%.
[0058] In another preferred embodiment of the ROR1-specific antigen binding molecule, FW1 is TRVDQTPRTATKETGESLTINCVLT (SEQ ID NO: 22); CDR1 is DTSYGLYS (SEQ ID NO: 1); FW2 is TSWFRKNPG (SEQ ID NO: 25); HV2 is TTDWERMSIG (SEQ ID NO: 6); FW3a is GRYVESV (SEQ ID NO: 27); HV4 is NKGAK (SEQ ID NO: 11); FW3b is SFSLRIKDLTVADSATYYCKA (SEQ ID NO: 29); CDR3 is REARHPWLRQWY (SEQ ID NO: 17); and FW4 is DGAGTVLTVN (SEQ ID NO: 32); or functional variants thereof with a sequence identity of at least 45%.
[0059] In another preferred embodiment of the ROR1-specific antigen binding molecule, FW1 is ASVNQTPRTATKETGESLTINCVVT (SEQ ID NO: 23); CDR1 is GANYGLAA (SEQ ID NO: 4); FW2 is TYWYRKNPG (SEQ ID NO: 26); HV2 is SSNQERISIS (SEQ ID NO: 7); FW3a is GRYVESV (SEQ ID NO: 27); HV4 is NKRTM (SEQ ID NO: 10); FW3b is SFSLRIKDLTVADSATYYCKA (SEQ ID NO: 29); CDR3 is YPWGAGAPWLVQWY (SEQ ID NO: 18); and FW4 is DGAGTVLTVN (SEQ ID NO: 32); or functional variants thereof with a sequence identity of at least 45%.
[0060] In another preferred embodiment of the ROR1-specific antigen binding molecule, FW1 is TRVDQSPSSLSASVGDRVTITCVLT (SEQ ID NO: 24); CDR1 is GANYGLAS (SEQ ID NO: 5); FW2 is TYWYRKNPG (SEQ ID NO: 26); HV2 is SSNKEQISIS (SEQ ID NO: 8); FW3a is GRYSESV (SEQ ID NO: 28); HV4 is NKGTK (SEQ ID NO: 12); FW3b is SFTLTISSLQPEDSATYYCRA (SEQ ID NO: 30); CDR3 is YPWGAGAPWLVQWY (SEQ ID NO: 18); and FW4 is DGAGTKVEIK (SEQ ID NO: 33); or functional variants thereof with a sequence identity of at least 45%.
[0061] In another preferred embodiment of the ROR1-specific antigen binding molecule, FW1 is TRVDQSPSSLSASVGDRVTITCVLT (SEQ ID NO: 24); CDR1 is GANYGLAS (SEQ ID NO: 5); FW2 is TYWYRKNPG (SEQ ID NO: 26); HV2 is SSNQERISIS (SEQ ID NO: 7); FW3a is GRYSESV (SEQ ID NO: 28); HV4 is NKRTM (SEQ ID NO: 10); FW3b is SFTLTISSLQPEDSATYYCRA (SEQ ID NO: 30); CDR3 is YPWGAGAPWLVQWY (SEQ ID NO: 18); and FW4 is DGAGTKVEIK (SEQ ID NO: 33); or functional variants thereof with a sequence identity of at least 45%.
[0062] In another preferred embodiment of the ROR1-specific antigen binding molecule, FW1 is TRVDQSPSSLSASVGDRVTITCVLT (SEQ ID NO: 24); CDR1 is DTSYGLYS (SEQ ID NO: 1); FW2 is TSWFRKNPG (SEQ ID NO: 25); HV2 is TTDWERMSIG (SEQ ID NO: 6); FW3a is GRYVESV (SEQ ID NO: 27); HV4 is NKGAK (SEQ ID NO: 11); FW3b is SFTLTISSLQPEDFATYYCKA (SEQ ID NO: 31); CDR3 is REARHPWLRQWY (SEQ ID NO: 17); and FW4 is DGAGTKVEIK (SEQ ID NO: 33); or functional variants thereof with a sequence identity of at least 45%.
[0063] In another preferred embodiment of the ROR1-specific antigen binding molecule, FW1 is TRVDQSPSSLSASVGDRVTITCVLT (SEQ ID NO: 24); CDR1 is DTSYGLYS (SEQ ID NO: 1); FW2 is TYWYRKNPG (SEQ ID NO: 26); HV2 is SSNKEQISIS (SEQ ID NO: 8); FW3a is GRYSESV (SEQ ID NO: 28); HV4 is NKGTK (SEQ ID NO: 12); FW3b is SFTLTISSLQPEDSATYYCRA (SEQ ID NO: 30); CDR3 is REARHPWLRQWY (SEQ ID NO: 17); and FW4 is DGAGTKVEIK (SEQ ID NO: 33); or functional variants thereof with a sequence identity of at least 45%.
[0064] In another preferred embodiment of the ROR1-specific antigen binding molecule, FW1 is TRVDQSPSSLSASVGDRVTITCVLT (SEQ ID NO: 24); CDR1 is DTSYGLYS (SEQ ID NO: 1); FW2 is TYWYRKNPG (SEQ ID NO: 26); HV2 is TTDWERMSIG (SEQ ID NO: 6); FW3a is GRYSESV (SEQ ID NO: 28); HV4 is NKGAK (SEQ ID NO: 11); FW3b is SFTLTISSLQPEDSATYYCRA (SEQ ID NO: 30); CDR3 is REARHPWLRQWY (SEQ ID NO: 17); and FW4 is DGAGTKVEIK (SEQ ID NO: 33); or functional variants thereof with a sequence identity of at least 45%.
[0065] In yet further preferred embodiments, the ROR1-specific antigen binding molecule comprises an amino acid sequence selected from: ASVNQTPRTATKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERMSIGGRYVESVNKRAKSFSLRIKDL- TVADSATYYCKAQSGMAISTGSGHGYNWYDGAGTVLTVN (SEQ ID NO: 39); AKVDQTPRTATKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERMSIGGRYVESVNKRAKSFSLRIKDL- TVADSATYYCKAQSGMAIDIGSGHGYNWYDGAGTVLTVN (SEQ ID NO: 40); TRVDQTPRTATKETGESLTI NCVVTGAKYGLAATYWYRKNPGSSNQERISISGRYVESVN KRTMSFSLRIKDLTVADSATYYCKAYPWAMWGQWYDGAGTVLTVN (SEQ ID NO: 41); TRVDQTPRTATKETGESLTINCVVTGAKYGLFATYWYRKNPGSSNQERISISGRYVESVNKRTMSFSLRIKDL- TVADSATYYCKAVFMPQHWHPAAHWYDGAGTVLTVN (SEQ ID NO: 42); TRVDQTPRTATKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERMSIGGRYVESVNKGAKSFSLRIKDL- TVADSATYYCKAREARHPWLRQWYDGAGTVLTVN (SEQ ID NO: 43); ASVNQTPRTATKETGESLTINCVVTGANYGLAATYWYRKNPGSSNQERISISGRYVESVNKRTMSFSLRIKDL- TVADSATYYCKAYPWGAGAPWLVQWYDGAGTVLTVN (SEQ ID NO: 44); TRVDQSPSSLSASVGDRVTITCVLTGANYGLASTYWYRKNPGSSNKEQISISGRYSESVNKGTKSFTLTISSL- QPEDSATYYCRAYPWGAGAPWLVQWYDGAGTKVEIK (SEQ ID NO: 45); TRVDQSPSSLSASVGDRVTITCVLTGANYGLASTYWYRKNPGSSNQERISISGRYSESVNKRTMSFTLTISSL- QPEDSATYYCRAYPWGAGAPWLVQWYDGAGTKVEIK (SEQ ID NO: 46); TRVDQSPSSLSASVGDRVTITCVLTDTSYGLYSTSWFRKNPGTTDWERMSIGGRYVESVNKGAKSFTLTISSL- QPEDFATYYCKAREARHPWLRQWYDGAGTKVEIK (SEQ ID NO: 47); TRVDQSPSSLSASVGDRVTITCVLTDTSYGLYSTYWYRKNPGSSNKEQISISGRYSESVNKGTKSFTLTISSL- QPEDSATYYCRAREARHPWLRQWYDGAGTKVEIK (SEQ ID NO: 48); TRVDQSPSSLSASVGDRVTITCVLTDTSYGLYSTYWYRKNPGTTDWERMSIGGRYSESVNKGAKSFTLTISSL- QPEDSATYYCRAREARHPWLRQWYDGAGTKVEIK (SEQ ID NO: 49), or a functional variant thereof with a sequence identity of at least 45%.
[0066] The EGFR-specific antigen binding molecule may be any molecule which binds to EGFR. In particular, the EGFR-specific antigen binding molecule may be selected from the group comprising an immunoglobulin, an immunoglobulin Fab region, a single chain Fv (scFv), a diabody, a triabody, a tetrabody, a bispecific t-cell engager (BiTE), an intein, a VNAR domain, a single domain antibody (sdAb), a VH domain, or a scaffold protein (affibodies, centyrins, darpins etc.). Preferably, the EGFR-specific antigen binding molecule is a single domain antibody (sdAb).
[0067] Cetuximab is an approved monoclonal antibody therapeutic that inhibits epidermal growth factor receptor (EGFR). Cetuximab prevents EGF and other ligands binding EGFR and otherwise activating EGFR (i.e. prevents the extended receptor conformation required for high-affinity ligand binding and dimerization) [Li 2005 Cancer Cell 7 301-311]. Cetuximab binds to a specific epitope within EGFR domain comprising amino acids 384-408.
[0068] 7C12 and 7D12 are camelid single domain antibodies (nanobodies) that compete for the Cetuximab epitope on EGFR [WO 2007042289 A2]. Both 7C12 and 7D12 demonstrate high affinity EGFR binding (low nM KD) [Roovers 2011 Int J Cancer 129 p 2013, Gainkam 2010 Mol Imaging] and block EGF binding to EGFR [Schmitz 2013 Structure 21 p 1214]. 7C12 and 7D12 differ by 5 amino acids with 7C12 having a higher off rate for EGFR binding [Roovers 2011 Int J Cancer 129 p 2013]
[0069] Matuzumab is another approved monoclonal antibody therapeutic that inhibits EGFR. Matuzumab binding sterically blocks the EGFR domain rearrangement required for high affinity ligand binding and receptor dimerization [Schmiedel 2008 Cancer Cell 13(4) 365-373]. Matuzumab binds primarily to the loop preceding the most C-terminal strand of the domain III .beta.-helix (aa 454-464 of EGFR).
[0070] 9G8 is a sdAb (nanobody) sequence that, although competing for the Matuzumab EGFR epitope [WO 2007042289 A2] has a distinct EGFR epitope, further towards the N terminus of EGFR domain III and further from the domain II ligand binding site, regions inaccessible to conventional antibodies [Schmitz 2013 Structure 21 p 1214].
[0071] Examples of sdAbs for use in the bi-specific antigen binding molecule of the first aspect of the invention include but are not limited to molecules that compete for binding with cetuximab or matuzumab. Preferably, the sdAb is selected from the group comprising:
TABLE-US-00002 7C12: (SEQ ID NO: 83) AVQLVESGGGSVQAGGSLRLTCAASGRTSRSYGMGWFRQAPGKEREFVS GISWRGDSTGYADSVKGRFTISRDNAKNTVDLQMNSLKPEDTAIYYCAA AAGSTWYGTLYEYDYWGQGTQVTVSS 7D12: (SEQ ID NO: 84) QVKLEESGGGSVQTGGSLRLTCAASGRTSRSYGMGWFRQAPGKEREFVS GISWRGDSTGYADSVKGRFTISRDNAKNTVDLQMNSLKPEDTAIYYCAA AAGSAWYGTLYEYDYWGQGTQVTVSS 9G8: (SEQ ID NO: 85) EVQLVESGGGLVQAGGSLRLSCAASGRTFSSYAMGWFRQAPGKEREFVV AINWSSGSTYYADSVKGRFTISRDNAKNTMYLQMNSLKPEDTAVYYCAA GYQINSGNYNFKDYEYDYWGQGTQVTVSS 38G7: (SEQ ID NO: 86) EVQLVESGGGLVQAGGSLRLSCAASGRTFSSYVMGWFRQATGKEREFVA TIAWDSGSTYYADSVKGRFTISRDNAKNTVHLQMNSLKPEDTAVYYCAA SYNVYYNNYYYPISRDEYDYWGQGTQVTVSS
[0072] It will be appreciated that the ROR1-specific antigen binding molecule and EGFR-specific antigen binding molecule may be combined in any order to form the bi-specific antigen binding molecule of the first aspect, i.e., the ROR1-specific antigen binding molecule may be N-terminal to the EGFR-specific antigen binding molecule or vice versa.
[0073] Furthermore, it will be appreciated that higher-order constructs are also contemplated herein, for example constructs composed of multiple ROR1-specific antigen binding molecule and EGFR-specific antigen binding molecules. These may take the form of multiple copies in a single primary amino acid sequence, for example ROR1 binder-EGFR binder-ROR1 binder or EGFR binder-ROR1 binder-EGFR binder.
[0074] The bi-specific antigen binding molecule of the first aspect may additionally include a linker region between the ROR1-specific antigen binding molecule and EGFR-specific antigen binding molecule. Preferred linkers include but are not limited to [G.sub.4S].sub.x, where x is 1, 2, 3, 4, 5, 5, 6, 7, 8, 9, or 10. A particular preferred linker is [G.sub.4S].sub.5. Other linkers may include, but are not limited to PGVQPSPGGGGS (SEQ ID NO: 63) (Wobbe-G4S), PGVQPAPGGGGS (SEQ ID NO: 64) (Wobbe-G4S GM). It will be appreciated that different combinations of different linkers can be combined within the same construct
[0075] The bi-specific antigen binding molecule of the first aspect may also comprise additional domains, which may take the form of N-terminal or C-terminal additions or may be placed between the ROR1-specific antigen binding molecule and EGFR-specific antigen binding molecule in the amino acid sequence of the bi-specific binding molecule. Each domain of the bi-specific antigen binding molecule of the first aspect may be connected via linker regions as described above. Preferred additional domains include, but are not limited to an immunoglobulin, an immunoglobulin Fc region, an immunoglobulin Fab region, a single chain Fv (scFv), a diabody, a triabody, a tetrabody, a bispecific t-cell engager (BiTE), an intein, a VNAR domain, a single domain antibody (sdAb), a VH domain, or a scaffold protein (affibodies, centyrins, darpins etc.). A particularly preferred additional domain is an immunoglobulin Fc region, preferably a human Fc region.
[0076] Combinations expressly contemplated in the present application include, but are not limited to:
[0077] Monovalent ROR1.times.EGFR (Fc Fusion) Bi-Specifics
TABLE-US-00003 B1-Fc-7C12 P3A1-Fc-9G8 E9-Fc-7C12 7C12-Fc-B1 9G8-Fc-P3A1 7C12-Fc-E9 B1-Fc-9G8 D3-Fc-7C12 E9-Fc-9G8 9G8-Fc-B1 7C12-Fc-D3 9G8-Fc-E9 P3A1-Fc-7C12 D3-Fc-9G8 7C12-Fc-P3A1 9G8-Fc-D3
[0078] Divalent ROR1.times.EGFR (Fc Fusion) Bi-Specifics
TABLE-US-00004 B1-B1-Fc-7C12 P3A1-7C12-Fc-P3A1 7C12-D3-Fc-D3 B1-7C12-Fc-B1 7C12-P3A1-Fc-P3A1 7C12-7C12-Fc-D3 7C12-B1-Fc-B1 7C12-7C12-Fc-P3A1 7C12-D3-Fc-7C12 7C12-7C12-Fc-B1 7C12-P3A1-Fc-7C12 D3-7C12-Fc-7C12 7C12-B1-Fc-7C12 P3A1-7C12-Fc-7C12 7C12-Fc-D3-D3 B1-7C12-Fc-7C12 7C12-Fc-P3A1-P3A1 D3-Fc-7C12-7C12 7C12-Fc-B1-B1 P3A1-Fc-7C12-7C12 7C12-Fc-D3-7C12 B1-Fc-7C12-7C12 7C12-Fc-P3A1-7C12 7C12-Fc-7C12-D3 7C12-Fc-B1-7C12 7C12-Fc-7C12-P3A1 D3-Fc-7C12-D3 7C12-Fc-7C12-B1 P3A1-Fc-7C12-P3A1 D3-Fc-D3-7C12 B1-Fc-7C12-B1 P3A1-Fc-P3A1-7C12 E9-E9-Fc-7C12 B1-Fc-B1-7C12 D3-D3-Fc-7C12 E9-7C12-Fc-E9 P3A1-P3A1-Fc-7C12 D3-7C12-Fc-D3 7C12-E9-Fc-E9 7C12-7C12-Fc-E9 7C12-Fc-E9-E9 7C12-Fc-7C12-E9 7C12-E9-Fc-7C12 E9-Fc-7C12-7C12 E9-Fc-7C12-E9 E9-7C12-Fc-7C12 7C12-Fc-E9-7C12 E9-Fc-E9-7C12
[0079] Monovalent ROR1.times.EGFR (Non-Fc) Bi-Specifics
TABLE-US-00005 B1-7C12 9G8-P3A1 E9-7C12 7C12-B1 P3A1-9G8 7C12-E9 9G8-B1 D3-7C12 9G8-E9 B1-9G8 7C12-D3 E9-9G8 P3A1-7C12 9G8-D3 7C12-P3A1 D3-9G8
[0080] Divalent ROR1.times.EGFR (Non-Fc) Bi-Specifics
TABLE-US-00006 B1-B1-7C12 7C12-P3A1-P3A1 D3-9G8-D3 B1-7C12-B1 P3A1-P3A1-9G8 9G8-D3-D3 7C12-B1-B1 P3A1-9G8-P3A1 E9-E9-7C12 B1-B1-9G8 9G8-P3A1-P3A1 E9-E9-D3 B1-9G8-B1 D3-D3-7C12 7C12-E9-E9 9G8-B1-B1 D3-7C12-D3 E9-E9-9G8 P3A1-P3A1-7C12 7C12-D3-D3 E9-9G8-E9 P3A1-7C12-P3A1 D3-D3-9G8 9G8-E9-E9
[0081] Monovalent ROR1, Half Life Extended ROR1.times.EGFR (Non-Fc) Bi-Specifics
TABLE-US-00007 B1-BA11-7C12 BA11-P3A1-7C12 7C12-D3-BA11 B1-7C12-BA11 BA11-7C12-P3A1 7C12-BA11-D3 BA11-B1-7C12 7C12-P3A1-BA11 D3-BA11-9G8 BA11-7C12-B1 7C12-BA11-P3A1 D3-9G8-BA11 7C12-B1-BA11 P3A1-BA11-9G8 BA11-D3-9G8 7C12-BA11-B1 P3A1-9G8-BA11 BA11-9G8-D3 B1-BA11-9G8 BA11-P3A1-9G8 9G8-D3-BA11 B1-9G8-BA11 BA11-9G8-P3A1 9G8-BA11-D3 BA11-B1-9G8 9G8-P3A1-BA11 E9-BA11-7C12 BA11-9G8-B1 9G8-BA11-P3A1 E9-7C12-BA11 9G8-B1-BA11 D3-BA11-7C12 BA11-E9-7C12 9G8-BA11-B1 D3-7C12-BA11 BA11-7C12-E9 P3A1-BA11-7C12 BA11-D3-7C12 7C12-E9-BA11 P3A1-7C12-BA11 BA11-7C12-D3 7C12-BA11-E9 E9-BA11-9G8 BA11-E9-9G8 9G8-E9-BA11 E9-9G8-BA11 BA11-9G8-E9 9G8-BA11-E9
[0082] Where the linkers between domains are preferentially, but not limited to (G.sub.4S).sub.X, where X is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10, PGVQPSPGGGGS (SEQ ID NO: 63) (Wobbe-G4S), PGVQPAPGGGGS (SEQ ID NO: 64) (Wobbe-G4S GM) and wherein different combinations of different linkers can be combined within the same construct.
[0083] Whereby, additional C-terminal (or N-terminal) tag sequences may or may not be present. C-terminal tags include, but are not limited to, tags that contain poly-Histidine sequences to facilitate purification (such as His6), contain c-Myc sequences (such as EQKLISEEDL (SEQ ID NO: 68)) to enable detection and/or contain Cysteine residues to enable labelling and bioconjugation using thiol reactive payloads and probes and combinations thereof. Preferential C-terminal tags include but are not limited to.
TABLE-US-00008 (SEQ ID NO: 69) QASGAHHHHHHGAEFEQKLISEEDL (SEQ ID NO: 67) QACGAHHHHHHGAEFEQKLISEEDL (SEQ ID NO: 70) QACKAHHHHHHGAEFEQKLISEEDL (SEQ ID NO: 71) AAAHHHHHHGAEFEQKLISEEDL (SEQ ID NO: 72) ACAHHHHHHGAEFEQKLISEEDL (SEQ ID NO: 73) QASGAHHHHHH (SEQ ID NO: 74) QACGAHHHHHH (SEQ ID NO: 75) QACKAHHHHHH (SEQ ID NO: 76) AAAHHHHHH (SEQ ID NO: 77) ACAHHHHHH (SEQ ID NO: 78) QASGA (SEQ ID NO: 79) QACGA (SEQ ID NO: 80) QACKA (SEQ ID NO: 81) ACA (SEQ ID NO: 82) SAPSA
[0084] Domains may also be combined via N-terminal, C-terminal or both N- and C-terminal fusion to an Fc domain, including but not limited to:
TABLE-US-00009 hIgG1 (SEQ ID NO: 87) EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK hIgG1 (S252C) (SEQ ID NO: 88) EPKSSDKTHTCPPCPAPELLGGPCVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK hIgG1 (S473C) (SEQ ID NO: 89) EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLCLSPGK
[0085] Wherein:
TABLE-US-00010 7C12 is (SEQ ID NO: 90) AVQLVESGGGSVQAGGSLRLTCAASGRTSRSYGMGWFRQAPGKEREFVS GISWRGDSTGYADSVKGRFTISRDNAKNTVDLQMNSLKPEDTAIYYCAA AAGSTWYGTLYEYDYWGQGTQVTVSSAAAHHHHHHGAEFEQKLISEEDL 9G8 is (SEQ ID NO: 91) MEVQLVESGGGLVQAGGSLRLSCAASGRTFSSYAMGWFRQAPGKEREFV VAINWSSGSTYYADSVKGRFTISRDNAKNTMYLQMNSLKPEDTAVYYCA AGYQINSGNYNFKDYEYDYWGQGTQVTVSSAAAHHHHHHGAEFEQKLIS EEDL B1 is (SEQ ID NO: 44) ASVNQTPRTATKETGESLTINCVVTGANYGLAATYWYRKNPGSSNQERI SISGRYVESVNKRTMSFSLRIKDLTVADSATYYCKAYPWGAGAPWLVQW YDGAGTVLTVN 2V is (SEQ ID NO: 65) TRVDQTPRTATKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYVESVNKGAKSFSLRIKDLTVADSATYYCKAQSLAISTRSYWYD GAGTVLTVN P3A1 is (SEQ ID NO: 43) TRVDQTPRTATKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYVESVNKGAKSFSLRIKDLTVADSATYYCKAREARHPWLRQWYD GAGTVLTVN D3 is (SEQ ID NO: 39) ASVNQTPRTATKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYVESVNKRAKSFSLRIKDLTVADSATYYCKAQSGMAISTGSGHG YNWYDGAGTVLTVN D3D3 is (SEQ ID NO: 92) ASVNQTPRTATKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYVESVNKRAKSFSLRIKDLTVADSATYYCKAQSGMAISTGSGHG YNWYDGAGTVLTVNGGGGSGGGGSGGGGSGGGGSGGGGSASVNQTPRTA TKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERMSIGGRYVESV NKRAKSFSLRIKDLTVADSATYYCKAQSGMAISTGSGHGYNWYDGAGTV LTVN BA11 is (SEQ ID NO: 66) TRVDQSPSSLSASVGDRVTITCVLTDTSYPLYSTYWYRKNPGSSNKEQI SISGRYSESVNKGTKSFTLTISSLQPEDSATYYCRAMSTNIWTGDGAGT KVEIK
[0086] It will be clear to those of skill in the relevant art that bi-specific antigen binding molecules comprising additional domains as described herein may, in some situations, include additional specificity beyond ROR1 and EGFR. Such configurations are also within the scope of the present invention.
[0087] The ROR1-specific antigen binding molecule may be humanized. The ROR1-specific antigen binding molecule may be de-immunized. Examples of humanised sequences of the invention include, but are not limited to:
TABLE-US-00011 B1 G1 (SEQ ID NO: 45) TRVDQSPSSLSASVGDRVTITCVLTGANYGLASTYWYRKNPGSSNKEQI SISGRYSESVNKGTKSFTLTISSLQPEDSATYYCRAYPWGAGAPWLVQW YDGAGTKVEIK; B1 G2 (SEQ ID NO: 46) TRVDQSPSSLSASVGDRVTITCVLTGANYGLASTYWYRKNPGSSNQERI SISGRYSESVNKRTMSFTLTISSLQPEDSATYYCRAYPWGAGAPWLVQW YDGAGTKVEIK; P3A1 V1 (SEQ ID NO: 47) TRVDQSPSSLSASVGDRVTITCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYVESVNKGAKSFTLTISSLQPEDFATYYCKAREARHPWLRQWYD GAGTKVEIK; P3A1 G1 (SEQ ID NO: 48) TRVDQSPSSLSASVGDRVTITCVLTDTSYGLYSTYWYRKNPGSSNKEQI SISGRYSESVNKGTKSFTLTISSLQPEDSATYYCRAREARHPWLRQWYD GAGTKVEIK; P3A1 G2 (SEQ ID NO: 49) TRVDQSPSSLSASVGDRVTITCVLTDTSYGLYSTYWYRKNPGTTDWERM SIGGRYSESVNKGAKSFTLTISSLQPEDSATYYCRAREARHPWLRQWYD GAGTKVEIK; D3 humanised ADV1 (SEQ ID NO: 50) ASVNQSPSSLSASVGDRVTITCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYSESVNKGAKSFTLTISSLQPEDSATYYCKAQSGMAISTGSGHG YNWYDGAGTKVEIK; D3 humanised ADV2 (SEQ ID NO: 51) TRVDQSPSSLSASVGDRVTITCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYSESVNKGAKSFTLTISSLQPEDSATYYCKAQSGMAISTGSGHG YNWYDGAGTKVEIK; D3 humanised ADV3 (SEQ ID NO: 52) ASVNQSPSSASASVGDRLTITCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYSESVNKGAKSFTLTISSLQPEDSATYYCKAQSGMAISTGSGHG YNWYDGAGTKLEVK; B1 humanised V5 (SEQ ID NO: 53) ASVDQSPSSLSASVGDRVTITCVVTGANYGLAATYWYRKNPGSSNQERI SISGRYSESVNKRTMSFTLTISSLQPEDSATYYCKAYPWGAGAPWLVQW YDGAGTKVEIK; B1 humanised V7 (SEQ ID NO: 54) ASVDQSPSSASASVGDRLTITCVVTGANYGLAATYWYRKNPGSSNQERI SISGRYSESVNKRTMSFTLTISSLQPEDSATYYCKAYPWGAGAPWLVQW YDGAGTKLEVK; D3 humanised EL V1 (SEQ ID NO: 55) ASVNQSPSSLSASVGDRVTITCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYVESVNKRAKSFSLRIKDLTVADSATYYCKAQSGMAISTGSGHG YNWYDGAGTKVEIK; D3 humanised EL V2 (SEQ ID NO: 56) ASVNQSPSSLSASVGDRVTITCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYVESVNKRAKSFTLTISSLQPEDFATYYCKAQSGMAISTGSGHG YNWYDGAGTKVEIK; D3 humanised EL V3 (SEQ ID NO: 57) ASVNQSPSSLSASVGDRVTITCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRFSGSGSKRAKSFTLTISSLQPEDFATYYCKAQSGMAISTGSGHG YNWYDGAGTKVEIK; D3 humanised EL V4 (SEQ ID NO: 58) ASVNQSPSSLSASVGDRVTITCVLTDTSYGLYSTSWYQQKPGTTDWERM SIGGRYVESVNKRAKSFTLTISSLQPEDFATYYCKAQSGMAISTGSGHG YNWYDGAGTKVEIK; and D3 humanised EL V5 (SEQ ID NO: 59) ASVNQSPSSLSASVGDRVTITCVLTDTSYGLYSTSWYQQKPGTTDWERM SIGGRFSGSGSKRAKSFTLTISSLQPEDFATYYCKAQSGMAISTGSGHG YNWYDGAGTKVEIK.
[0088] The EGFR-specific antigen binding molecule may be humanised or de-immunised, independently of the humanisation or de-immunization of the ROR1-specific antigen binding molecule.
[0089] The bi-specific antigen binding molecule of the present invention may also be conjugated to a detectable label, dye, toxin, drug, pro-drug, radionuclide or biologically active molecule. The conjugation may be via either the ROR1-specific antigen binding molecule and EGFR-specific antigen binding molecule. Additionally, conjugation may be via sequences or domains fused to the ROR1-specific antigen binding molecule and EGFR-specific antigen binding molecule. In particular, conjugation is via Fc domains or short thiol containing sequences fused to the ROR1-specific antigen binding molecule and EGFR-specific antigen binding molecule.
[0090] Preferably, the ROR1-specific antigen binding molecule selectively interacts with ROR1 protein with an affinity constant of approximately 0.01 to 50 nM, preferably 0.1 to 30 nM, even more preferably 0.1 to 10 nM.
[0091] Furthermore, the bi-specific antigen binding molecule is preferably capable of mediating killing of ROR1-expressing tumour cells or is capable of inhibiting cancer cell proliferation. In addition, the bi-specific antigen binding molecule is preferably capable of mediating killing of EGFR-expressing tumour cells or is capable of inhibiting cancer cell proliferation. Furthermore, the bi-specific antigen binding molecule is preferably capable of mediating killing of tumour cells expressing both ROR1 and EGFR or is capable of inhibiting proliferation of such cells.
[0092] The bi-specific antigen binding molecule may also be capable of being endocytosed upon binding to ROR1 and/or EGFR. In other embodiments, the bi-specific antigen binding molecule may not be endocytosed upon binding to ROR1 and/or EGFR.
[0093] The bi-specific antigen binding molecule may also be capable of down-regulating cell-surface levels or total protein levels of ROR1 or EGFR upon binding to ROR1 and/or EGFR. Furthermore, the bi-specific antigen binding molecule may also be capable of down regulating ROR1 or EGFR signalling. The bi-specific antigen binding molecule may also be capable of down regulating ROR1 and EGFR signalling
[0094] The components of the bi-specific antigen binding molecule may be connected via one or more linker domains. Preferred linkers include but are not limited to [G.sub.4S].sub.x, where x is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. Particular preferred linkers are [G.sub.4S].sub.3 (SEQ ID NO: 60) and [G.sub.4S].sub.5 (SEQ ID NO: 61). Other preferred linkers include the sequences PGVQPSP (SEQ ID NO: 62), PGVQPSPGGGGS (SEQ ID NO: 63) and PGVQPAPGGGGS (SEQ ID NO: 64). These linkers may be particularly useful when proteins are expressed in different expression systems that differ in glycosylation patterns, such as CHO and insect, and those that do not glycosylate expressed proteins (e.g. E. coli).
[0095] It will also be appreciated that the bi-specific antigen binding molecule of the invention can be constructed in any order, i.e., with the ROR1-specific antigen binding molecule at the N-terminus or C-terminus
[0096] In a second aspect of the present invention, there it is provided a recombinant fusion protein comprising a bi-specific antigen binding molecule of the first aspect. Preferably, in the recombinant fusion protein of the second aspect, the bi-specific antigen binding molecule is fused to one or more biologically active proteins. The bi-specific antigen binding molecule may be fused to one or more biologically active proteins via one or more linker domains. Preferred linkers include but are not limited to [G.sub.4S].sub.x, where x is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. Particular preferred linkers are [G.sub.4S].sub.3 (SEQ ID NO: 60) and [G.sub.4S].sub.5 (SEQ ID NO: 61). Other preferred linkers include the sequences PGVQPSP (SEQ ID NO: 62), PGVQPSPGGGGS (SEQ ID NO: 63) and PGVQPAPGGGGS (SEQ ID NO: 64). These linkers may be particularly useful when recombinant fusion proteins are expressed in different expression systems that differ in glycosylation patterns, such as CHO and insect, and those that do not glycosylate expressed proteins (e.g. E. coli).
[0097] It will also be appreciated that the fusion proteins of the invention can be constructed in any order, i.e., with the ROR1-specific antigen binding molecule at the N-terminus, C-terminus, or at neither terminus (e.g. in the middle of a longer amino acid sequence). Furthermore, fusion proteins in which the ROR1 and EGFR components of the bi-specific antigen binding molecule are separated by the biologically active protein are described. A non-limiting example would be the presence of an Fc domain between the two components of the bi-specific antigen binding molecule. Depending on the exact configuration desired, one or more linker domains as described herein may be included.
[0098] Preferred biologically active proteins include, but are not limited to an immunoglobulin, an immunoglobulin Fc region, an immunoglobulin Fab region, a single chain Fv (scFv), a diabody, a triabody, a tetrabody, a bispecific t-cell engager (BiTE), an intein, a VNAR domain, a single domain antibody (sdAb), a VH domain, or a scaffold protein (affibodies, centyrins, darpins etc.). A particularly preferred biologically active protein is an immunoglobulin Fc region.
[0099] Any part of the fusion protein of the invention may be engineered to enable conjugation. In a preferred example, where an immunoglobulin Fc region is used, it may be engineered to include a cysteine residue as a conjugation site. Preferred introduced cysteine residues include, but are not limited to S252C and S473C (Kabat numbering), which correspond to S239C and S442C in EU numbering, respectively.
[0100] In accordance with the second aspect, recombinant fusions comprising multiple VNAR domains are provided. Accordingly, the recombinant fusions of the invention may be dimers, trimers or higher order multimers of VNARs. In such recombinant fusions, the specificity of each VNAR may be the same or different. Recombinant fusions of the invention include, but are not limited to, bi-specific or tri-specific molecules in which each VNAR domain binds to a different antigen, or to different epitopes on a single antigen (bi-paratopic binders). The term "bi-paratopic" as used herein is intended to encompass molecules that bind to multiple epitopes on a given antigen. Molecules that bind three or more epitopes on a given antigen are also contemplated herein and where the term "bi-paratopic" is used, it should be understood that the potential for tri-paratopic or multi-paratopic molecules is also encompassed.
[0101] Also in accordance with the second aspect, recombinant fusions are provided which include a bi-specific antigen binding molecule of the first aspect and a humanised VNAR domain. Humanised VNAR domains may be referred to as soloMERs and include but are not limited to the VNAR BA11, which is a humanised VNAR that binds with high affinity to human serum albumin (Kovalenko et al, J. Biol. Chem., 2013 JBC).
[0102] In certain embodiments, the specific binding molecules or recombinant fusions of the invention may be expressed with N- or C-terminal tags to assist with purification. Examples include but are not limited to His6 and/or Myc. In addition, the N- or C-terminal tag may be further engineered to include additional cysteine residues to serve as conjugation points. It will therefore be appreciated that reference to specific binding molecules or recombinant fusions in all aspects of the invention is also intended to encompass such molecules with a variety of N- or C-terminal tags, which tags may also include additional cysteines for conjugation.
[0103] Also in accordance with the second aspect, recombinant fusions are provided which include a bi-specific antigen binding molecule of the first aspect and a recombinant toxin. Examples of recombinant toxins include but are not limited to Pseudomonas exotoxin PE38 and diphtheria toxin.
[0104] In a third aspect of the present invention, there is provided a chimeric antigen receptor (CAR), comprising at least one bi-specific antigen binding molecule as defined by the first aspect of the invention, fused or conjugated to at least one transmembrane region and at least one intracellular domain.
[0105] The present invention also provides a cell comprising a chimeric antigen receptor according to the third aspect, which cell is preferably an engineered T-cell.
[0106] In a fourth aspect of the invention, there is provided a nucleic acid sequence comprising a polynucleotide sequence that encodes a bi-specific antigen binding molecule, recombinant fusion protein or chimeric antigen receptor according to the first, second or third aspects of the invention.
[0107] There is also provided a vector comprising a nucleic acid sequence in accordance with the fourth aspect and a host cell comprising such a nucleic acid.
[0108] A method for preparing a bi-specific antigen binding molecule, recombinant fusion protein or chimeric antigen receptor, of the first, second or third aspect is provided, the method comprising cultivating or maintaining a host cell comprising the polynucleotide or vector described above under conditions such that said host cell produces the bi-specific antigen binding molecule, recombinant fusion protein or chimeric antigen receptor, optionally further comprising isolating the bi-specific antigen binding molecule, recombinant fusion protein or chimeric antigen receptor.
[0109] In a fifth aspect of the invention, there is provided a pharmaceutical composition comprising the bi-specific antigen binding molecule, fusion protein or chimeric antigen receptor of the first, second or third aspects. The pharmaceutical composition may contain a variety of pharmaceutically acceptable carriers. Pharmaceutical compositions of the invention may be for administration by any suitable method known in the art, including but not limited to intravenous, intramuscular, oral, intraperitoneal, or topical administration. In preferred embodiments, the pharmaceutical composition may be prepared in the form of a liquid, gel, powder, tablet, capsule, or foam.
[0110] The bi-specific antigen binding molecule, recombinant fusion protein or chimeric antigen receptor of the first, second or third aspects may be for use in therapy. More specifically, the bi-specific antigen binding molecule, recombinant fusion protein or chimeric antigen receptor of the first, second or third aspects may be for use in the treatment of cancer. Preferably, the cancer is a ROR1-positive cancer type. More preferably, the cancer is selected from the group comprising blood cancers such as lymphomas and leukemias, chronic lymphocytic leukaemia (CLL), mantle cell lymphoma (MCL), B-cell acute lymphoblastic leukaemia (B-ALL), marginal zone lymphoma (MZL), non-Hodgkin lymphomas (NHL), acute myeloid leukemia (AML) and solid tumours including neuroblastoma, renal cancer, lung cancer, colon cancer, ovarian cancer, pancreatic cancer, breast cancer, skin cancer, uterine cancer, prostate cancer, thyroid cancer, Head and Neck cancer, bladder cancer, stomach cancer or liver cancer.
[0111] Also provided herein is the use of a bi-specific antigen binding molecule, recombinant fusion protein or chimeric antigen receptor of the first, second or third aspects in the manufacture of a medicament for the treatment of a disease in a patient in need thereof.
[0112] Furthermore, in accordance with the present invention there is provided a method of treatment of a disease in a patient in need of treatment comprising administration to said patient of a therapeutically effective dosage of a bi-specific antigen binding molecule, recombinant fusion protein or chimeric antigen receptor of the first, second or third aspects or a pharmaceutical composition of the fifth aspect.
[0113] Preferably, the cancer is a ROR1-positive cancer type. More preferably, the cancer is selected from the group comprising blood cancers such as lymphomas and leukemias, chronic lymphocytic leukaemia (CLL), mantle cell lymphoma (MCL), B-cell acute lymphoblastic leukaemia (B-ALL), marginal zone lymphoma (MZL), non-Hodgkin lymphomas (NHL), acute myeloid leukemia (AML) and solid tumours including neuroblastoma, renal cancer, lung cancer, colon cancer, ovarian cancer, pancreatic cancer, breast cancer, skin cancer, uterine cancer, prostate cancer, thyroid cancer, Head and Neck cancer, bladder cancer, stomach cancer or liver cancer.
[0114] Also provided herein is a method of assaying for the presence of a target analyte in a sample, comprising the addition of a detectably labelled bi-specific antigen binding molecule of the first aspect, or a recombinant fusion protein of the second aspect, to the sample and detecting the binding of the molecule to the target analyte.
[0115] In addition, there is provided herein a method of imaging a site of disease in a subject, comprising administration of a detectably labelled bi-specific antigen binding molecule of the first aspect or a detectably labelled recombinant fusion protein of the second aspect to a subject.
[0116] There is also provided herein a method of diagnosis of a disease or medical condition in a subject comprising administration of a bi-specific antigen binding molecule of the first aspect or a recombinant fusion protein of the second aspect.
[0117] Also contemplated herein is an antibody, antibody fragment or antigen-binding molecule that competes for binding to ROR1 with the ROR1-specific antigen binding molecule of the first aspect.
[0118] Also contemplated herein is an antibody, antibody fragment or antigen-binding molecule that competes for binding to ROR1 and EGFR with the bi-specific antigen binding molecule of the first aspect. The term "compete" when used in the context of antigen binding proteins (e.g., neutralizing antigen binding proteins or neutralizing antibodies) means competition between antigen binding proteins as determined by an assay in which the antigen binding protein (e.g., antibody or functional fragment thereof) under test prevents or inhibits specific binding of a the antigen binding molecule defined herein (e.g., the bi-specific antigen binding molecule of the first aspect) to a common antigen (e.g., ROR1 or EGFR in the case of the bi-specific antigen binding molecule of the first aspect).
[0119] Also described herein is a kit for diagnosing a subject suffering from cancer, or a pre-disposition thereto, or for providing a prognosis of the subject's condition, the kit comprising detection means for detecting the concentration of antigen present in a sample from a test subject, wherein the detection means comprises a bi-specific antigen binding molecule of the first aspect, a recombinant fusion protein of the second aspect, a chimeric antigen receptor of the third aspect or a nucleic acid sequence of the fourth aspect, each being optionally derivatized, wherein presence of antigen in the sample suggests that the subject suffers from cancer. Preferably the antigen comprises ROR1 protein, more preferably an extracellular domain thereof. More preferably, the kit is used to identify the presence or absence of ROR1-positive cells in the sample, or determine the concentration thereof in the sample. The kit may also comprise a positive control and/or a negative control against which the assay is compared and/or a label which may be detected.
[0120] The present invention also provides a method for diagnosing a subject suffering from cancer, or a pre-disposition thereto, or for providing a prognosis of the subject's condition, the method comprising detecting the concentration of antigen present in a sample obtained from a subject, wherein the detection is achieved using a bi-specific antigen binding molecule of the first aspect, a recombinant fusion protein of the second aspect, a chimeric antigen receptor of the third aspect or a nucleic acid sequence of the fourth aspect, each being optionally derivatized, and wherein presence of antigen in the sample suggests that the subject suffers from cancer.
[0121] Also contemplated herein is a method of killing or inhibiting the growth of a cell expressing ROR1 in vitro or in a patient, which method comprises administering to the cell a pharmaceutically effective amount or dose of (i) bi-specific antigen binding molecule of the first aspect, a recombinant fusion protein of the second aspect, a nucleic acid sequence of the third aspect, or the CAR or cell according the fourth aspect, or (ii) of a pharmaceutical composition of the fifth aspect. Preferably, the cell expressing ROR1 is a cancer cell. More preferably, the ROR1 is human ROR1.
[0122] Also contemplated herein is a method of killing or inhibiting the growth of a cell expressing EGFR in vitro or in a patient, which method comprises administering to the cell a pharmaceutically effective amount or dose of (i) bi-specific antigen binding molecule of the first aspect, a recombinant fusion protein of the second aspect, a nucleic acid of the third aspect, or the CAR or cell according to the cell aspect, or (ii) of a pharmaceutical composition according to the fifth aspect. Preferably, the cell expressing EGFR is a cancer cell.
[0123] Also contemplated herein is a method of killing or inhibiting the growth of a cell expressing both ROR1 and EGFR in vitro or in a patient, which method comprises administering to the cell a pharmaceutically effective amount or dose of (i) bi-specific antigen binding molecule of the first aspect, a recombinant fusion protein of the second aspect, a nucleic acid of the third aspect, or the CAR or cell according to the cell aspect, or (ii) of a pharmaceutical composition according to the fifth aspect. Preferably, the cell expressing ROR1 and EGFR is a cancer cell.
[0124] In a sixth aspect of the present invention, there is provided a bi-specific antigen binding molecule comprising an amino acid sequence represented by the formula (II):
Xb-X-Xa-FW1-CDR1-FW2-HV2-FW3a-HV4-FW3b-CDR3-FW4-Ya-Y-Yb (II)
[0125] wherein
[0126] FW1 is a framework region
[0127] CDR1 is a CDR sequence
[0128] FW2 is a framework region
[0129] HV2 is a hypervariable sequence
[0130] FW3a is a framework region
[0131] HV4 is a hypervariable sequence
[0132] FW3b is a framework region
[0133] CDR3 is a CDR sequence
[0134] FW4 is a framework region
[0135] wherein Xa, Xb, Ya and Yb are either absent or an EGFR-specific binding molecule,
[0136] wherein at least one of Xa, Xb, Ya and Yb is an EGFR-specific binding molecule,
[0137] X and Y are optional amino acid sequences
[0138] wherein the specific antigen binding molecule is conjugated to a second moiety.
[0139] In certain preferred embodiments, the bi-specific antigen binding molecule according to this aspect of the invention may additionally be conjugated to a third, fourth or fifth moiety. Conjugation of further moieties is also contemplated. In some cases, a third, fourth or fifth moiety may be conjugated to the second moiety. Accordingly, it will be understood that any of the moieties according to this aspect of the invention may have additional moieties conjugated thereto. Description of preferred features of the second moiety as set out below apply to the third, fourth, fifth or higher order moiety mutatis mutandis.
[0140] Preferably X or Y are individually either absent or selected from the group comprising an immunoglobulin, an immunoglobulin Fc region, an immunoglobulin Fab region, a single chain Fv (scFv), a diabody, a triabody, a tetrabody, a bispecific t-cell engager (BiTE), an intein, a VNAR domain, a single domain antibody (sdAb), a VH domain, or a scaffold protein (affibodies, centyrins, darpins etc.), or a toxin including but not limited to Pseudomonas exotoxin PE38, diphtheria toxin.
[0141] Preferably, the conjugation is via a cysteine residue in the amino acid sequence of the specific antigen binding molecule. The cysteine residue may be anywhere in the sequence, including in optional sequences X or Y (if present).
[0142] The conjugation may be via a thiol, aminoxy or hydrazinyl moiety incorporated at the N-terminus or C-terminus of the amino acid sequence of the specific antigen binding molecule.
[0143] Preferably, the second moiety is selected from the group comprising detectable label, dye, toxin, drug, pro-drug, radionuclide or biologically active molecule.
[0144] More preferably, the second moiety is at least one toxin selected from the group comprising:
[0145] maytansinoids,
[0146] auristatins,
[0147] anthracyclins, preferably PNU-derived anthracyclins
[0148] calicheamicins,
[0149] amanitin derivatives, preferably .alpha.-amanitin derivatives
[0150] tubulysins
[0151] duocarmycins
[0152] radioisotopes for example alpha-emitting radionuclide, such as 227 Th or 225 Ac
[0153] liposomes comprising a toxic payload,
[0154] protein toxins
[0155] taxanes,
[0156] pyrrolbenzodiazepines
[0157] indolinobenzodiazepine pseudodimers and/or
[0158] spliceosome inhibitors
[0159] CDK11 inhibitors
[0160] Pyridinobenzodiazepines
[0161] In other preferred embodiments in accordance with this aspect, the second moiety may be from the group comprising an immunoglobulin, an immunoglobulin Fc region, an immunoglobulin Fab region, a single chain Fv (scFv), a diabody, a triabody, a tetrabody, a bispecific t-cell engager (BiTE), an intein, a VNAR domain, a single domain antibody (sdAb), a VH domain, or a scaffold protein (affibodies, centyrins, darpins etc.), or a toxin including but not limited to Pseudomonas exotoxin PE38, diphtheria toxin.
[0162] In particularly preferred embodiments, the second moiety is a VNAR domain, which may be the same or different to the specific antigen binding molecule according to this aspect. Accordingly, dimers, trimers or higher order multimers of VNAR domains linked by chemical conjugation are explicitly contemplated herein. In such embodiments, each individual VNAR domain may have the same antigen specificity as the other VNAR domains, or they may be different.
[0163] In accordance with this aspect, the specific antigen binding molecule may be a receptor tyrosine kinase-like orphan receptor 1 (ROR1) specific antigen binding molecule. This may be a ROR1-specific antigen binding molecule as described above in relation to the first aspect of the invention. Accordingly, any of the preferred features described above in relation to the first, second and third aspects apply mutatis mutandis to the sixth aspect.
[0164] Preferably, the EGFR-specific antigen binding molecule is selected from the group comprising an immunoglobulin, an immunoglobulin Fab region, a single chain Fv (scFv), a diabody, a triabody, a tetrabody, a bispecific t-cell engager (BiTE), an intein, a VNAR domain, a single domain antibody (sdAb), a VH domain, or a scaffold protein (affibodies, centyrins, darpins etc.).
[0165] The bi-specific antigen binding molecule of the sixth aspect may be for use in therapy. More specifically, the bi-specific antigen binding molecule of the sixth aspect may be for use in the treatment of cancer. Preferably, the cancer is a ROR1-positive cancer type. More preferably, the cancer is selected from the group comprising blood cancers such as lymphomas and leukemias, chronic lymphocytic leukaemia (CLL), mantle cell lymphoma (MCL), B-cell acute lymphoblastic leukaemia (B-ALL), marginal zone lymphoma (MZL), non-Hodgkin lymphomas (NHL), acute myeloid leukemia (AML) and solid tumours including neuroblastoma, renal cancer, lung cancer, colon cancer, ovarian cancer, pancreatic cancer, breast cancer, skin cancer, uterine cancer, prostate cancer, thyroid cancer, Head and Neck cancer, bladder cancer, stomach cancer or liver cancer.
[0166] Also provided herein is the use of a bi-specific antigen binding molecule of the sixth aspect in the manufacture of a medicament for the treatment of a disease in a patient in need thereof.
[0167] Pharmaceutical compositions comprising the bi-specific antigen binding molecule of the sixth aspect are also provided. The pharmaceutical composition may contain a variety of pharmaceutically acceptable carriers
[0168] Furthermore, in accordance with the present invention there is provided a method of treatment of a disease in a patient in need of treatment comprising administration to said patient of a therapeutically effective dosage of a bi-specific antigen binding molecule of the sixth aspect or a pharmaceutical composition comprising a specific antigen binding molecule of the sixth aspect.
[0169] Preferably, the cancer is a ROR1-positive cancer type. More preferably, the cancer is selected from the group comprising blood cancers such as lymphomas and leukemias, chronic lymphocytic leukaemia (CLL), mantle cell lymphoma (MCL), B-cell acute lymphoblastic leukaemia (B-ALL), marginal zone lymphoma (MZL), non-Hodgkin lymphomas (NHL), acute myeloid leukemia (AML) and solid tumours including neuroblastoma, renal cancer, lung cancer, colon cancer, ovarian cancer, pancreatic cancer, breast cancer, skin cancer, uterine cancer, prostate cancer, thyroid cancer, Head and Neck cancer, bladder cancer, stomach cancer or liver cancer.
[0170] Also provided herein is a method of assaying for the presence of a target analyte in a sample, comprising the addition of a detectably labelled bi-specific antigen binding molecule of the sixth aspect to the sample and detecting the binding of the molecule to the target analyte.
[0171] In addition, there is provided herein a method of imaging a site of disease in a subject, comprising administration of a detectably labelled bi-specific antigen binding molecule of the sixth aspect to a subject.
[0172] There is also provided herein a method of diagnosis of a disease or medical condition in a subject comprising administration of a bi-specific antigen binding molecule of the sixth aspect.
[0173] In a seventh aspect of the present invention, there is provided there is provided a bi-specific antigen binding molecule comprising an amino acid sequence represented by the formula (II):
Xb-X-Xa-FW1-CDR1-FW2-HV2-FW3a-HV4-FW3b-CDR3-FW4-Ya-Y-Yb (II)
[0174] wherein
[0175] FW1 is a framework region
[0176] CDR1 is a CDR sequence
[0177] FW2 is a framework region
[0178] HV2 is a hypervariable sequence
[0179] FW3a is a framework region
[0180] HV4 is a hypervariable sequence
[0181] FW3b is a framework region
[0182] CDR3 is a CDR sequence
[0183] FW4 is a framework region
[0184] wherein Xa, Xb, Ya and Yb are either absent or an EGFR-specific binding molecule,
[0185] wherein at least one of Xa, Xb, Ya and Yb is an EGFR-specific binding molecule,
[0186] X and Y are optional amino acid sequences.
[0187] All features described in relation to the sixth aspect of the invention apply mutatis mutandis to the molecule of the seventh aspect.
[0188] Furthermore, any of the features described in respect of any of the above-mentioned aspects of the invention may be combined mutatis mutandis with the other aspects of the invention.
DESCRIPTION OF FIGURES
[0189] FIG. 1: anti-ROR1 phage monoclonals displaying VNAR domains: binding to human or mouse recombinant ROR1-Fc in ELISA. B1, P3A1 and E7--specific ROR1 binders, H2--non-specific phage.
[0190] FIG. 2: ROR1 binding sequences obtained from screening the synthetic VNAR library using human ROR1 (B1 and E7) and mouse ROR1 (P3A1 and CPF7). Sequences shown without and with the C-terminal His.sub.6Myc tag (His.sub.6 Myc sequence in italics).
[0191] FIG. 3: Generation of the immunised VNAR library using human ROR1: analysis of three spiny dogfish pre- and post-immunisation plasma binding to murine or human ROR1.
[0192] FIG. 4: anti-ROR1 phage monoclonals from immunised VNAR library: binding to human or mouse recombinant ROR1-Fc in ELISA. E9 and D3--specific ROR1 binders, H1--non-specific VNAR binder displayed on phage.
[0193] FIG. 5: ROR1 binding sequences E9 and D3 obtained from screening the immunised VNAR library using mouse ROR1. Sequences shown without and with the C-terminal His.sub.6Myc tag (His6 Myc sequence in italics).
[0194] FIG. 6: Far UV CD spectra of VNAR no tag, VNAR 6.times. His and VNAR-His.sub.6-Myc in 50 mM NaCl 20 mM NaP buffer pH 6.0 at room temperature.
[0195] FIG. 7: VNAR reformatting A: monomeric VNAR, B: homodimers, C: conjugated homodimers via C-terminal intermolecular disulphide bond, D: heterodimers, E: VNAR IgG Fc fusions, F: IgG Fc-VNAR fusions, G: VNAR-(IgG Fc)-VNAR fusions.
[0196] FIG. 8: Binding of B1 C-terminally linked homodimer to hROR1. B1, B1 C-terminal thiol (B1 SH) and B1 C-terminal disulphide dimer (B1 S-S B1) binding to human ROR1 by ELISA.
[0197] FIG. 9: Cell surface binding of VNAR (His.sub.6Myc tag) molecules to A549 (ROR1.sup.hi) lung cancer cells by flow cytometry. B1 and E7 monomers and P3A1-P3A1 dimer bind strongly to A549 cells at all concentrations tested. CPF7 and P3A1 monomers bind at 50 .mu.g/ml to A549 cells. VNAR binding was detected using PE-anti Myc tag Ab (CST) and analysed using a BD Biosciences FACSCalibur flow cytometer.
[0198] FIG. 10: Linker mouse IgG and linker human IgG sequences used in VNAR IgG Fc fusion proteins. Engineered hIgG1 Fc fusion proteins incorporate an engineered cysteine substitution in the hIgG1 Fc sequence, for example at position S252C (Kabat numbering) to enable site specific labelling.
[0199] FIG. 11: Intein cleavage reagents and the corresponding VNAR C-terminal derivatives.
[0200] FIG. 12: VNAR binding to human, mouse and rat ROR1 and human ROR2 by ELISA. All VNARs were found to be species cross-reactive to ROR1. None of the VNAR clones cross-reacted with human ROR2.
[0201] FIG. 13: VNAR cell surface binding to A549 (ROR1.sup.hi) vs A427 (ROR1.sup.low) lung cancer cell lines by flow cytometry. VNAR binding was detected using a PE-anti-Myc Ab (CST) and a ThermoFisher Attune NxT flow cytometer.
[0202] FIG. 14: Cell surface binding of VNARs to MDA-MB-231 breast cancer cells for 2 hrs at 4.degree. C. or 37.degree. C. Loss of cell surface signal at 37.degree. C. is suggestive of ROR1 internalisation. VNAR binding was detected using PE-anti Myc tag Ab (CST) and analysed using a BD Biosciences FACS Calibur (B1) or a ThermoFisher Attune N.times.T flow cytometer.
[0203] FIG. 15: Bar chart depicting VNAR-hFc molecule cell surface binding to A549 (ROR1.sup.hi) vs A427 (ROR1.sup.low) lung cancer cell lines. VNAR hFc binding was detected using a PE-anti-human antibody (Jackson ImmunoResearch Labs/Stratech) and a ThermoFisher Attune N.times.T flow cytometer.
[0204] FIG. 16: Internalisation of VNAR-Fc fusions. Cell surface binding of VNAR-Fc to MDA-MB-231 breast cancer cells for 2 hrs at 4.degree. C. or 37.degree. C. Loss of cell surface signal at 37.degree. C. is suggestive of ROR1 internalisation. VNAR-Fc binding was detected using a PE-anti-human antibody (JacksonImmunoResearch) and a ThermoFisher Attune N.times.T flow cytometer.
[0205] FIG. 17: VNARs bind to human ROR1 independent of glycosylation. A, SDS PAGE analysis of hROR1 (lane 2) and deglycosylated hROR1 (lane 3). Mwt markers (lane 1). B, ROR1 binding VNARs B1, P3A1-P3A1 and D3-D3 bind equally well to deglycosylated hROR1 by ELISA. C, B1 mFc binds equally well to glycosylated and deglycosylated hROR1 by ELISA. Binding to unfolded hROR1 (reduced with 28 mM DTT, 0.5% Sarkosyl) was significantly reduced, consistent with B1 VNAR binding to conformational epitope(s).
[0206] FIG. 18: B1 forms a complex with ROR1 Ig domain by SEC. A, Overlayed SEC analysis (Superdex 200 Increase 10/300, GE Healthcare) of human ROR1 Ig domain with and without B1 his (orange and blue traces, respectively). B, SDS PAGE analysis of peak fractions.
[0207] FIG. 19: SPR sensograms depicting binding of VNARs to hROR1+/-previously captured B1 His.sub.6Myc VNAR. 2V monomer or dimer did not bind under any of these conditions.
[0208] FIG. 20: B1 and P3A1 do not bind to selected linear ROR1 peptides by ELISA. Binding to human ROR1 is included as a positive control.
[0209] FIG. 21: B1, P3A1, D3 and D3-D3 do not bind to selected linear ROR1 peptides by ELISA. Binding to human ROR1 is included as a positive control.
[0210] FIG. 22: Competition ELISA experiments.
[0211] FIG. 23: Competition ELISA experiments.
[0212] FIG. 24: Binding of B1, P3A1, D3 monomer and D3-D3 dimer to different ROR1 domains.
[0213] FIG. 25: Schematic of BA11 aminoxy conjugation to benzaldehyde fluorescein.
[0214] FIG. 26: Schematic of BA11 thiol conjugation to maleimide fluorescein.
[0215] FIG. 27: Schematic of BA11 C-terminal cysteine derivative conjugation to maleimide fluorescein
[0216] FIG. 28: Examples of labels and payloads used for conjugation.
[0217] FIG. 29: Analysis of B1 MMAE conjugates. A, SDS PAGE analysis of B1 his myc derivatives and conjugates--lanes 1, B1 aminoxy; 2, B1 oxime MMAE; 3, B1 oxime vc MMAE; 4, B1 SH vc MMAE. B-F, electrospray mass spectra of B1 his myc derivatives and conjugates--B, B1 SH (expected mass; 14908.9 Da, observed mass 14908.4 Da); C, B1 SH vc MMAE (expected mass 16225.5 Da, observed mass 16225.5 Da); D, B1 aminoxy (expected mass 14937.4 Da, observed mass 14936.5 Da); E, B1 oxime MMAE (expected mass 16015.4 Da, observed mass 16016.7 Da); F, B1 oxime vc MMAE (expected mass 16334.4 Da, observed mass 16334.2 Da).
[0218] FIG. 30: Cell surface binding of B1-, P3A1- and 2V-hFc molecules vs the MMAE-conjugated versions in A549 (ROR1.sup.hi) vs A427 (ROR1.sup.low) lung cancer cell lines. VNAR hFc binding was detected using a PE-anti-human antibody (Jackson ImmunoResearch Labs/Stratech) and a ThermoFisher Attune N.times.T flow cytometer.
[0219] FIG. 31: Analysis of VNAR hFc conjugates. A&B, SDS PAGE analysis of VNAR hFc (S252C) proteins and conjugates (4-12% and 12% Bis Tris gel, respectively). Lanes 1, untreated protein, 2, refolded protein and 3, MMAE conjugate(+/-reduction with DTT). C & D, Example of mass spec analysis of deglycosylated, reduced VNAR hFc (S252C) fusion proteins before and after MMAE conjugation, respectively. Expected masses: unconjugated 38,997.8 Da and MMAE conjugate (DAR 2) 40,310.0 Da. E&F SDS PAGE analysis of VNAR hFc (S473C) protein conjugates. Lanes 3, MMAE conjugates and 4, AF488 conjugates(+/-reduction with DTT). G&H Mass spec analysis of deglycosylated, reduced B1- and P3A1 hFc (S473C) MMAE conjugates, respectively. Expected masses: B1 conjugate 40,170.5 Da and P3A1 conjugate 40,308.5 Da (DARs of 2) [* corresponds to MS artefact due to in source fragmentation]. I&J Mass spec analysis of deglycosylated, reduced B1- and P3A1 hFc (S473C) AF488 conjugates, respectively. Expected masses: B1 conjugate 39,552.4 Da and P3A1 conjugate 39,690.4 Da (DARs of 2).
[0220] FIG. 32: Schematic of VNAR hFc PBD dimer, amanitin and PNU conjugates.
[0221] FIG. 33: Cell viability following treatment with B1 mFc MMAE or 2V mFc-MMAE molecules (72 hr) in a panel of different human cancer cell lines. Cell Titre Glo reagent (Promega) was used to quantify ATP which correlates with the number of metabolically active cells in culture. IC50 values were determined using GraphPad Prism software.
[0222] FIG. 34: Cell viability following treatment with VNAR hFc PBD conjugates (96 hr) in 2 different human cancer cell lines (DU145 and Jeko-1). Cell Titre Glo reagent (Promega) was used to quantify ATP which correlates with the number of metabolically active cells in culture. IC50 values were determined using GraphPad Prism software. VNAR hFc conjugates were generated by reacting VNAR hIgG1 Fc(S252C) fusions with MA PEG4 va PBD (see FIG. 32).
[0223] FIG. 35: Cell viability following treatment with VNAR hFc PBD, SG3199 PBD and PNU (PEG4 vc PAB DMAE PNU159682) conjugates (96 hr) in 2 different human cancer cell lines (PA-1 and Kasumi-2). Cell Titre Glo reagent (Promega) was used to quantify ATP which correlates with the number of metabolically active cells in culture. IC50 values were determined using GraphPad Prism software. Whereby VNAR hFc conjugates were generated by reacting VNAR hIgG1 Fc(S252C) fusions with MA PEG4 va PBD, MA PEG8 va PAB SG3199, MA PEG4 vc PAB DMAE PNU 159682 (see FIG. 32).
[0224] FIGS. 36A and 36B: Cell surface binding of bispecific molecule B1hFc7C12 to a variety of cell lines compared to parental molecules. B1hFc7C12 shows an uplifting in binding. Performed using an Attune N.times.T flow cytometer (ThermoFisher) and a PE-conjugated anti-human secondary antibody to detect (Biolegend). A: Proteins applied at 66 nM B: Proteins applied at 357 nM.
[0225] FIG. 36C: Cell surface binding of bispecific molecule P3A1hFc7C12 to a variety of cell lines compared to parental molecules. P3A1hFc7C12 shows an uplifting in binding. Performed using an Attune N.times.T flow cytometer (ThermoFisher) and a PE-conjugated anti-human secondary antibody to detect (Biolegend).
[0226] FIG. 37A: Cell surface binding of ROR1-, EGFR-, and EGFR-ROR1 bispecific molecules to A549 cells (high ROR1, high EGFR). Binding of the His6Myc tagged proteins was assessed by flow cytometry using a PE-anti-Myc tag antibody to detect (CST). Analyses was performed using an Attune N.times.T flow cytometer (Thermo).
[0227] FIG. 37B: Cell surface binding of ROR1-, EGFR-, and EGFR-ROR1 bispecific molecules to PA-1 cells (high ROR1, medium/low EGFR). Binding of the His6Myc tagged proteins was assessed by flow cytometry using a PE-anti-Myc tag antibody to detect (CST). Analyses was performed using an Attune N.times.T flow cytometer (Thermo).
[0228] FIG. 37C: Cell surface binding of ROR1-, EGFR-, and EGFR-ROR1 bispecific molecules to A427 cell (low ROR1, low EGFR). Binding of the His6Myc tagged proteins was assessed by flow cytometry using a PE-anti-Myc tag antibody to detect (CST). Analyses was performed using an Attune N.times.T flow cytometer (Thermo). A427 are ROR1 low, so as expected the ROR1.times.EGFR bi-specific shows little increase in binding wrt parental EGFR binder only.
[0229] FIG. 38: Comparison of cell surface binding of 7C12hFc fusion and hFc-7C12 fusion to a variety of cell lines. Fusion of 7C12 to the C-terminus of the hFc shows a decrease in binding to EGFR on cell-lines as compared to when 7C12 is fused to the N-terminus of the hFc protein. Performed using an Attune N.times.T flow cytometer (ThermoFisher) and a PE-conjugated anti-human secondary antibody to detect (Biolegend)
[0230] FIG. 39: B1hFc7C12 microscopy
[0231] Increased cell surface binding at 4.degree. C. of bispecific molecule B1hFc7C12 and internalisation after incubation at 37.degree. C. for 2 hours was observed in A549 cells compared to parental molecules. Images were obtained using a GE Healthcare InCell 2000. Hoechst dye was used to stain nuclei (blue), AF488-anti-human Ab (Thermo) was used to detect VNAR hFc molecules (green) and AF647-anti-rabbit Ab (CST) was used to detect Lamp-1 or EEA1 (red).
[0232] FIG. 40: P3A1hFc7C12 microscopy
[0233] Increased cell surface binding at 4.degree. C. of bispecific molecule P3A1hFc7C12 and internalisation after incubation at 37.degree. C. for 2 hours was observed in A549 cells compared to parental molecules. Images were obtained using a GE Healthcare InCell 2000. Hoechst dye was used to stain nuclei (blue), AF488-anti-human Ab (Thermo) was used to detect VNAR hFc molecules (green) and AF647-anti-rabbit Ab (CST) was used to detect Lamp-1 or EEA1 (red).
[0234] FIG. 41: B1hFc7C12 co-localisation
[0235] Bispecific molecule B1hFc7C12 appears to co-localise with EEA1 (early endosome antigen 1) and to some extent with Lamp-1 (lysosomal marker-1) following incubation at 37.degree. C. for 2 hrs in A549 cells.
[0236] FIG. 42: A549 internalisation assay data for (A) 9G8 containing bispecifics and (B) 7C12 containing bispecifics by flow cytometry analysis at 4.degree. C. and 37.degree. C. Performed using an Attune N.times.T flow cytometer (ThermoFisher) and a PE-anti-Myc Ab (CST) to detect.
[0237] FIG. 43: (A) Down-regulation of ROR1 by B1hFc, hFc7C12 and B1hFc7C12; (B) Down-regulation of EGFR by B1hFc, hFc7C12 and B1hFc7C12. Cell surface expression of ROR1 or EGFR receptors was assessed using PE-ROR1 2A2 mAb (Biolegend) and PE-AY13 EGFR mAb (Biolegend), respectively. An Attune N.times.T flow cytometer (ThermoFisher) was used to perform the analyses. Data are presented as % of 0 h control levels.
[0238] FIG. 44: (A) Down-regulation of ROR1 by P3A1hFc, hFc7C12 and P3A1hFc7C12; (B) Down-regulation of EGFR by P3A1hFc, hFc7C12 and P3A1hFc7C12. Cell surface expression of ROR1 or EGFR receptors was assessed using PE-ROR1 2A2 mAb (Biolegend) and PE-AY13 EGFR mAb (Biolegend), respectively. An Attune N.times.T flow cytometer (ThermoFisher) was used to perform the analyses. Data are presented as % of 0 h control levels.
[0239] FIG. 45: (A) Down-regulation of ROR1 by D3D3hFc, hFc7C12 and D3D3hFc7C12; (B) Down-regulation of EGFR by D3D3hFc, hFc7C12 and D3D3hFc7C121. Cell surface expression of ROR1 or EGFR receptors was assessed using PE-ROR1 2A2 mAb (Biolegend) and PE-AY13 EGFR mAb (Biolegend), respectively. An Attune N.times.T flow cytometer (ThermoFisher) was used to perform the analyses. Data are presented as % of 0 h control levels.
[0240] FIG. 46: Examples of simultaneous ROR1 and EGFR binding of ROR1.times.EGFR bi-specific molecules using BLI. Constructs are shown to bind immobilised hROR1, which then in turn bind EGFR as it is passed over the sensor surface. Mono-specific ROR1 binding VNAR B1 does not contain an EGFR binding moiety, and so no additional increase in signal is observed when EGFR is flowed over the surface of the sensor.
[0241] In addition to the sequences mentioned the following sequences are expressly disclosed. Certain of these sequences relate to examples of molecules of the invention described herein:
TABLE-US-00012 SEQ ID NO: Sequence Name 111 7C12 hFc (S252C) 112 hFc (S252C) 7C12 113 B1 hFc (S252C) 7C12 114 P3A1 hFc (S252C) 7C12 115 D3D3 hFc (S252C) 7C12 116 B1-7C12 AAA his myc 117 B1-7C12 ACA his myc 118 7C12-B1 QASGA his myc 119 7C12-B1 QACGA his myc 120 B1-9G8 AAA his myc 121 9G8-B1 QASGA his myc 122 D3-7C12 AAA his myc 123 D3-7C12 ACA his myc 124 7C12-D3 QASGA his myc 125 7C12-D3 QACGA his myc 126 D3-9G8 AAA his myc 127 9G8-D3 QASGA his myc 128 D3D3-7C12 AAA his myc 129 D3D3-7C12 ACA his myc 130 7C12-D3D3 QASGA his myc 131 7C12-D3D3 QACGA his myc 132 P3A1-7C12 AAA his myc 133 P3A1-7C12 ACA his myc 134 7C12-P3A1 QASGA his myc 135 7C12-P3A1 QACGA his myc 136 2V-7C12 ACA his myc 137 7C12-2V QACGA his myc 138 2V-9G8 ACA his myc 139 9G8-2V QACGA his myc 140 7C12 AAA his myc 141 9G8 AAA his myc 142 B1 QASGA his myc 143 D3 QASGA his myc 144 D3-D3 QASGA his myc 145 P3A1 QASGA his myc 146 7C12 hFc (S252C) 147 hFc (S252C) 7C12 148 B1 hFc (S252C) 7C12 149 P3A1 hFc (S252C) 7C12 150 D3D3 hFc (S252C) 7C12 151 B1-7C12 152 7C12-B1 153 B1-9G8 154 9G8-B1 155 D3-7C12 156 7C12-D3 157 D3-9G8 158 9G8-D3 159 D3D3-7C12 160 7C12-D3D3 161 P3A1-7C12 162 7C12-P3A1 163 2V-7C12 164 7C12-2V 165 2V-9G8 166 9G8-2V 167 7C12 168 9G8 169 B1 170 D3 171 D3-D3 172 P3A1
DETAILED DESCRIPTION
[0242] The present invention generally relates to specific antigen binding molecules. Specifically, the invention provides immunoglobulin-like shark variable novel antigen receptors (VNARs) specific for receptor tyrosine kinase-like orphan receptor 1 (ROR1) and associated fusion proteins, chimeric antigen receptors, conjugates, and nucleic acids, as well as accompanying methods. The ROR1-specific VNAR domains are described herein as ROR1-specific antigen binding molecules.
[0243] The Novel or New antigen receptor (IgNAR) is an approximately 160 kDa homodimeric protein found in the sera of cartilaginous fish (Greenberg A. S., et al., Nature, 1995. 374(6518): p. 168-173, Dooley, H., et al, Mol. Immunol, 2003. 40(1): p. 25-33; Muller, M. R., et al., mAbs, 2012. 4(6): p. 673-685)). Each molecule consists of a single N-terminal variable domain (VNAR) and five constant domains (CNAR). The IgNAR domains are members of the immunoglobulin-superfamily. The VNAR is a tightly folded domain with structural and some sequence similarities to the immunoglobulin and T-cell receptor Variable domains and to cell adhesion molecules and is termed the VNAR by analogy to the N Variable terminal domain of the classical immunoglobulins and T Cell receptors. The VNAR shares limited sequence homology to immunoglobulins, for example 25-30% similarity between VNAR and human light chain sequences (Dooley, H. and Flajnik, M. F., Eur. J. Immunol., 2005. 35(3): p. 936-945).
[0244] Kovaleva M. et al Expert Opin. Biol. Ther. 2014. 14(10): p. 1527-1539 and Zielonka S. et al mAbs 2015. 7(1): p. 15-25 provided summaries of the structural characterization and generation of the VNARs which are hereby incorporated by reference.
[0245] The VNAR does not appear to have evolved from a classical immunoglobulin antibody ancestor. The distinct structural features of VNARs are the truncation of the sequences equivalent to the CDR2 loop present in conventional immunoglobulin variable domains and the lack of the hydrophobic VH/VL interface residues which would normally allow association with a light chain domain, which is not present in the IgNAR structure. Furthermore, unlike classical immunoglobulins some VNAR subtypes include extra cysteine residues in the CDR regions that are observed to form disulphide bridges in addition to the canonical Immunoglobulin superfamily bridge between the Cysteines in the Framework 1 and 3 regions N terminally adjacent to CDRs 1 and 3.
[0246] To date, there are three defined types of shark IgNAR known as I, II and III. These have been categorized based on the position of non-canonical cysteine residues which are under strong selective pressure and are therefore rarely replaced.
[0247] All three types have the classical immunoglobulin canonical cysteines at positions 35 and 107 (numbering as in Kabat, E. A. et al. Sequences of proteins of immunological interest. 5th ed. 1991, Bethesda: US Dept. of Health and Human Services, PHS, NIH) that stabilize the standard immunoglobulin fold, together with an invariant tryptophan at position 36. There is no defined CDR2 as such, but regions of sequence variation that compare more closely to TCR HV2 and HV4 have been defined in framework 2 and 3 respectively. Type I has germline encoded cysteine residues in framework 2 and framework 4 and an even number of additional cysteines within CDR3. Crystal structure studies of a Type I IgNAR isolated against and in complex with lysozyme enabled the contribution of these cysteine residues to be determined. Both the framework 2 and 4 cysteines form disulphide bridges with those in CDR3 forming a tightly packed structure within which the CDR3 loop is held tightly down towards the HV2 region. To date Type I IgNARs have only been identified in nurse sharks--all other elasmobranchs, including members of the same order have only Type II or variations of this type.
[0248] Type II IgNAR are defined as having a cysteine residue in CDR1 and CDR3 which form intramolecular disulphide bonds that hold these two regions in close proximity, resulting in a protruding CDR3 (FIG. 2) that is conducive to binding pockets or grooves. Type I sequences typically have longer CDR3s than type II with an average of 21 and 15 residues respectively. This is believed to be due to a strong selective pressure for two or more cysteine residues in Type I CDR3 to associate with their framework 2 and 4 counterparts. Studies into the accumulation of somatic mutations show that there are a greater number of mutations in CDR1 of type II than type I, whereas HV2 regions of Type I show greater sequence variation than Type II. This evidence correlates well with the determined positioning of these regions within the antigen binding sites.
[0249] A third IgNAR type known as Type III has been identified in neonates. This member of the IgNAR family lacks diversity within CDR3 due to the germline fusion of the D1 and D2 regions (which form CDR3) with the V-gene. Almost all known clones have a CDR3 length of 15 residues with little or no sequence diversity.
[0250] Another structural type of VNAR, termed type (IIb or IV), has only two canonical cysteine residues (in framework 1 and framework 3b regions). So far, this type has been found primarily in dogfish sharks (Liu, J. L., et al. Mol. Immunol. 2007. 44(7): p. 1775-1783; Kovalenko O. V., et al. J Biol Chem. 2013. 288(24): p. 17408-19) and was also isolated from semisynthetic V-NAR libraries derived from wobbegong sharks (Streltsov, V. A. et al. (2004) Proc. Natl. Acad. Sci. U.S.A. 101(34): p. 12444-12449).
[0251] It has been shown however specific VNARs isolated from synthetic libraries formed from the VNAR sequences can bind with high affinity to other proteins (Shao C. Y. et al. Mol Immunol. 2007. 44(4): p. 656-65; WO2014/173959) and that the IgNAR is part of the adaptive immune system as cartilaginous fish can be immunized with antigen and responsive IgNARs obtained that bind to the antigen (Dooley, H., et al, Mol. Immunol, 2003. 40(1): p. 25-33; WO2003/014161). It has been shown that the IgNAR has a mechanism for combinatorial joining of V like sequences with D and J sequences similar to that of immunoglobulins and the T cell receptor (summarized by Zielonka S. et al mAbs 2015. 7(1): p. 15-25).
[0252] The VNAR binding surface, unlike the variable domains in other natural immunoglobulins, derives from four regions of diversity: CDR1, HV2, HV4 and CDR3 (see also Stanfield, R. L., et al, Science, 2004. 305(5691): p. 1770-1773; Streltsov, V. A., et al, Protein Sci., 2005. 14(11): p. 2901-2909; Stanfield, R. L., et al., J Mol. Biol., 2007. 367(2): p. 358-372), joined by intervening framework sequences in the order: FW1-CDR1-FW2-HV2-FW3a-HV4-FW3b-CDR3-FW4. The combination of a lack of a natural light chain partner and lack of CDR2 make VNARs the smallest naturally occurring binding domains in the vertebrate kingdom.
[0253] The IgNAR shares some incidental features with the heavy chain only immunoglobulin (HCAb) found in camelidae (camels, dromedaries and llamas, Hamers-Casterman, C. et al. Nature, 1993. 363, 446-448; Wesolowski, J., et al., Med Microbiol Immunol, 2009. 198(3): p. 157-74) Unlike the IgNAR the HCAb is clearly derived from the immunoglobulin family and shares significant sequence homology to standard immunoglobulins. Importantly one key distinction of VNARs is that the molecule has not had at any point in its evolution a partner light chain, unlike classical immunoglobulins or the HCAbs. Flajnik M. F. et al PLoS Biol 2011. 9(8): e1001120 and Zielonka S. et al mAbs 2015. 7(1): p. 15-25 have commented on the similarities and differences between, and the possible and distinct evolutionary origins of, the VNAR and the immunoglobulin-derived VHH single binding domain from the camelids.
[0254] Although antibodies to ROR1 have been reported in the literature, the high sequence identity between the extracellular domain of human, mouse and rat ROR1 and between human ROR1 and ROR2 family members, means generating high affinity hROR1-specific binding agents is not trivial. Additionally, the large size of antibodies compromises their ability to penetrate into solid tumours and render regions of target proteins inaccessible due to steric factors, which can be particularly acute for cell-surface proteins where oligomerisation or receptor clustering is observed.
[0255] As a result, there is a need in the art for improved anti-ROR1 binding protein agents with different functional or physical characteristics or properties to antibodies and the development of therapeutics and diagnostic agents for malignancies associated with ROR1 expression. The present invention provides such agents in the form of the ROR1-specific antigen binding molecules described herein.
[0256] The presently-described ROR1-specific antigen binding molecules have been shown to bind to both human and murine ROR1. Furthermore, the ROR1-specific antigen binding molecules of the present invention bind to deglycosylated forms of ROR1 and do not bind to a number of linear peptides associated with anti-ROR1 antibodies described in the prior art. The presently-described ROR1-specific antigen binding molecules are therefore thought to bind to novel epitopes in the ROR1 sequence.
[0257] Binding of the ROR1-specific antigen binding molecules of the invention to cancer cell lines, as well as internalisation, have been demonstrated. This confirms the potential for the use of such molecules in the treatment of cancers, specifically cancers which express ROR1.
[0258] The epidermal growth factor receptor (EGFR) is a member of the ErbB family of receptor tyrosine kinases. It is a 170 kDa transmembrane protein composed of four extracellular domains, a transmembrane region, an intracellular tyrosine kinase domain and a carboxy-terminal tail. The normal function of EGFR relates to regulation of epithelial tissue development, but it is also associated with a number of pathological states. In particular, overexpression of EGFR has been associated with a number of cancers. Accordingly, it is an important drug target and many therapeutic approaches have been applied. In addition to a number of small molecule-based EGFR inhibitors, such as gefitinib, erlotinib, afatinib, brigatinib, icotinib, and osimertinib a number of antibodies to EGFR have been developed. Anti-EGFR antibodies cetuximab, panitumumab, zalutumumab, nimotuzumab, and matuzumab. These antibodies block the extracellular ligand binding domain, preventing ligand binding and subsequent activation of the tyrosine kinase domain. Single domain antibodies (sdAb) that show competitive binding with cetuximab or matuzumab have also been developed.
[0259] The present inventors have created a bi-specific antigen binding molecule based on an ROR1-specific VNAR and an EGFR binding molecule. Various forms of the ROR1-specific antigen binding molecules are described, including fusion proteins of several types, which may be used in the bi-specific antigen binding molecule Fusion proteins including an immunoglobulin Fc region are described, as well as both homo and heterodimers. Fusion of proteins to an Fc domain can improve protein solubility and stability, markedly increase plasma half-life and improve overall therapeutic effectiveness.
[0260] Surprisingly, the bi-specific antigen binding molecules described show marked improvement in binding and internalisation compared to the equivalent constituent molecules.
[0261] The present inventors have also, for the first time, created VNAR molecules conjugated to a variety of moieties and payloads. The present invention therefore also provides chemically conjugated VNARs. More specifically, ROR1-specific antigen molecules in several conjugated formats are provided. Such molecules may be included in the bi-specific antigen binding molecules described. Furthermore, there are provided herein bi-specific ROR1/EGFR-specific antigen molecules chemically conjugated to various payloads in various formats. Specifically, the present inventors have provided ROR1/EGFR bi-specific recombinant fusion proteins which include an Fc region, in which conjugates are provided via the Fc region. In specific examples, the S239C or S442C mutations (EU numbering, equivalent to S252C and S473C in Kabat numbering) in the Fc domain are used as conjugation sites. Bi-specific ROR1/EGFR-specific antigen molecules have also been generated appended with short cysteine containing tag sequences to facilitate conjugation with thiol reactive payloads and labels.
[0262] Furthermore, the inventors have found that, surprisingly, the increase in binding to A549 cells and PA1 cells is observed dependent on the orientation of the EGFR binding domain (9G8 or 7C12) with respect to the ROR1 binding agent. When the EGFR binding agent is fused C-terminal to the ROR1 binding agent the cell-surface binding is compromised as compared to the same construct but with the EGFR binding agent fused N-terminal to the ROR1 binding agent. Changing the orientation of the domains within the construct therefore provides a method for altering the apparent affinity of the bi-specific agent to the cell-surface.
[0263] A similar surprising observation was within the context of Fc fusion proteins (FIG. 38). When the EGFR binding agent 7C12 was fused to the C-terminus of the Fc fragment (hFc 7C12) the binding to the EGFR+ve cell-lines A549, PA-1 and A427 was consistently lower as compared to the corresponding N-terminal fusion (7C12 hFc). Thereby, enabling the cell-surface binding characteristics of ROR1-EGFR bispecific binding agents to be modulated through appropriate design of the corresponding Fc fusion proteins.
[0264] Definitions
[0265] An antigen specific binding molecule of the invention comprises amino acid sequence derived from a synthetic library of VNAR molecules, or from libraries derived from the immunization of a cartilaginous fish. The terms VNAR, IgNAR and NAR may be used interchangeably also.
[0266] Amino acids are represented herein as either a single letter code or as the three-letter code or both.
[0267] The term "affinity purification" means the purification of a molecule based on a specific attraction or binding of the molecule to a chemical or binding partner to form a combination or complex which allows the molecule to be separated from impurities while remaining bound or attracted to the partner moiety.
[0268] The term "Complementarity Determining Regions" or CDRs (i.e., CDR1 and CDR3) refers to the amino acid residues of a VNAR domain the presence of which are typically involved in antigen binding. Each VNAR typically has two CDR regions identified as CDR1 and CDR3. Additionally, each VNAR domain comprises amino acids from a "hypervariable loop" (HV), which may also be involved in antigen binding. In some instances, a complementarity determining region can include amino acids from both a CDR region and a hypervariable loop. In other instances, antigen binding may only involve residues from a single CDR or HV. According to the generally accepted nomenclature for VNAR molecules, a CDR2 region is not present.
[0269] "Framework regions" (FW) are those VNAR residues other than the CDR residues. Each VNAR typically has five framework regions identified as FW1, FW2, FW3a, FW3b and FW4.
[0270] The boundaries between FW, CDR and HV regions in VNARs are not intended to be fixed and accordingly some variation in the lengths and compositions of these regions is to be expected. This will be understood by those skilled in the art, particularly with reference to work that have been carried out in analyzing these regions. (Anderson et al., PLoS ONE (2016) 11 (8); Lui et al., Mol Immun (2014) 59, 194-199; Zielonka et al., Mar Biotechnol (2015). 17, (4) 386-392; Fennell et al., J Mol Biol (2010) 400. 155-170; Kovalenko et al., J Biol Chem (2013) 288. 17408-17419; Dooley et al., (2006) PNAS 103 (6). 1846-1851). The molecules of the present invention, although defined by reference to FW, CDR and HV regions herein, are not limited to these strict definitions. Variation in line with the understanding in the art as the structure of the VNAR domain is therefore expressly contemplated herein.
[0271] A "codon set" refers to a set of different nucleotide triplet sequences used to encode desired variant amino acids. A set of oligonucleotides can be synthesized, for example, by solid phase synthesis, including sequences that represent all possible combinations of nucleotide triplets provided by the codon set and that will encode the desired group of amino acids. A standard form of codon designation is that of the IUB code, which is known in the art and described herein.
[0272] A codon set is typically represented by 3 capital letters in italics, e.g. NNK, NNS, XYZ, DVK etc. A "non-random codon set" therefore refers to a codon set that encodes select amino acids that fulfill partially, preferably completely, the criteria for amino acid selection as described herein. Synthesis of oligonucleotides with selected nucleotide "degeneracy" at certain positions is well known in that art, for example the TRIM approach (Knappek et al.; J. Mol. Biol. (1999), 296, 57-86); Garrard & Henner, Gene (1993), 128, 103). Such sets of oligonucleotides having certain codon sets can be synthesized using commercial nucleic acid synthesizers (available from, for example, Applied Biosystems, Foster City, Calif.), or can be obtained commercially (for example, from Life Technologies, Rockville, Md.). A set of oligonucleotides synthesized having a particular codon set will typically include a plurality of oligonucleotides with different sequences, the differences established by the codon set within the overall sequence. Oligonucleotides used according to the present invention have sequences that allow for hybridization to a VNAR nucleic acid template and also may where convenient include restriction enzyme sites.
[0273] "Cell", "cell line", and "cell culture" are used interchangeably (unless the context indicates otherwise) and such designations include all progeny of a cell or cell line. Thus, for example, terms like "transformants" and "transformed cells" include the primary subject cell and cultures derived therefrom without regard for the number of transfers. It is also understood that all progeny may not be precisely identical in DNA content, due to deliberate or inadvertent mutations. Mutant progeny that have the same function or biological activity as screened for in the originally transformed cell are included.
[0274] "Control sequences" when referring to expression means DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism. The control sequences that are suitable for prokaryotes, for example, include a promoter, optionally an operator sequence, a ribosome binding site, etc. Eukaryotic cells use control sequences such as promoters, polyadenylation signals, and enhancers.
[0275] The term "coat protein" means a protein, at least a portion of which is present on the surface of the virus particle. From a functional perspective, a coat protein is any protein which associates with a virus particle during the viral assembly process in a host cell and remains associated with the assembled virus until it infects another host cell.
[0276] The "detection limit" for a chemical entity in a particular assay is the minimum concentration of that entity which can be detected above the background level for that assay. For example, in the phage ELISA, the "detection limit" for a particular phage displaying a particular antigen binding fragment is the phage concentration at which the particular phage produces an ELISA signal above that produced by a control phage not displaying the antigen binding fragment.
[0277] A "fusion protein" and a "fusion polypeptide" refer to a polypeptide having two portions covalently linked together, where each of the portions is a polypeptide having a different property. The property may be a biological property, such as activity in vitro or in vivo. The property may also be a simple chemical or physical property, such as binding to a target antigen, catalysis of a reaction, etc. The two portions may be linked directly by a single peptide bond or through a peptide linker containing one or more amino acid residues. Generally, the two portions and the linker will be in reading frame with each other. Preferably, the two portions of the polypeptide are obtained from heterologous or different polypeptides.
[0278] The term "fusion protein" in this text means, in general terms, one or more proteins joined together by chemical means, including hydrogen bonds or salt bridges, or by peptide bonds through protein synthesis or both. Typically, fusion proteins will be prepared by DNA recombination techniques and may be referred to herein as recombinant fusion proteins.
[0279] "Heterologous DNA" is any DNA that is introduced into a host cell. The DNA may be derived from a variety of sources including genomic DNA, cDNA, synthetic DNA and fusions or combinations of these. The DNA may include DNA from the same cell or cell type as the host or recipient cell or DNA from a different cell type, for example, from an allogenic or xenogenic source. The DNA may, optionally, include marker or selection genes, for example, antibiotic resistance genes, temperature resistance genes, etc.
[0280] A "highly diverse position" refers to a position of an amino acid located in the variable regions of the light and heavy chains that have a number of different amino acid represented at the position when the amino acid sequences of known and/or naturally occurring antibodies or antigen binding fragments are compared. The highly diverse positions are typically in the CDR or HV regions.
[0281] "Identity" describes the relationship between two or more polypeptide sequences or two or more polynucleotide sequences, as determined by comparing the sequences. Identity also means the degree of sequence relatedness (homology) between polypeptide or polynucleotide sequences, as the case may be, as determined by the match between strings of such sequences. While there exist a number of methods to measure identity between two polypeptide or two polynucleotide sequences, methods commonly employed to determine identity are codified in computer programs. Preferred computer programs to determine identity between two sequences include, but are not limited to, GCG program package (Devereux, et al., Nucleic acids Research, 12, 387 (1984), BLASTP, BLASTN, and FASTA (Atschul et al., J. Molec. Biol. (1990) 215, 403).
[0282] Preferably, the amino acid sequence of the protein has at least 45% identity, using the default parameters of the BLAST computer program (Atschul et al., J. Mol. Biol. (1990) 215, 403-410) provided by HGMP (Human Genome Mapping Project), at the amino acid level, to the amino acid sequences disclosed herein.
[0283] More preferably, the protein sequence may have at least 45%, 46%, 47%, 48%, 49%, 50%, 55%, 60%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 90% and still more preferably 95% (still more preferably at least 96%, 97%, 98% or 99%) identity, at the nucleic acid or amino acid level, to the amino acid sequences as shown herein.
[0284] The protein may also comprise a sequence which has at least 45%, 46%, 47%, 48%, 49%, 50%, 50%, 55%, 60%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity with a sequence disclosed herein, using the default parameters of the BLAST computer program provided by HGMP, thereto
[0285] A "library" refers to a plurality of VNARs or VNAR fragment sequences (for example, polypeptides of the invention), or the nucleic acids that encode these sequences, the sequences being different in the combination of variant amino acids that are introduced into these sequences according to the methods of the invention.
[0286] "Ligation" is the process of forming phosphodiester bonds between two nucleic acid fragments. For ligation of the two fragments, the ends of the fragments must be compatible with each other. In some cases, the ends will be directly compatible after endonuclease digestion. However, it may be necessary first to convert the staggered ends commonly produced after endonuclease digestion to blunt ends to make them compatible for ligation. For blunting the ends, the DNA is treated in a suitable buffer for at least 15 minutes at 15.degree. C. with about 10 units of the Klenow fragment of DNA polymerase I or T4 DNA polymerase in the presence of the four deoxyribonucleotide triphosphates. The DNA is then purified by phenol-chloroform extraction and ethanol precipitation or by silica purification. The DNA fragments that are to be ligated together are put in solution in about equimolar amounts. The solution will also contain ATP, ligase buffer, and a ligase such as T4 DNA ligase at about 10 units per 0.5 .mu.g of DNA. If the DNA is to be ligated into a vector, the vector is first linearized by digestion with the appropriate restriction endonuclease(s). The linearized fragment is then treated with bacterial alkaline phosphatase or calf intestinal phosphatase to prevent self-ligation during the ligation step.
[0287] A "mutation" is a deletion, insertion, or substitution of a nucleotide(s) relative to a reference nucleotide sequence, such as a wild type sequence.
[0288] "Natural" or "naturally occurring" VNARs, refers to VNARs identified from a non-synthetic source, for example, from a tissue source obtained ex vivo, or from the serum of an animal of the Elasmobranchii subclass. These VNARs can include VNARs generated in any type of immune response, either natural or otherwise induced. Natural VNARs include the amino acid sequences, and the nucleotide sequences that constitute or encode these antibodies. As used herein, natural VNARs are different than "synthetic VNARs", synthetic VNARs referring to VNAR sequences that have been changed from a source or template sequence, for example, by the replacement, deletion, or addition, of an amino acid, or more than one amino acid, at a certain position with a different amino acid, the different amino acid providing an antibody sequence different from the source antibody sequence.
[0289] The term "nucleic acid construct" generally refers to any length of nucleic acid which may be DNA, cDNA or RNA such as mRNA obtained by cloning or produced by chemical synthesis. The DNA may be single or double stranded. Single stranded DNA may be the coding sense strand, or it may be the non-coding or anti-sense strand. For therapeutic use, the nucleic acid construct is preferably in a form capable of being expressed in the subject to be treated.
[0290] "Operably linked" when referring to nucleic acids means that the nucleic acids are placed in a functional relationship with another nucleic acid sequence. For example, DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promotor or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation. Generally, "operably linked" means that the DNA sequences being linked are contiguous and, in the case of a secretory leader, contingent and in reading frame. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adapters or linkers are used in accord with conventional practice.
[0291] The term "protein" means, in general terms, a plurality of amino acid residues joined together by peptide bonds. It is used interchangeably and means the same as peptide, oligopeptide, oligomer or polypeptide, and includes glycoproteins and derivatives thereof. The term "protein" is also intended to include fragments, analogues, variants and derivatives of a protein wherein the fragment, analogue, variant or derivative retains essentially the same biological activity or function as a reference protein. Examples of protein analogues and derivatives include peptide nucleic acids, and DARPins (Designed Ankyrin Repeat Proteins).
[0292] A fragment, analogue, variant or derivative of the protein may be at least 25 preferably 30 or 40, or up to 50 or 100, or 60 to 120 amino acids long, depending on the length of the original protein sequence from which it is derived. A length of 90 to 120, 100 to 110 amino acids may be convenient in some instances.
[0293] The fragment, derivative, variant or analogue of the protein may be (i) one in which one or more of the amino acid residues are substituted with a conserved or non-conserved amino acid residue (preferably, a conserved amino acid residue) and such substituted amino acid residue may or may not be one encoded by the genetic code, or (ii) one in which one or more of the amino acid residues includes a substituent group, or (iii) one in which the additional amino acids are fused to the mature polypeptide, such as a leader or auxiliary sequence which is employed for purification of the polypeptide. Such fragments, derivatives, variants and analogues are deemed to be within the scope of those skilled in the art from the teachings herein.
[0294] "Oligonucleotides" are short-length, single- or double-stranded polydeoxynucleotides that are chemically synthesized by known methods (such as phosphotriester, phosphite, or phosphoramidite chemistry, using solid-phase techniques). Further methods include the polymerase chain reaction (PCR) used if the entire nucleic acid sequence of the gene is known, or the sequence of the nucleic acid complementary to the coding strand is available. Alternatively, if the target amino acid sequence is known, one may infer potential nucleic acid sequences using known and preferred coding residues for each amino acid residue. The oligonucleotides can be purified on polyacrylamide gels or molecular sizing columns or by precipitation. DNA is "purified" when the DNA is separated from non-nucleic acid impurities (which may be polar, non-polar, ionic, etc.).
[0295] A "source" or "template" VNAR, as used herein, refers to a VNAR or VNAR antigen binding fragment whose antigen binding sequence serves as the template sequence upon which diversification according to the criteria described herein is performed. An antigen binding sequence generally includes within a VNAR preferably at least one CDR, preferably including framework regions.
[0296] A "transcription regulatory element" will contain one or more of the following components: an enhancer element, a promoter, an operator sequence, a repressor gene, and a transcription termination sequence.
[0297] "Transformation" means a process whereby a cell takes up DNA and becomes a "transformant". The DNA uptake may be permanent or transient. A "transformant" is a cell which has taken up and maintained DNA as evidenced by the expression of a phenotype associated with the DNA (e.g., antibiotic resistance conferred by a protein encoded by the DNA).
[0298] A "variant" or "mutant" of a starting or reference polypeptide (for example, a source VNAR or a CDR thereof), such as a fusion protein (polypeptide) or a heterologous polypeptide (heterologous to a phage), is a polypeptide that (1) has an amino acid sequence different from that of the starting or reference polypeptide and (2) was derived from the starting or reference polypeptide through either natural or artificial mutagenesis. Such variants include, for example, deletions from, and/or insertions into and/or substitutions of, residues within the amino acid sequence of the polypeptide of interest. For example, a fusion polypeptide of the invention generated using an oligonucleotide comprising a nonrandom codon set that encodes a sequence with a variant amino acid (with respect to the amino acid found at the corresponding position in a source VNAR or antigen binding fragment) would be a variant polypeptide with respect to a source VNAR or antigen binding fragment. Thus, a variant CDR refers to a CDR comprising a variant sequence with respect to a starting or reference polypeptide sequence (such as that of a source VNAR or antigen binding fragment). A variant amino acid, in this context, refers to an amino acid different from the amino acid at the corresponding position in a starting or reference polypeptide sequence (such as that of a source VNAR or antigen binding fragment). Any combination of deletion, insertion, and substitution may be made to arrive at the final variant or mutant construct, provided that the final construct possesses the desired functional characteristics. The amino acid changes also may alter post-translational processes of the polypeptide, such as changing the number or position of glycosylation sites.
[0299] A "wild-type" or "reference" sequence or the sequence of a "wild-type" or "reference" protein/polypeptide, such as a coat protein, or a CDR of a source VNAR, may be the reference sequence from which variant polypeptides are derived through the introduction of mutations. In general, the "wild-type" sequence for a given protein is the sequence that is most common in nature. Similarly, a "wild-type" gene sequence is the sequence for that gene which is most commonly found in nature. Mutations may be introduced into a "wild-type" gene (and thus the protein it encodes) either through natural processes or through man induced means. The products of such processes are "variant" or "mutant" forms of the original "wild-type" protein or gene.
[0300] The term "chimeric antigen receptors (CARs)," as used herein, may refer to artificial T-cell receptors, chimeric T-cell receptors, or chimeric immunoreceptors, for example, and encompass engineered receptors that graft an artificial specificity onto a particular immune effector cell. CARs may be employed to impart the specificity of an antigen-specific binding protein, such as a monoclonal antibody or VNAR, onto a T cell, thereby allowing a large number of specific T cells to be generated, for example, for use in adoptive cell therapy. CARs may direct the specificity of the cell to a tumour associated antigen, for example. CARs may comprise an intracellular activation domain, a transmembrane domain, and an extracellular domain comprising a tumour associated antigen binding region. In particular aspects, CARs comprise fusions of single-chain variable fragments (scFv) derived from monoclonal antibodies fused to CD3-zeta transmembrane and endodomains. In other particular aspects, CARs comprise fusions of the VNAR domains described herein with CD3-zeta transmembrane and endodomains. The specificity of other CAR designs may be derived from ligands of receptors (e.g., peptides) or from pattern-recognition receptors, such as Dectins. In particular embodiments, one can target malignant B cells by redirecting the specificity of T cells by using a CAR specific for the B-lineage molecule, CD 19. In certain cases, the spacing of the antigen-recognition domain can be modified to reduce activation-induced cell death. In certain cases, CARs comprise domains for additional co-stimulatory signalling, such as CD3-zeta, FcR, CD27, CD28, CD 137, DAP 10, and/or OX40. In some cases, molecules can be co-expressed with the CAR, including co-stimulatory molecules, reporter genes for imaging (e.g., for positron emission tomography), gene products that conditionally ablate the T cells upon addition of a pro-drug, homing receptors, chemokines, chemokine receptors, cytokines, and cytokine receptors.
[0301] The term "conjugation" as used herein may refer to any method of chemically linking two or more chemical moieties. Typically, conjugation will be via covalent bond. In the context of the present invention, at least one of the chemical moieties will be a polypeptide and in some cases the conjugation will involve two or more polypeptides, one or more of which may be generated by recombinant DNA technology. A number of systems for conjugating polypeptides are known in the art. For example, conjugation can be achieved through a lysine residue present in the polypeptide molecule using N-hydroxy-succinimide or through a cysteine residue present in the polypeptide molecule using maleimidobenzoyl sulfosuccinimide ester. In some embodiments, conjugation occurs through a short-acting, degradable linkage including, but not limited to, physiologically cleavable linkages including ester, carbonate ester, carbamate, sulfate, phosphate, acyloxyalkyl ether, acetal, and ketal, hydrazone, oxime and disulphide linkages. In some embodiments linkers that are cleavable by intracellular or extracellular enzymes, such as cathepsin family members, cleavable under reducing conditions or acidic pH are incorporated to enable releases of conjugated moieties from the polypeptide or protein to which it is conjugated.
[0302] A particularly preferred method of conjugation is the use of intein-based technology (US2006247417) Briefly, the protein of interest is expressed as an N terminal fusion of an engineered intein domain (Muir 2006 Nature 442, 517-518). Subsequent N to S acyl shift at the protein-intein union results in a thioester linked intermediate that can be chemically cleaved with bis-aminoxy agents or amino-thiols to give the desired protein C-terminal aminoxy or thiol derivative, respectively (FIG. 11). These C-terminal aminoxy and thiol derivatives can be reacted with aldehyde/ketone and maleimide functionalised moieties, respectively, in a chemoselective fashion to give the site-specific C-terminally modified protein (FIGS. 25-27).
[0303] In another preferred method of conjugation, the VNARs are directly expressed with an additional cysteine at or near the C-terminal region of the VNAR or incorporated within a short C-terminal tag sequence enabling conjugation with thiol reactive payloads such as maleimide functionalised moieties.
[0304] Conjugation as referred to herein is also intended to encompass the use of a linker moiety, which may impart a number of useful properties. Linker moieties include, but are not limited to, peptide sequences such as poly-glycine, gly-ser, val-cit or val-ala. In certain cases, the linker moiety may be selected such that it is cleavable under certain conditions, for example via the use of enzymes, nucleophilic/basic reagents, reducing agents, photo-irradiation, electrophilic/acidic reagents, organometallic and metal reagents, or oxidizing reagents, or the linker may be specifically selected to resist cleavage under such conditions.
[0305] Polypeptides may be conjugated to a variety of functional moieties in order to achieve a number of goals. Examples of functional moieties include, but are not limited to, polymers such as polyethylene glycol in order to reduce immunogenicity and antigenicity or to improve solubility. Further non-limiting examples include the conjugation of a polypeptide to a therapeutic agent or a cytotoxic agent.
[0306] The term "detectable label" is used herein to specify that an entity can be visualized or otherwise detected by spectroscopic, photochemical, biochemical, immunochemical, electrical, optical, chemical or other means. The detectable label may be selected such that it generates a signal which can be measured and whose intensity is proportional to the amount of bound entity. A wide variety of systems for labelling and/or detecting proteins and peptides are known in the art. A label may be directly detectable (i.e., it does not require any further reaction or manipulation to be detectable, e.g., a fluorophore is directly detectable) or it may be indirectly detectable (i.e., it is made detectable through reaction or binding with another entity that is detectable, e.g., a hapten is detectable by immunostaining after reaction with an appropriate antibody comprising a reporter such as a fluorophore). Suitable detectable agents include, but are not limited to, radionuclides, fluorophores, chemiluminescent agents, microparticles, enzymes, colorimetric labels, magnetic labels, haptens, molecular beacons, and aptamer beacons.
[0307] Methods of killing or inhibiting the growth of a cells expressing ROR1 in vitro or in a patient are contemplated herein, In general, them "killing" as used herein in the context of cells means causing a cell death. This may be achieved by a number of mechanisms, such as necrosis or other cells injury, or the induction of apoptosis. The phrases "inhibiting the growth" or "inhibiting proliferation" when used herein are intended to encompass the prevention of cell development, more specifically the prevention of cell division.
[0308] The present invention will be further understood by reference to the following examples.
EXAMPLES
Example 1
Generation of Specific Anti-ROR1 VNAR Sequences
[0309] Specific VNAR Sequences from Synthetic Library
[0310] Two selection campaigns were adopted for screening a VNAR synthetic domain library (WO2014173959) for specific ROR1 binders. The first campaign made use of human ROR1 antigen and the second used mouse ROR1 antigen. Both recombinant ROR1 proteins were biotinylated as per manufacturer's instructions (Thermo Scientific Sulfo-NHS-LC-Biotin protocol, Cat N 21327) to aid the antigen presentation and selection process. VNAR domains were isolated after 3 rounds of selection using these biotinylated ROR1 antigens immobilised on streptavidin-coated beads. Post selection and following the screening of individual clones, 70% of monoclonal phage displaying VNAR domains (selected against human ROR1 protein) were found to be specific to human and mouse ROR1, but not a closely related ROR2 protein (the lead clones from this selection were called B1--40% and E7--30% (FIG. 1). Similarly, 45% of monoclonal phage selected with mouse ROR1 were specific to human and mouse ROR1, but not ROR2 (lead clone from this selection was called P3A1, FIG. 1). Another specific clone obtained from mouse ROR1 screening was CPF7 which was present as a single sequence out of 200 screened clones.
[0311] The sequences obtained from screening with human ROR1 are B1 and E7, and from screening with mouse ROR1 is P3A1 and CPF7. (FIG. 2)
[0312] Specific VNAR Sequences from Immunised Libraries
[0313] Libraries Construction.
[0314] Three spiny dogfish were immunised with extracellular domain of recombinant human ROR1 protein and a target-specific IgNAR immune response was monitored through the analysis of post-immunised sera as described in Muller M. R. et al. Generation and Isolation of Target-Specific Single-Domain Antibodies from Shark Immune Repertoires, Humana Press 2012. Sera samples pre- and post-immunisation were taken from animals and tested for antigen binding in ELISA. An IgNAR titre increase, specific for human ROR1, was observed after 16 weeks in all animals (FIG. 3). The specificity of post-immune sera to mouse ROR1 was also observed indicating the presence in immunised animals of species cross-reactive ROR1 specific IgNAR binders (FIG. 3).
[0315] The VNAR repertoire (binding sites of IgNAR) was amplified from dogfish blood using specific PCR primers and cloned into a phage display vector, which contained an in-frame coat protein pill of the bacteriophage M13 gene as described in Muller M.R. et al. Generation and Isolation of Target-Specific Single-Domain Antibodies from Shark Immune Repertoires, Humana Press 2012. The library sizes were calculated and are shown in Table 1:
TABLE-US-00013 TABLE 1 Fish # Library Size (unique transformants) 154 ELSI 5 6 .times. 107 156 ELSI 6 1.7 .times. 107.sup. 161 ELSI 7 2 .times. 107
[0316] Screening of the Immunised Libraries for Antigen Specific VNAR Sequences.
[0317] Recombinant mouse ROR1 protein was used for screening the immunised libraries (ELSI 5-7). Following a protocol similar to that used to screen the synthetic library, VNAR domains were isolated after 3 rounds of selection using biotinylated ROR1 antigen immobilised on streptavidin-coated beads. Following the selection process, 45% of monoclonal phage displaying a VNAR domain (from the combined output from the 3 libraries) was specific to human and mouse ROR1. One third of the ROR1 specific VNAR were found to have the sequence D3 (FIGS. 4 and 5) and the remaining two thirds--to the sequence E9 (FIGS. 4 and 5).
[0318] The sequences obtained from screening with mouse ROR1 are E9 and D3. (FIG. 5)
[0319] All lead anti-ROR1 VNAR proteins were expressed in TG1 E. coli or HEK293 mammalian cells and IMAC purified from the periplasmic fraction or the cell supernatant, respectively.
[0320] Methods
[0321] IgNAR Titre in Sera ELISA
[0322] ELISA were carried out using the following protocol:
[0323] 1. Coat an ELISA plate with 100 .mu.l/well of 1 mg/ml of human ROR1-Fc or mouse ROR1-Fc in or PBS. Incubate at 4.degree. C. overnight.
[0324] 2. Wash plates 3.times. with PBST.
[0325] 3. Block plates by adding 200 .mu.l/well 2% (w/v) M-PBS and incubate at 37.degree. C. for 1 h.
[0326] 4. Wash plates 3.times. with PBST.
[0327] 5. Serially dilute dogfish sera in PBS from no less than 1:10 up to 1:1000 and add 100 .mu.l/well. Incubate at room temperature for 1 h.
[0328] 6. Wash plates 3.times. with PBST.
[0329] 7. Add 100 .mu.l/well primary antibody (mouse monoclonal anti-IgNAR antibody, GA8) diluted as hybridoma tissue culture supernatant in PBST.
[0330] 8. Wash plates 3.times. with PBST.
[0331] 9. Add 100 .mu.l/well of a suitable secondary anti-mouse IgG HRP conjugate diluted in PBS. Incubate for 1 h.
[0332] 10. Wash plates 2.times. with PBST followed by 2.times. with PBS.
[0333] 11. Add 100 .mu.l/well of TMB substrate to the plate and incubate until the appearance of signal/onset of saturation. Stop the colour development by adding 100 .mu.l/well of 0.18 M H.sub.2SO.sub.4.
[0334] 12. Read at 450 nm with a microtiter plate reader.
[0335] Library Screening
[0336] 1. To rescue library phage for selections, cultures from library glycerol stocks were grown at 37.degree. C. and 250 rpm, in 2.times.TY, 2% glucose, 100 .mu.g/ml ampicillin to an OD600 of 0.5.
[0337] 2. Cells were super-infected with 109 M13K07 helper phage (NEB) and then incubated overnight in 2.times.TY, 100 .mu.g/ml ampicillin, 50 .mu.g/ml kanamycin at 25.degree. C. and 250 rpm.
[0338] 3. The phage was PEG-precipitated (20% PEG/2.5 M NaCl) twice from the bacterial culture and the resulting phage pellets were resuspended in 1 ml PBS.
[0339] 4. 200 .mu.l of Dynabeads M-280 Streptavidin (Invitrogen #11205D), pre-blocked with 2% (w/v) MPBS, were coated with 400 nM biotinylated mouse ROR1 rotating at 20 rpm, at room temperature for 1 h.
[0340] 5. Library phage was de-selected by incubation with Dynabeads for 1 h rotating at room temperature and then added to the antigen-coated beads.
[0341] 6. Beads were washed 5-10 times with PBST and 5-10 times with PBS, eluted by rotating for 8 min in 400 .mu.l 100 mM TEA and neutralised by the addition of 200 .mu.l 1 M Tris-HCl pH 7.5.
[0342] 7. E. coli TG1 cells (10 ml) were infected with 300 .mu.l of eluted phage for 30 min at 37.degree. C. and grown overnight at 37.degree. C. on TYE agar plates containing 2% (w/v) glucose and 100 .mu.g/ml ampicillin.
[0343] 8. Three further rounds of selection were conducted and outputs were screened for antigen-specific binding by monoclonal phage and periplasmic extract ELISAs against human or mouse ROR1. Phage binders were detected using HRP-conjugated anti-M13 antibody (GE Healthcare, 27942101) and periplasmic protein was detected using HRP-conjugated anti-c-Myc antibody (Roche, 118 141 50 001).
[0344] VNAR Expression in E. coli
[0345] 1. Dilute the overnight culture 1:50 in TB media with phosphate salts, 1% glucose, 100 ug/ml Ampicillin and incubate at 37.degree. C. with vigorous shaking (250 rpm) all day.
[0346] 2. Pellet the cells by centrifugation at 3,000.times.g for 20 min at 20.degree. C.
[0347] 3. Re-suspend the cells in the same volume of TB media with phosphate salts, 100 ug/ml Ampicillin (no glucose).
[0348] 4. Add IPTG to a final concentration of 1 mM IPTG and incubate at 16.degree. C. overnight (16 h) with shaking at 250 rpm.
[0349] 5. Collect the cells by centrifugation at 6,000.times.g for 30 min (the pellet could be frozen at this point at -20.degree. C.).
[0350] 6. Re-suspend the pellet in 10% culture volume ice-cold TES and shake gently on ice for 15 min.
[0351] 7. Add an equal volume ice-cold 5 mM MgSO4 (for 2.5 mM final concentration of MgSO.sub.4) and continue shaking gently on ice for a further 15 min.
[0352] 8. Pellet the suspension by centrifugation at 15,000.times.g for 30 min at 4.degree. C. and carefully decant the supernatant containing released periplasmic proteins into a clean falcon.
[0353] 9. Add 10.times. PBS pH 7.4 [final concentration of 1.times. PBS] to peri-prep extract prior to IMAC incubation.
[0354] VNAR Expression in HEK293
[0355] 10 .mu.g DNA in water (sterile filtrated) for 10 ml culture.
[0356] Use 10 ml of cells (.about.106/ml) in a 50 ml bioreactor tube (exponentially growing cells in fresh media)
[0357] Add OptiMEM media to DNA to a total volume of 500 .mu.l.
[0358] Add 25 .mu.l of PEI (1 mg/ml stock made up in water) to a separate 500 .mu.l OptiMEM media.
[0359] Incubated DNA and PEI at room temperature for up to 15 min.
[0360] Mix 500 .mu.l of PEI in media to each 500 .mu.l of DNA in media.
[0361] Incubated at room temperature for 20-30 min facilitating complex formation.
[0362] Add 1 ml of mixture to the cells and incubate at 37.degree. C., 5% CO.sub.2 sharking 140 rpm.
[0363] Next day feed cells by addition of 250 .mu.l of 20% (w/v) tryptone to 10 ml of cells to obtain the final concentration of tryptone 0.5%
[0364] Leave cells to express for 3-5 days.
[0365] Spin the cells and assess supernatant for secreted protein to determine productivity.
[0366] Add 10.times. PBS pH 7.4 [final concentration of 1.times. PBS] to peri-prep extract prior to IMAC incubation.
[0367] This protocol can be scaled up or down as required for protein production.
[0368] Protein Expression (Scale Up)
[0369] ROR1 binding VNAR proteins expressed well in many different forms in several different expression systems. The addition of standard C terminal tags, including His and His.sub.6Myc, to aid protein purification, handling and protein analysis, did not affect the binding of ROR1 VNARs to target ROR1 (Table 2).
TABLE-US-00014 TABLE 2 SPR data for binding of VNARs with different C-terminal tags to human ROR1 and ROR2 hROR1 VNAR C-terminal tag Ka (M.sup.-1s.sup.-1) Kd (s.sup.-1) K.sub.D (nM) hROR2 B1 6xHis 2.33E+06 1.91E-04 0.11 No binding 6xHis myc 7.47E+05 6.09E-04 0.83 No binding P3A1 6xHis 2.92E+06 2.06E-02 7.8 No binding 6xHis myc 9.8E+05 2.5E-02 25.6 No binding P3A1 dimer No tag 1.67E+06 5.98E-04 0.36 No binding 6xHis myc 2.08E+06 6.37E-04 0.35 No binding
[0370] In addition, VNAR C-terminal tags do not affect VNAR structure as measured by circular dichroism (FIG. 6--CD spectra of VNARs) (Glasgow University, UK).
[0371] VNARs were also expressed genetically fused to mouse and human IgG Fc sequences, and as N-terminal fusions to engineered inteins, enabling site specific conjugation to labels and drugs. Expression systems used include E. coli (periplasmic and cytoplasmic expression), HEK 293 and CHO (Evitria Fc fusion proteins).
Example 2
VNAR Reformatting
[0372] Homodimers
[0373] ROR1 binding VNARs were successfully reformatted into homodimers by genetic fusion using standard GlySer based linkers (FIG. 7B). Homodimers were shown to have increased affinity for recombinant hROR1 by SPR and ELISA, and increased binding to cell surface ROR1 on ROR1 positive cancer cell lines by flow cytometry (FIG. 9). Flow cytometry experiments are described in more detail in Example 4.
[0374] In addition, ROR1 binding VNAR homodimers were successfully generated through chemical conjugation. VNARs were expressed as intein fusion proteins and cleaved with cysteamine to generate C-terminal thiol derivatives, which then self-associated into homodimers via C terminal intermolecular disulphide formation (FIG. 7C). These disulphide-linked homodimers showed increased binding affinity to recombinant hROR1 by ELISA (FIG. 8). Production of intein fusion proteins is discussed in more detail in Example 8.
[0375] Heterodimers
[0376] ROR1 binding VNAR heterodimers were generated by genetic fusion with standard GlySer linkers (FIG. 7D) and demonstrated high affinity specific binding to recombinant ROR1 and ROR1 positive cells. Heterodimeric VNAR proteins can also be generated by chemical conjugation.
[0377] Results for binding characterisation experiments are tabulated in Table 3 and 4 (see Example 3).
[0378] VNAR Fc Fusion Proteins
[0379] Fusion of proteins to an Fc domain can improve protein solubility and stability, markedly increase plasma half-life and improve overall therapeutic effectiveness. ROR1 binding VNARs were genetically fused to the N terminus of mouse IgG2a Fc (mFc) and both the N and C termini of human IgG1 (hFc) via standard GlySer linkers (FIG. 7E, F, G). Examples of Fc sequences
TABLE-US-00015 Mouse IgG2a Fc (mFc) (SEQ ID NO: 93) EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVV VDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQD WMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKK QVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKL RVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK Human IgG1 Fc (hFc) (SEQ ID NO: 94) EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[0380] VNAR Fc fusion proteins were expressed as secreted protein in CHO K1 cells and purified from the media using MabSelect.TM. SuRe.TM. (Evitria, Switzerland). Purified proteins were analysed by SEC (AdvanceBio, Agilent), SDS PAGE and mass spectrometry to confirm sequence and protein integrity. The resulting VNAR Fc fusion proteins bind recombinant human ROR1 by SPR (Table 6) and ROR1 positive cells with high affinity (FIG. 15) and were shown to internalise into ROR1 positive cells. ROR1 binding VNARs were also genetically fused to engineered hIgG1 Fc fusion proteins that incorporated an engineered cysteine substitution in the hIgG1 Fc sequence, for example at position S252C or S473C (Kabat numbering) to enable site specific labelling. (FIG. 10)
[0381] Typical Method for Expression of VNAR Intein Fusion Proteins
[0382] For expression as intein fusions, DNA encoding VNARs was optimised for E. coli expression (GeneArt, Thermo) and cloned into the NdeI/SapI sites of the pTXB1 vector (NEB) and derivatives thereof. This results in a gene encoding the VNAR protein of interest fused to an engineered intein domain which in turn is fused to a chitin binding domain (CBD) to enable purification on a chitin column. pTXB1 vector derivatives encode alternative inteins as the fusion proteins.
[0383] Transformed E. coli cells were grown in 1 L shaker flasks until OD600=.about.0.6, cold shocked 4.degree. C. for 2 hours then protein expression induced with 0.5 mM IPTG at 18.degree. C. overnight. Cells were lysed by sonication in lysis buffer (50 mM sodium phosphate pH 7.4, 0.5M NaCl, 15% glycerol, 0.5 mM EDTA, 0.1% Sarkosyl, 1 mM AEBSF) and centrifuged to remove cell debris. VNAR intein fusion protein was purified from clarified cell lysate by immobilizing on chitin beads (NEB, S6651). Beads were washed extensively with lysis buffer followed by cleavage buffer (50 mM sodium phosphate pH 6.9, 200 mM NaCl) and VNARs released from the beads by overnight chemical cleavage in 400 mM dioxyamine, or O,O'-1,3-propanediylbishydroxylamine, or 100 mM cysteine or cysteamine to generate the corresponding C-terminal aminoxy, C-terminal cysteine or C-terminal thiol derivative of the VNARs (FIG. 11).
[0384] Cleaved VNAR supernatant was then further purified by SEC (Superdex75 26/60 GE healthcare) or IMAC (HisTrap HP, GE Healthcare). Concentrations were determined from absorbance at 280 nm using the theoretical extinction coefficient predicted from the amino acid sequence. All proteins were characterized by reducing and non-reducing SDS PAGE analysis and mass spectrometry. The formation of the desired disulphide bond was confirmed by mass spectrometry methods.
Example 3
Anti-ROR1 VNAR Characterisation--Binding to ROR1 and ROR2 by SPR and ELISA
[0385] Species Cross-Reactivity of ROR1 VNAR Binders
[0386] Soluble VNAR protein clones (B1, P3A1 and D3) were analysed for species cross-reactivity with human, mouse and rat ROR1 along with a positive control antibody 2A2 and an anti ROR2 specific antibody control. 2A2 is an anti-human ROR1 specific mouse monoclonal antibody (BioLegend Cat #357802) and the anti ROR2 antibody is a commercial monoclonal mouse antibody from R&D (Cat #MAB2064).
[0387] VNAR B1 was observed to be a very strong binder to both mouse and human ROR1. All VNARs are species cross-reactive to ROR1 derived from a human, mouse and rat origin (Table 3 and Table 4). None of the VNAR clones cross-reacted with human ROR2 (Table 3).
[0388] Determination of Binding Kinetics to Human ROR1, Human ROR2, Mouse ROR1 or Rat ROR1
[0389] Binding kinetics were determined using a Pioneer Surface Plasmon Resonance (SPR) instrument (SensiQ/Pall ForteBio). ROR1-hFc or ROR2-hFc fusion proteins (extracellular domain) were immobilised in sodium acetate pH 5 buffer to COOH.sub.2 chips using amine coupling. VNARs and VNAR-Fc molecules were tested at various concentrations and the Ka (M.sup.-1s.sup.-1), Kd (s.sup.-1) and KD (nM) values were determined using Qdat software (SensiQ/Pall ForteBio). ROR1 2A2 mAb (Biolegend) and ROR2 mAb (R&D Systems) were included as controls for positive/negative binding to ROR1 and ROR2. 2V is a control VNAR sequence, derived from a nave VNAR library, so is representative of this protein class but has no known target.
TABLE-US-00016 TABLE 3 SPR data for binding of VNAR molecules to human ROR1 (hROR1) and human ROR2 (hROR2). C-terminal His.sub.6 or His.sub.6Myc tagged VNARs were expressed. hROR1 Expression KD VNAR System Ka (M.sup.-1s.sup.-1) Kd (s.sup.-1) (nM) hROR2 B1 E. coli 6.29E+05 7.93E-04 1.6 No binding B1 HEK293 5.36E+05 2.26E-03 0.63 No binding P3A1 E. coli 2.47E+06 4.42E-02 19.1 No binding CPF7 E. coli 2.33E+06 2.96E-02 13.6 No binding E7 E. coli 1.11E+06 1.18E-02 11.1 No binding D3 E. coli 2.09E-05 3.24E-02 159.1 No binding D3 HEK293 1.39E+06 7.52E-02 54.5 No binding E9 HEK293 4.23E+05 4.45E-02 136.6 No binding P3A1-[G.sub.4S].sub.5-P3A1 HEK293 4.9E+06 1.12E-03 0.30 No binding D3-[G.sub.4S].sub.5-D3 E. coli 2.95E+06 3.38E-03 2.33 No binding P3A1-[G.sub.4S].sub.5-B1 E. coli 3.13E+06 2.08E-03 1.0 No binding P3A1-[G.sub.4S].sub.3-B1 E. coli 1.09E+06 2.84E-03 2.7 No binding P3A1-[G.sub.4S].sub.7-B1 E. coli 1.49E+06 6.44E-03 4.3 No binding 2V E. coli No binding No binding No binding No binding 2V-[G.sub.4S].sub.5-2V E. coli No binding No binding No binding No binding
TABLE-US-00017 TABLE 4 SPR data for binding to mouse ROR1 (mROR1) and rat ROR1 (rROR1) mROR1 rROR1 Expression KD KD VNAR System Ka (M.sup.-1s.sup.-1) Kd (s.sup.-1) (nM) Ka (s.sup.-1) Kd (M.sup.-1s.sup.-1) (nM) B1 E. coli 4.32E+05 2.09E-03 5.2 1.2E+05 1.11E-02 94.5 B1 HEK 293 7.2E+05 1.51E-03 2.18 1.16E+05 6.51E-03 56.5 P3A1 E. coli 2.95E+06 4.08E-02 14.3 2.86E+06 4.5E-02 17.7 CPF7 E. coli 2.26E+06 3.2E-02 19.1 7.72E+05 3.66E-02 68.6 E7 E. coli 1.41E+06 2.0E-03 1.4 ND ND ND P3A1-[G.sub.4S].sub.5- HEK 293 4.17E+06 1.45E-03 0.396 3.18E+06 1.73E-03 0.57 P3A1 2V E. coli No No No No No No binding binding binding binding binding binding 2V-[G.sub.4S].sub.5-2V E. coli No No No No No No binding binding binding binding binding binding
[0390] VNAR proteins have been developed, which bind with high affinity to human ROR1 ECD in monomeric and multimeric formats (both homo and hetero dimeric forms), show no binding to the closely related family member human ROR2 and cross react with high affinity to mouse and rat orthologues of ROR1. Reformatting the P3A1 and D3 proteins as dimers significantly increased the binding affinity to human ROR1 with a significant reduction in the dissociation rate constants being observed.
[0391] The binding of a chemically conjugated B1 homodimer to hROR1 was also assessed by ELISA. To generate this molecule a B1 derivative was generated with a unique C-terminal thiol functionality through chemical cleavage of the corresponding B1-intein fusion protein precursor with cysteamine. Intermolecular disulphide bond formation was used to covalently link the C-termini of the two proteins to generate a homodimer of unnatural but defined topology (B1-S-S-B1, FIG. 7C). Binding of the B1-S-S-B1 to hROR1 was compared to the B1 monomer by ELISA.
[0392] In brief, ELISA method as follows. Wells coated with 100 ng antigen and incubated, covered, at room temperature for 2 hr. Plates washed 3.times.400 ul per well with PBST (PBS+0.05% Tween 20 (v/v)), then blocked with 4% skimmed milk powder (w/v) in PBST for 1 hour at 37.degree. C. Plates washed as before plus additional wash in PBS alone. Binding proteins were diluted in 4% milk PBST and incubated overnight at 4.degree. C. Plates washed 3.times. with PBST, 3.times. PBS and binding detected using appropriate secondary detection antibody in 4% milk PBST, room temperature 1 hour. Secondary antibodies used include:
[0393] Anti-c-Myc, HRP (Invitrogen #R951-25)
[0394] Rabbit anti-Human IgG H&L, HRP (Abcam #ab6759)
[0395] Rabbit anti-Mouse IgG H&L, HRP (Abcam #ab97046)
[0396] Mouse anti-polyHis, HRP (Sigma #A7058)
[0397] Plates washed 3.times. with PBST. 100 .mu.L TMB substrate (Thermo #34029) added and reaction allowed to proceed at r.t. for 10 mins. 100 .mu.L of 2M H.sub.2SO.sub.4 added to quench the reaction. Plate centrifuged briefly before absorbance at 450 nm read on a CLARIOstar plate reader (BMG Labtech).
[0398] Whilst B1 monomer and the C-terminal thiol derivative binds strongly to human ROR1, an increase in human ROR1 binding was observed for the chemically linked B1-S-S-B1 dimer (FIG. 8).
Example 4
Anti-EGFR-ROR1 VNAR Characterisation--Cell Binding and Internalisation by Flow Cytometry
[0399] Cell Surface Binding
[0400] Adherent human cancer cells were detached from tissue culture flasks by incubating with 0.1% EDTA/PBS solution at 37.degree. C. for .about.10 minutes or until cells detached easily. Cells were re-suspended in 5 ml ice-cold PBS/2% FCS in 15 ml tubes and centrifuged at 1500 rpm for 5 mins at 4.degree. C. Supernatant was removed and the cell pellet re-suspended in 1-2 ml of PBS/2% FCS. A cell count was performed using a Z1 Coulter Particle Counter (Beckman Coulter) and 5.times.10{circumflex over ( )}5 cells were aliquoted per test sample. Cells were incubated with 100 .mu.l of either VNAR (His.sub.6Myc tagged), VNAR-Fc molecules or ROR1 mAb, EGFR mAb and IgG controls for 1 hour on ice. Excess VNAR, VNAR-Fc or mAb was removed by adding 5 ml of ice-cold PBS/2% FCS, followed by centrifugation at 1500 rpm for 5 mins at 4.degree. C. The supernatant was removed and a second wash performed by re-suspending the cell pellet in 1 ml of ice-cold PBS/2% FCS and adding a further 4 ml of ice-cold PBS/2% FCS. Samples were again centrifuged at 1500 rpm for 5 min at 4.degree. C. Supernatant was removed and excess liquid removed by blotting the tubes on tissue paper. Appropriate secondary antibodies were used to detect bound VNAR (His.sub.6Myc), VNAR-hFc, VNAR-mFc or ROR mAb (PE-anti-Myc tag antibody (CST), PE-anti-human antibody (JIR labs/Stratech), and PE-anti-mouse antibody (JIR/Stratech) respectively). Cells were incubated with chosen secondary antibody for 30 min on ice. Cells were washed to remove excess antibody as described earlier. Cell pellets were re-suspended in 0.5 ml of ice-cold PBS/2% FCS and left on ice in the dark prior to analysis on either a FACS Calibur (BD Biosciences) or an Attune N.times.T (ThermoFisher) flow cytometer.
[0401] Cell-Surface Staining Following Incubation at 37.degree. C. vs 4.degree. C.
[0402] Briefly, 5.times.10{circumflex over ( )}5 cells were incubated with VNAR, VNAR-Fc, ROR1 2A2 mAb, EGFR AY13 mAb or IgG1 control for 1 hr on ice. Cells were washed twice by addition of 5 ml of ice-cold PBS/2% FCS followed by centrifugation at 1500 rpm for 5 mins at 4.degree. C. Following the final centrifugation step, excess supernatant was removed and the tubes blotted on tissue paper. Each cell pellet was re-suspended in 200 .mu.l of PBS/2% FCS and either placed on ice or at 37.degree. C. for 2 hours. Bound VNAR (His.sub.6Myc tagged), VNAR-hFc, VNAR, ROR1 2A2 mAb or EGFR AY13 mAb was detected using either PE-conjugated anti-Myc tag antibody (CST), PE-conjugated anti-human antibody (JIR/Stratech) or PE-conjugated anti-mouse antibody (JIR/Stratech). Loss of signal at 37.degree. C. with respect to samples incubated on ice is indicative of ROR1 internalisation.
[0403] A decrease in cell-surface binding after incubation at 37.degree. C. versus 4.degree. C. was observed for anti-ROR1 VNAR constructs (FIG. 14) and anti-EGFR-ROR1 VNAR molecules (FIGS. 42A and 42B), which is consistent with binding and internalisation of the proteins by ROR1 and EGFR.
[0404] Binding of VNARs to a Panel of Cancer Cell-Lines
[0405] FIG. 9 shows representative flow cytometry histograms for binding of anti ROR1 VNARs binding to the ROR1.sup.hi A549 lung adenocarcinoma cells.
[0406] FIG. 13 shows the binding of different VNARs to the ROR1.sup.hi A549 lung adenocarcinoma cells and the ROR1.sup.low lung cancer cell-line A427 by flow cytometry.
[0407] Table 5 shows a summary of flow cytometry data for binding of VNAR proteins to a variety of ROR1.sup.hi and ROR1.sup.low cancer cell-lines.
TABLE-US-00018 TABLE 5 Relative ranking of VNAR cell surface binding in human cancer cell lines, ascertained by flow Cytometry. Number of `+` corresponds to binding strength. `-` indicates no binding. `/` not determined in this cell line. Based on Median (YL1-PE) or Geo Mean (FL2-PE) A549 A427 MDA-MB-231 T47D HT-29 Colo205 Molecule (ROR1.sup.hi) (ROR1.sup.low) (ROR1.sup.hi) (ROR1.sup.low) (ROR1.sup.hi) (ROR1.sup.low) B1 +++++ + +++ ++ +++ + E7 ++++ + +++ ++ +++ + P3A1 + - + +/- + - CPF7 ++ - + +/- + - P3A1-[G.sub.4S].sub.5- +++ - ++ / / / P3A1 dimer CPF7-[G.sub.4S].sub.5- +++ ++ / / / / CPF7 dimer P3A1- [G.sub.4S].sub.5- ++++ - +++ / / / B1 D3 + - / / / / D3-[G.sub.4S].sub.5-D3 ++++ - ++ / / / dimer 2V - - - - - - 2V-[G.sub.4S].sub.5-2V - - - - - - dimer
[0408] Robust binding of the VNARs to ROR1 expressing cancer cell-lines is observed as compared to the ROR1.sup.low cancer cell-lines where little to no staining was observed for the majority of the ROR1 binding VNARs tested.
[0409] The cell-surface staining for P3A1-P3A1 is not as strong as for B1 or D3-D3 proteins, which may reflect differences in the epitopes of these binders and that in the cellular context some regions of the extracellular domain of ROR1 are potentially more accessible for binding than others.
Example 5
Characterisation of Anti-ROR1 VNAR-Fc Fusion Proteins--Binding to ROR1 and ROR2 by SPR and Cell Surface Binding and Internalisation
[0410] ROR1 binding VNARs were expressed fused to the N terminus of mouse IgG2a Fc (mFc) and the N terminus and C-terminus of human IgG1 (hFc) via standard GlySer linkers. Fusion of the human IgG1 Fc were also generated whereby Ser235 in the Fc region (Kabat numbering) was replaced with a Cys (FIG. 10).
[0411] Binding to ROR1 and ROR2 by SPR
[0412] Using the procedures outlined above the binding of VNAR-Fc fusions to human, mouse and rat ROR1 and human ROR2 were determined by SPR.
TABLE-US-00019 TABLE 6 SPR data for binding of VNAR-Fc fusions to human ROR1 and human ROR2 hROR1 Molecule Ka (M.sup.-1s.sup.-1) Kd (s.sup.-1) KD (nM) hROR2 B1 mFc 4.19E+05 3.356E-04 0.8 No binding 2V mFc No binding No binding No binding No binding B1 hFc 3.08E+06 9.53E-05 0.032 No binding P3A1 hFc 1.07E+07 5.64E-04 0.084 No binding D3 hFc 1.21E+06 2.88E-03 2.6 No binding E9 hFc 7.07E+05 3.64E-03 5.3 No binding D3-D3 hFc 4.96E+06 9.88E-04 0.25 No binding hFc - P3A1 2.38E+06 7.76E-04 0.35 No binding hFc - D3 1.10E+06 2.35E-03 2.37 No binding hFc - D3-D3 2.35E+06 1.01E-03 0.49 No binding 2V hFc No binding No binding No binding No binding 2V-2V hFc No binding No binding No binding No binding
[0413] As shown in Table 6 anti ROR1 VNAR-Fc proteins bind with high affinity to human ROR1, with no binding to human ROR2 observed. Strong binding to mouse and rat ROR1 ECD was also observed. As VNAR-Fc fusions, a significant decrease in the K.sub.D apparent values for ROR1 binding is observed with respect to the corresponding VNAR monomers. This is consistent with these VNAR-Fc fusions binding in a bivalent fashion to the ROR1-chip surface in the SPR experiments. Both N- and C-terminal VNAR Fc fusions bind with high affinity to human ROR1 but do not bind to human ROR2.
[0414] Binding of VNARs to Cancer Cell-Lines
[0415] Binding of the VNAR-Fc fusions to the surface of a panel of cancer cell lines was measured by flow cytometry using the methods outlined previously. FIG. 15 shows the binding of different VNAR-Fc fusions to the ROR1.sup.hi A549 lung adenocarcinoma cells and the ROR1.sup.low lung cancer cell-line A427 by flow cytometry at a fixed concentration of protein.
[0416] Table 7 summarises the binding data for VNAR-Fc proteins with a variety of ROR1.sup.hi cancer cell-lines.
TABLE-US-00020 TABLE 7 Relative ranking of VNAR hFc molecule cell surface binding in ROR1.sup.hi human cancer cell lines. The number of `+` indicates the strength of binding. `-` indicates no binding. `/` indicates that it has not been determined. hFc molecules were detected using a PE-anti- human antibody (Jackson Immune Research/Stratech) and a ThermoFisher Attune NxT flow cytometer. Based on Median (YL1-PE) Molecule A549 MDA-MB-231 PC-9 NCI-H1975 B1 hFc ++++ +++++ +++++ +++++ P3A1 hFc ++ +++ ++ ++ D3 hFc + ++ / / E9 hFc + / / / D3-D3 hFc ++ ++++ / / 2V hFc - - - - 2V-2V hFc + / / /
[0417] Robust binding of the VNARs to ROR1 expressing cancer cell-lines is observed as compared to the ROR1.sup.low cancer cell-lines, where little to no staining was detected for the majority of the ROR1 binding VNARs tested.
[0418] Differences in the mean cell-surface staining may indicate that different regions of ROR1 may be more accessible than others when the protein is expressed on the cell surface. For targeting less accessible regions of ROR1 on cancer cells, it would be advantageous to use small protein binders such as VNARs as opposed to large antibodies that will be sterically occluded.
[0419] Cell-Surface Staining Following Incubation at 37.degree. C. vs 4.degree. C.
[0420] The binding of VNAR-Fc fusions to MDA-MB-231 cells after incubation at 37.degree. C. or 4.degree. C. was determined by flow cytometry using the methods described previously. For the B1-hFc, P3A1-hFc, D3-hFc and D3D3-hFc proteins tested, there was a loss of cell-surface staining after incubation at 37.degree. C. versus 4.degree. C. (FIG. 16), consistent with binding and internalisation of these VNAR-hFc fusion proteins.
[0421] Internalisation by Immunofluorescence Following Incubation at 37.degree. C. vs 4.degree. C.
[0422] The cellular localisation of human IgG1 Fc and mouse IgG2a Fc fusion proteins can be detected by immunofluorescence using fluorescently labelled secondary antibodies targeting these domains. Immunofluorescence methods were used to detect internalisation of VNAR-Fc by ROR1 on cancer cells.
[0423] Black, clear bottom 96-well plates (Greiner) were coated with 100 .mu.g/ml Collagen I (Sigma) to aid cell attachment. Cells were seeded in complete growth media (Gibco) into the coated 96 well plates and incubated at 5% CO2, 37.degree. C. for 24 hr. The media was removed and replaced with serum-free media (Gibco) on the following day and left overnight. On the following morning, media was removed and cells were treated with various concentrations of VNAR-Fc molecules. Plates were incubated on ice for 30 minutes. Treatments were removed and replaced with 100 .mu.l of PBS/2% FCS per well. One plate was kept on ice and the other was placed at 37.degree. C., 5% CO2 for 2 hours. Following this 2 hour incubation, the PBS/2% FCS solution was removed and cells were fixed with 4% Paraformaldehyde in ice cold PBS for 20 min on ice. The PFA solution was removed and replaced with 0.05% Saponin (Sigma) made up in PBS/2% FCS for 15 min at room temperature. This step permeabilises the cell membranes. Secondary antibody staining was performed using; AF488-anti-human Ab (1:250; ThermoFisher) to detect VNAR-hFc fusion proteins. All secondary antibody working stocks were made up in 0.05% Saponin/PBS/2% FCS. Plates were incubated at 4.degree. C. overnight in the dark. On the following day, secondary AF488-conjugated antibodies were removed and the cells were washed .times.3 using 0.05% Saponin/PBS/2% FCS. Lamp-1 antibody (1:200; CST) or EEA1 antibody (1:50; CST) were added to detect lysosome and early endosome compartments respectively. Plates were incubated in the dark at room temperature for 2 hours. The Lamp-1 and EEA1 antibodies were then removed and the cells were washed .times.3 with 0.05% Saponin/PBS/2% FCS. AF647-anti rabbit antibody (1:1000; CST) was then added to detect Lamp1 and EEA1 antibody binding. A further incubation in the dark at room temperature for 2 hours was performed before removing the AF647-secondary antibody and washing the cells .times.3 with 0.05% Saponin/PBS/2% FCS. Cell nuclei were stained using 10 .mu.M Hoechst reagent (Sigma) in 0.05% Saponin/PBS/2% FCS for 20 min at room temperature in the dark. Finally, this solution was removed and replaced with PBS. Plates were stored at 4.degree. C. in the dark prior to imaging using a GE Healthcare InCell 2000 instrument.
[0424] Internalisation of B1 hFc and B1 mFc was observed in MDA-MB-231 breast cancer cells following incubation at 37.degree. C. for 2 hours. The VNAR-Fc-ROR1 complex appears to overlay with Lamp-1 and EEA1 staining following internalisation which is suggestive of ROR1 cellular trafficking via early endosomal and lysosomal compartments. ROR1-VNAR-Fc staining remained predominantly at the cell surface when the samples were incubated on ice for 2 hours. No cell surface binding or internalisation was observed following incubation with 2V Fc protein (non-binding negative control VNAR). B1-hFc and B1-mFc were not internalised by the ROR1.sup.low lung cancer cell-line A427.
Example 6
Humanisation and Further Engineering
[0425] A number of humanised sequence derivatives of two lead ROR1 binding VNARs were generated using two different strategies.
[0426] Humanised sequences were designed based on the human germ line V.kappa.1 sequence, DPK-9. For example, in P3A1 V1 the framework regions 1, 3 and 4 of the VNAR were mutated to align with the framework regions of DPK-9.
[0427] The second strategy involved grafting the binding loops of the ROR1 binding VNARs onto a previously humanised VNAR framework (Kovalenko et al JBC 2013 288(24) 17408-17419; WO2013/167883). For the first construct (G1) only the CDR1 and CDR3 loops were grafted. The second construct (G2) had both the CDRs and HV loops grafted.
[0428] Examples of humanised/grafted VNAR sequences:
TABLE-US-00021 B1 G1 (SEQ ID NO: 45) TRVDQSPSSLSASVGDRVTITCVLTGANYGLASTYWYRKNPGSSNKEQI SISGRYSESVNKGTKSFTLTISSLQPEDSATYYCRAYPWGAGAPWLVQW YDGAGTKVEIK B1 G2 (SEQ ID NO: 46) TRVDQSPSSLSASVGDRVTITCVLTGANYGLASTYWYRKNPGSSNQERI SISGRYSESVNKRTMSFTLTISSLQPEDSATYYCRAYPWGAGAPWLVQW YDGAGTKVEIK P3A1 V1 (SEQ ID NO: 47) TRVDQSPSSLSASVGDRVTITCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYVESVNKGAKSFTLTISSLQPEDFATYYCKAREARHPWLRQWYD GAGTKVEIK P3A1 G1 (SEQ ID NO: 48) TRVDQSPSSLSASVGDRVTITCVLTDTSYGLYSTYWYRKNPGSSNKEQI SISGRYSESVNKGTKSFTLTISSLQPEDSATYYCRAREARHPWLRQWYD GAGTKVEIK P3A1 G2 (SEQ ID NO: 49) TRVDQSPSSLSASVGDRVTITCVLTDTSYGLYSTYWYRKNPGTTDWERM SIGGRYSESVNKGAKSFTLTISSLQPEDSATYYCRAREARHPWLRQWYD GAGTKVEIK D3 humanised ADV1 (SEQ ID NO: 50) ASVNQSPSSLSASVGDRVTITCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYSESVNKGAKSFTLTISSLQPEDSATYYCKAQSGMAISTGSGHG YNWYDGAGTKVEIK D3 humanised ADV2 (SEQ ID NO: 51) TRVDQSPSSLSASVGDRVTITCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYSESVNKGAKSFTLTISSLQPEDSATYYCKAQSGMAISTGSGHG YNWYDGAGTKVEIK D3 humanised ADV3 (SEQ ID NO: 52) ASVNQSPSSASASVGDRLTITCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYSESVNKGAKSFTLTISSLQPEDSATYYCKAQSGMAISTGSGHG YNWYDGAGTKLEVK B1 humanised V5 (SEQ ID NO: 53) ASVDQSPSSLSASVGDRVTITCVVTGANYGLAATYWYRKNPGSSNQERI SISGRYSESVNKRTMSFTLTISSLQPEDSATYYCKAYPWGAGAPWLVQW YDGAGTKVEIK B1 humanised V7 (SEQ ID NO: 54) ASVDQSPSSASASVGDRLTITCVVTGANYGLAATYWYRKNPGSSNQERI SISGRYSESVNKRTMSFTLTISSLQPEDSATYYCKAYPWGAGAPWLVQW YDGAGTKLEVK
[0429] DNA encoding the humanised constructs was codon optimised for expression in E. coli and synthesised by GeneArt (Thermo). P3A1 sequences were designed as dimers with a [G.sub.4S].sub.5 linker connecting the VNAR domains. All humanised sequences were generated with the following C terminal His.sub.6myc tag:
TABLE-US-00022 (SEQ ID NO: 95) QASGAHHHHHHGAEFEQKLISEEDLG
[0430] DNA encoding these proteins was sub cloned into the intein expression vectors, expressed in E. coli and purified as described previously in "Typical method for expression of VNAR intein fusion proteins" section.
[0431] Further humanised versions of D3 were created as follows:
TABLE-US-00023 D3 humanised EL V1 (SEQ ID NO: 55) ASVNQSPSSLSASVGDRVTITCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYVESVNKRAKSFSLRIKDLTVADSATYYCKAQSGMAISTGSGHG YNWYDGAGTKVEIK D3 humanised EL V2 (SEQ ID NO: 56) ASVNQSPSSLSASVGDRVTITCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYVESVNKRAKSFTLTISSLQPEDFATYYCKAQSGMAISTGSGHG YNWYDGAGTKVEIK D3 humanised EL V3 (SEQ ID NO: 57) ASVNQSPSSLSASVGDRVTITCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRFSGSGSKRAKSFTLTISSLQPEDFATYYCKAQSGMAISTGSGHG YNWYDGAGTKVEIK D3 humanised EL V4 (SEQ ID NO: 58) ASVNQSPSSLSASVGDRVTITCVLTDTSYGLYSTSWYQQKPGTTDWERM SIGGRYVESVNKRAKSFTLTISSLQPEDFATYYCKAQSGMAISTGSGHG YNWYDGAGTKVEIK and D3 humanised EL V5 (SEQ ID NO: 59) ASVNQSPSSLSASVGDRVTITCVLTDTSYGLYSTSWYQQKPGTTDWERM SIGGRFSGSGSKRAKSFTLTISSLQPEDFATYYCKAQSGMAISTGSGHG YNWYDGAGTKVEIK
[0432] Humanised ROR1 binding VNAR variants demonstrated high affinity binding to human ROR1 by SPR and improved thermal stability. SPR was performed as described previously using human ROR1 ECD-Fc immobilised to the chip surface. Thermal stability assays used Applied Biosystems StepOne Real Time PCR system with the Protein Thermal Shift.TM. dye kit (Thermo). The assay mix was set up so that the protein was at a final concentration of 20 .mu.M in 20 .mu.L. 5 .mu.L of Thermal Shift.TM. buffer was added alongside 2.5 uL 8.times. Thermal Shift.TM. Dye. Assays were run using the StepOne software and data analysed using Protein Thermal Shift.TM. software. All data are from first derivative analysis.
TABLE-US-00024 TABLE 8 Thermal stability and hROR1 binding data for humanised VNAR variants hROR1 binding (SPR) Construct Tm (.degree. C.) Ka (M.sup.-1s.sup.-1) Kd (s.sup.-1) K.sub.D (nM) B1 54.2 7.45E+05 6.09E-04 0.83 B1G1 58.0 2.20E+05 1.62E-02 82.8 B1G2 59.9 1.85E+05 7.90E-03 45.9 B1V5 46.05 5.20E+04 3.85E-05 0.74 B1V7 43.91 7.74E+04 5.54E-05 0.77 P3A1 dimer 60.7 3.78E+05 1.17E-03 0.30 P3A1 V1 dimer 48.5 4.78E+05 8.46E-04 0.18 P3A1 G1 dimer 57.1 4.30E+05 1.47E-03 0.43 P3A1 G2 dimer 54.0 1.88E+05 1.19E-03 0.77 B1G1-hFc ND 2.4E+05 2.66E-03 11.8 B1G2-hFc ND 6.26E+05 1.41E-03 2.55 D3 ADV1 dimer 54.66 6.36E+05 5.67E-03 8.92 D3 ADV2 dimer 56.18 6.09E+05 1.60E-02 26.2 D3 WT 64.4 1.21E+06 9.43E-05 15.5 D3 AD V2 56.98 4.58E+04 2.36E-03 51.6 D3 EL V1 53.25 1.50E+06 1.58E-04 16.1 D3 EL V2 56.50 1.85E+06 1.63E-04 18.9 D3 EL V4 54.1 1.38E+06 5.45E-04 58.5
[0433] Grafting the HV and/or CDR loops of B1 onto a humanised VNAR framework and substituting P3A1 sequences with regions from the human DPK-9 sequence, yielded substantially engineered proteins that are stable and maintain hROR1 binding with nanomolar and picomolar affinity respectively.
Example 7
Epitope Mapping
[0434] Binding of Proteins to Deglycosylated Human ROR1
[0435] ELISA was used to compare VNAR binding to glycosylated and deglycosylated human ROR1 protein. To generate deglycosylated human ROR1, 0.2 mg/ml protein was incubated overnight at room temperature with 1 U PNGaseF (Roche) per 2 .mu.g ROR1 protein. Control, glycosylated human ROR1 was prepared in parallel without adding PNGaseF. SDS PAGE analysis showed shift on PNGaseF treatment, consistent with ROR1 deglycosylation (FIG. 17A).
[0436] These ROR1 proteins were used to coat ELISA plates and ELISAs were performed as previously described in the "Anti ROR1 VNAR characterisation" section. VNARs (B1, P3A1-P3A1, D3-D3, B1 mFc) bound equally well to both glycosylated and deglycosylated ROR1 proteins by ELISA (FIGS. 17B & 17C) indicating ROR1 binding is independent of ROR1 glycosylation.
[0437] Binding of B1 to unfolded hROR1 (reduced with 28 mM DTT, 0.5% Sarkosyl) was significantly reduced, consistent with B1 VNAR binding to conformational epitope(s) (FIG. 17C)
[0438] Binding of B1 to ROR1 Ig Domain by SEC
[0439] B1 VNAR forms a complex with ROR1 Ig domain by SEC (FIG. 18). 1:1 VNAR:ROR1 domain or ROR1 domain pairs was incubated on ice for 30 mins then run on a the Superdex 200 increase 10/300 column (GE Healthcare) in PBS and fractions analysed by SDS-PAGE. Under these conditions, B1 formed a complex with the ROR1 Ig domain.
[0440] Epitope Binning Experiments
[0441] Competition of binding studies were completed using SPR. Human ROR1 (hROR1) was immobilised to flow channels 1 and 3 (FC1 and FC3) of a COOH.sub.2 chip by amine coupling. FC2 was used as the reference channel. A chosen VNAR e.g. B1, P3A1 dimer; or ROR1 2A2 mAb (BioLegend) was then captured to hROR1 on FC1. Test analytes were then assessed for binding to i) hROR1 with either VNAR or ROR1 2A2 mAb previously captured, or ii) to hROR1 in the absence of bound VNAR or mAb. The hROR1 chip surface was regenerated following each test analyte using Glycine pH 2. Prior to testing the next analyte, VNAR or ROR1 2A2 mAb was again captured to hROR1 in FC1 and so on. Binding kinetics were determined using QDat software. For non-competing molecules, binding kinetics and sensogram profiles were similar/unaffected to hROR1+/-captured binder. For competing molecules, the sensogram profile and binding kinetics were significantly altered.
[0442] FIG. 19 shows representative sensograms and binding kinetics for binding of the VNARs to human ROR1 without and with prior incubation with B1. The results demonstrated that B1 and P3A1 VNARs do not compete with each other, nor with the ROR1 mAb 2A2 for binding to hROR1. When B1 VNAR was captured to hROR1 on the chip surface, further binding of B1 was significantly hindered, however the binding profiles of P3A1 monomer, P3A1 dimer or ROR1 2A2 mAb to hROR1 were the same in the absence and presence of pre-captured B1 (FIG. 19). The kinetic parameters derived for binding of these molecules to hROR1 in the presence or absence of captured B1 VNAR confirm that they do not compete with B1 (with the exception of B1, which competes with itself as expected).
[0443] Binding of VNARs to hROR1 with and without pre-capture of P3A1 derivatives or 2A2 mAb was similarly assessed. The results are summarised in (Table 9), which showed that B1, P3A1 and 2A2 do not compete with each other, but compete with themselves as anticipated, and therefore bind different regions of hROR1.
TABLE-US-00025 TABLE 9 Binding kinetic data derived by SPR analysis of VNARs or ROR1 2A2 mAb to hROR1 +/- previously captured B1 VNAR. Data demonstrates that B1 binding does not compete with P3A1 or 2A2. VNARs were expressed with C-terminal His.sub.6Myc tags. hROR1 binding B1 pre- captured tohROR1 Molecule Ka (M.sup.-1s.sup.-1) Kd (s.sup.-1) KD (nM) Ka (M.sup.-1s.sup.-1) Kd (s.sup.-1) KD (nM) B1 1.04E+06 4.40E-04 0.424 nM No/poor binding P3A1-P3A1 1.63E+06 6.28E-04 0.385 nM 1.52E+06 5.36E-04 0.352 nM P3A1 2.58E+06 4.11E-02 15.9 nM 1.94E+06 3.20E-02 16.45 nM ROR1 2A2 mAb 9.79E+05 2.11E-04 0.21 nM 8.35E+05 8.47E-05 0.101 nM (Biolegend)
[0444] Epitope Mapping of Anti-ROR1 VNARs Using Anti-ROR1 Peptides
[0445] ELISA analysis was used to determine whether the lead anti-ROR1 VNAR domains, B1, P3A1 and D3 bound to the same or overlapping epitopes on ROR1 (defined here as four ECD peptides). Initial analysis of direct binding with peptides (in PBS and DMSO) immobilised onto ELISA plates indicated that none of the VNARs bound any of the peptides but did bind to the immobilised ECD hROR1-Fc protein control included as part of the same ELISA (FIG. 20 and FIG. 21). To interrogate this further, a competition assay was designed where VNARs were incubated with increasing concentrations of the four test peptides (or human ROR1 ECD-Fc) in solution and an assessment of residual binding to ROR1-Fc immobilised on an ELISA plate was then observed. Competition was evident between the VNARs and human ROR1 ECD-Fc, which was used as a positive control. However, no decrease signal was evident in the presence of the peptides, clearly indicating that no binding of VNAR to these specific ECD peptides had occurred (FIG. 22 and FIG. 23).
[0446] Further, B1, P3A1 and D3 VNARs do not bind any overlapping linear 15 mer peptides spanning the entire ECD of hROR1. Nor do they bind to hROR1 previously sonicated in SDS containing buffer under reducing conditions, conditions that typically denature protein (Pepscan data not shown). Together this indicates B1, P3A1 and D3 VNARs bind to distinct conformational epitope(s) on human ROR1 ECD protein.
[0447] Direct Binding of VNARs to ECD Peptides
[0448] The following peptides were synthesised and dissolved in PBS pH 7.4:
TABLE-US-00026 Peptide 1 (SEQ ID NO: 34) YMESLHMQGEIENQI Peptide 2 (SEQ ID NO: 38) RSTIYGSRLRINLDTTDTGYFQ Peptide 3 (SEQ ID NO: 35) CQPWNSQYPHTHTFTALRFP Peptide 4 (SEQ ID NO: 37) QCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYE Peptide 5 (SEQ ID NO: 36) RSTIYGSRLRIRNLDTTDTGYFQ
[0449] Clones B1 and P3A1 isolated from ELSS1 were assessed as monomers and D3 from an immunized library as both a monomer and a homodimer.
[0450] Both B1 and P3A1 demonstrated binding to ROR1 with no binding evident to any of the four peptides. HSA was included as a non-specific control (FIG. 20).
[0451] However as peptide 2 was insoluble in PBS, the direct binding ELISAs were repeated with the peptides dissolved in 25% DMSO. D3 and D3-D3 as a protein dimer fusion were included in these datasets and again no binding to the peptides was observed (FIG. 21).
[0452] Methods
[0453] Direct Peptide Binding ELISA
[0454] 1. Coated 96 well plates with 10 or 50 nM huROR1-Fc in PBS or 10 .mu.M of peptides in PBS or 25% DMSO. Incubated o/n at 4 oC
[0455] 2. Washed 2.times. PBS
[0456] 3. Blocked with 200 .mu.l/well of 4% MPBS for 1 h at RT.
[0457] 4. Washed 2.times. PBS
[0458] 5. Added B1 or P3A1 at 1 .mu.g/ml (67 nM); D3 and D3-D3 at 10 .mu.g/ml (670 nM) and 1:3 serial dilutions across the plate. Incubated for 1 h at RT.
[0459] 6. Washed 3.times. PBST
[0460] 7. Incubated plates with 100 ul of anti-his-HRP SIGMA (1:1000 in PBST) for 1 h at RT
[0461] 8. Washed 2.times. PBST and 2.times. PBS
[0462] 9. Added 100 .mu.l/well of TMB substrate. Stopped reaction with 1 M H2SO4
[0463] Competition Assays of VNARs and ROR1 Peptides
[0464] Competition assays were conducted as described in the methods with all four peptides reconstituted in PBS. In these assays no binding was observed by VNARs B1 or P3A1 to any of the four peptides immobilised in typical binding ELISA format (FIG. 22). Therefore, there was no evidence that these peptides represented epitopes on ROR1 that are recognised by B1 or P3A1.
[0465] Following the conditions used in FIG. 21 (due to peptide 2 being insoluble in PBS), all the competition assays were repeated with peptides dissolved in 25% DMSO. For the assay D3 and D3-D3 dimer were also included in these datasets. These results confirmed that the VNAR domains B1, P3A1 and D3 recognise a different epitope (or epitopes) from those represented by the 4 peptides tested.
[0466] Methods
[0467] Competition ELISA
[0468] 1. Coated 96 well plates with 50 nM of huROR1-Fc for P3A1; 10 nM of huROR1-Fc for B1, D3 and D3-D3 dimer in PBS. Incubated o/n at 4 oC
[0469] 2. Washed 2.times. PBS
[0470] 3. Blocked with 200 .mu.l/well 4% MPBS for 1 h at RT
[0471] 4. Washed 2.times. PBS
[0472] 5. Pre -incubated for 30 min at RT
[0473] B1=15 nM
[0474] Plus peptides (in PBS or 25% DMSO) at start concentration of 1 .mu.M (then 1:3 serial dilutions across the plate)
[0475] or huROR1-Fc at start concentration of 100 nM (then 1:3 serial dilutions across the plate)
[0476] P3A1=670 nM
[0477] Plus peptides (in PBS or 25% DMSO) at starting concentration of 50 .mu.M (then 1:3 serial dilutions across the plate)
[0478] or of huROR1-Fc at a starting concentration 1 .mu.M (then 1:3 serial dilutions across the plate)
[0479] D3=67 nM
[0480] Plus peptides or huROR1-Fc (in PBS or 25% DMSO) at starting concentration of 500 nM (then 1:3 serial dilutions across the plate)
[0481] D3-D3=0.67 nM
[0482] Plus peptides or huROR1-Fc (in PBS or 25% DMSO) at starting concentration of 500 nM (then 1:3 serial dilutions across the plate)
[0483] 6. Add 100 .mu.l/well of pre-incubated samples. Incubated 1 h at RT
[0484] 7. Washed 3.times. PBST
[0485] 8. Incubated plates with 100 .mu.l/well of anti-His-HRP (1:1000 in PBST). Incubated 1 h at RT
[0486] 9. Washed 2.times. PBST and 2.times. PBS
[0487] 10. Added 100 .mu.l/well of TMB substrate. Stopped reaction with 50 .mu.l/well 1 M H2SO4
[0488] Epitope Mapping of Anti-ROR1 VNARs Using Recombinant ROR1 Domains
[0489] The ROR1 ECD is made up of three distinct protein domains: Ig-like, Frizzle and Kringle. To determine if the epitope recognised by each of these VNARs was within a specific sub-domain of the whole ROR1 protein the following ELISA analysis was performed.
[0490] Direct Binding of VNARs to ROR1 Domains
[0491] Anti-ROR1 VNARs B1, P3A1 and D3 were assessed for binding to the three extracellular domains of human ROR1 (Ig-like, Frizzle and Kringle) by direct binding ELISA. B1 and P3A1 were assessed as monomers and D3 as both a monomer and a homodimer (D3-D3). 2A2 anti-ROR1 antibody was also incorporated into the assay as a positive control.
[0492] B1 and 2A2 recognised the Ig-like domain, however this binding to Ig-like domain was much weaker compared to their binding of the whole extracellular huROR1. P3A1 recognised the Frizzled domain but again weaker binding than to the intact ROR1 protein (FIG. 24 and Table 10). D3 and D3-D3 homodimer bound full length ROR1 ECD but no binding to individual ROR1 ECD sub domains was observed (FIG. 24 and Table 10).
[0493] All results are summarised in a Table 10.
TABLE-US-00027 TABLE 10 B1 P3A1 D3 2A2 rhROR1-Fc +++ +++ +++ +++ Ig-like domain + - - + Frizzle domain - + - - Kringle domain - - - -
[0494] Methods
[0495] Direct Binding ELISA to ROR1 Domains
[0496] 1. Coated 96 well plates with 1 .mu.g/ml of huROR1-Fc or huROR1 domains in PBS. Incubated o/n at 4.degree. C.
[0497] 2. Washed 2.times. PBS
[0498] 3. Blocked with 200 .mu.l/well of 4% MPBS for 1 h at RT.
[0499] 4. Washed 2.times. PBS
[0500] 5. Added D3, D3-D3 dimer or 2A2 mAb at start concentration 10 .mu.g/ml for VNAR and 1:150 dilution for mAb. Made 3-fold serial dilutions across the plate. Incubated for 1 h at RT.
[0501] 6. Washed 3.times. PBST
[0502] 7. Incubated plates with 100 .mu.l of anti-c-myc-HRP (1:1000 in PBST) for 1 h at RT.
[0503] 8. Washed 2.times. PBST and 2.times. PBS
[0504] 9. Added 100 .mu.l/well of TMB substrate. Stopped reaction with 1 M H.sub.2SO.sub.4.
Example 8
VNAR Conjugation Chemistries
[0505] Labelling of BA11 as Proof of Concept for Site-Specific VNAR Conjugation
[0506] Currently there are no methods for the site-specific conjugation of labels and drugs to VNARs, therefore there is a need to establish such conjugation methods. The VNAR BA11 is a humanised variant of E06 that binds with high affinity to human serum albumin (Kovalenko et al, J. Biol. Chem., 2013 JBC) and has applications as a half-life extension technology. BA11 was used as a model VNAR to determine whether site-specifically conjugated VNARs can be generated in good yield without compromising the binding activity of the VNAR domain. The C-terminus of VNARs is distal to the CDR1 & 3 and HV2 & 4 regions, which are the regions of the VNAR generally used to bind its target.
[0507] Therefore, intein based technology (US2006247417) was used to assess the site-specific conjugation of payloads to the C-terminus of VNARs via different chemistries. Briefly, the protein of interest is expressed as an N terminal fusion of an engineered intein domain (Muir T W 2006 Nature 442, 517-518). Subsequent N to S acyl shift at the protein-intein union results in a thioester linked intermediate that can be chemically cleaved with bis-aminoxy agents or amino-thiols to give the desired protein C-terminal aminoxy or thiol derivative, respectively (FIG. 11). These C-terminal aminoxy and thiol derivatives can be reacted with aldehyde/ketone and maleimide functionalised moieties, respectively, in a chemoselective fashion to give the site-specific C-terminally modified protein (FIGS. 25-27). Using this approach BA11 fluorescein conjugates were generated via oxime and thioether forming chemistry in good yields and these conjugates maintained binding to human serum albumin protein.
[0508] Initially, the BA11 intein-CBD fusion protein, immobilised on chitin beads, was generated as described previously with typical yields .gtoreq.10 mg/L from cytosolic expression in E. coli. This precursor fusion protein was then cleaved under aqueous buffered conditions with different small molecule agents to generate BA11 with unique chemically reactive functionalities at its C-terminus.
[0509] Generation of BA11-Aminoxy (FIG. 11)
[0510] Immobilised BA11 intein-CBD fusion protein was cleaved overnight in 400 mM dioxyamine (NH.sub.2--O--(CH.sub.2).sub.2--O--NH.sub.2) in cleavage buffer pH 6.9 resulting in .about.75% cleavage.
[0511] Cleavage supernatant containing BA11 aminoxy was drained and purified on a Superdex75 26/60 (GE Healthcare) in 20 mM sodium phosphate pH 6.9, 200 mM NaCl. This yielded soluble, derivatised, folded protein with yields of >2 mg/L E. coli. All protein was characterised by reducing and non-reducing SDS PAGE analysis and mass spectrometry. The formation of the desired disulphide bond was confirmed by mass spec methods.
[0512] Generation of BA11-Oxime-Fluorescein (FIG. 25)
[0513] Purified BA11 aminoxy was mixed with 3 molar equivalents benzaldehyde-peg-fluorescein in pH 5.5 buffer with 10% acetonitrile and 10 mM aniline catalyst, room temperature overnight. SDS PAGE and mass spectrometry showed .gtoreq.98% reaction and conjugate was purified by SEC as above, and confirmed by reducing and non-reducing SDS PAGE analysis and mass spectrometry.
[0514] Generation of BA11 C-Terminal Thiol Derivatives (FIG. 11)
[0515] BA11 intein-CBD fusion protein immobilised on chitin beads was cleaved overnight in 100 mM cysteamine (Sigma) in cleavage buffer with 2 mM TCEP to generate the corresponding C-terminal thiol derivative of the VNAR. The cleavage supernatant containing BA11 thiol was drained, treated with 2 mM TCEP to reduce any cysteamine adducts on the introduced C-term thiol group, and protein purified on a Superdex75 26/60 (GE Healthcare) in 20 mM sodium phosphate pH 6.9, 200 mM NaCl. Yields .about.1.6 mg/L E. coli for BA11 SH were obtained. All proteins were characterised by reducing and non-reducing SDS PAGE analysis and mass spectrometry. The formation of the desired disulphide bond and free C-terminal thiol were confirmed by mass spec methods.
[0516] Generation of BA11-C Term Thiol-Maleimide-Peg-Fluorescein (FIG. 26)
[0517] BA11 generated with a C-terminal thiol (BA11 SH) was mixed with 4 molar equivalents maleimide-peg-fluorescein in pH 6.9 buffer with 0.3% DMF final, room temperature 0.5-1 hour. SDS PAGE and mass spectrometry showed 98% reaction. Conjugate was purified by SEC as above, and confirmed by reducing and non-reducing SDS PAGE analysis and mass spectrometry.
[0518] Generation of BA11 C-Terminal Cysteine Derivatives (FIG. 11)
[0519] BA11 Intein-CBD fusion protein immobilised on chitin beads was cleaved overnight in 100 mM cysteine in cleavage buffer with 2 mM TCEP to generate the corresponding C-terminal cysteine derivative of the VNAR. The cleavage supernatant containing BA11 Cys was drained, treated with 2 mM TCEP to reduce any cysteine adducts on the introduced C-term thiol group, and protein purified on a Superdex75 26/60 (GE Healthcare) in 20 mM sodium phosphate pH 6.9, 200 mM NaCl. Yields .about.>3 mg/L E. coli for BA11-cys were obtained. All proteins were characterised by reducing and non-reducing SDS PAGE analysis and mass spectrometry. The formation of the desired disulphide bond and free C-terminal cysteine thiol were confirmed by mass spec methods.
[0520] Generation of BA11-C Terminal Cysteine-Maleimide-Peg-Fluorescein (FIG. 27)
[0521] BA11 generated with a C-terminal cysteine (BA11 cys,) was mixed with 4 molar equivalents maleimide-peg-fluorescein in pH 6.9 buffer with 0.3% DMF final, room temperature 0.5-1 hour. SDS PAGE and mass spectrometry showed 60-80% reaction for BA11 cys, lower reaction was due to significant BA11 cys dimer formation. Conjugate was purified by SEC as above, and confirmed by reducing and non-reducing SDS PAGE analysis and mass spectrometry.
[0522] The binding of BA11 and the corresponding C-terminal derivatives and conjugates to serum albumins was determined by SPR
[0523] Determination of the Binding Kinetics of the Half-Life Extension VNAR (BA11) or Fluorescein-Conjugated-BA11 to Human, Mouse, Rat and Cynomolgus Serum Albumin
[0524] Binding kinetics were determined using SPR. The serum albumins or negative control protein were immobilised to COOH.sub.2 chips by amine coupling using optimised buffer conditions as follows:--Human serum albumin (HSA) and mouse serum albumin (MSA) were immobilised in sodium acetate pH 5 buffer. Rat serum albumin (RSA) and cynomolgus serum albumin (CSA) in sodium acetate pH 4.5 buffer and the negative control hen egg lysozyme (HEL) protein was immobilised in sodium acetate pH 5.5 buffer.
[0525] Analytes (BA11, BA11-Fluorescein or 2V negative control binder) were tested at various concentrations and the K.sub.a (M.sup.-1s-.sup.1), K.sub.d(s.sup.-1) and K.sub.D (nM) values were determined using QDat software (SensiQ/Pall ForteBio). For each analyte test experiment, binding to the chosen serum albumin protein was assayed alongside the negative control protein (HEL).
TABLE-US-00028 TABLE 11 Summary of SPR data (K.sub.D nM) for BA11 C terminal derivatives and subsequent fluorescein conjugates with different conjugation chemistries binding to serum albumin proteins. Fl, fluorescein; cys, cysteine; mal, maleimide; SH, thiol; 2V, non-binding VNAR negative control. Serum Albumin Human Rat Mouse Cyano pH 7.4 5.5 7.4 5.5 7.4 5.5 7.4 5.5 BA11 0.636 0.910 2.969 4.389 1.902 4.804 3.360 1.109 BA11-aminoxy 1.118 ND 10.85 ND 8.767 21.20 7.970 ND BA11-oxime-Fl 0.677 1.296 5.725 5.928 4.238 7.442 1.748 5.540 BA11-cys 0.756 1.956 3.370 3.215 ND 3.775 2.103 ND BA11-cys-mal-Fl 1.097 3.160 4.775 7.240 5.064 13.645 3.681 8.205 BA11-SH 0.774 2.229 7.671 12.10 4.764 11.08 3.414 6.738 BA11-S-mal-Fl 1.417 1.912 5.297 7.925 5.004 10.60 2.300 7.010 2V Did not bind
[0526] All BA11 derivatives and conjugates showed high affinity binding to the different serum albumin proteins at both pH 7.4 and pH 5.5. Therefore the methodologies described provide robust high yielding approaches for the site-specific modification and conjugation of VNARs that maintain the binding activity of the protein.
[0527] ROR1 Binding VNARs--AF488 and MMAE Conjugates
[0528] Expression of ROR1 binding VNARs as C-terminal intein fusion proteins enabled generation of ROR1 binding VNARs with unique C-terminal aminoxy and C-terminal thiol groups. This in turn enabling site specific, C-terminal conjugation to fluorescent labels and cytotoxic payloads via oxime forming conjugation chemistry and maleimide chemistry, respectively. Examples of labels and payloads used are shown in FIG. 28.
[0529] ROR1 binding VNAR intein CBD fusion protein immobilised on chitin beads was generated as described above
[0530] Generation of VNAR-ox-vcMMAE and VNAR-ox-MMAE
[0531] The immobilised VNAR intein fusion protein was cleaved with 400 mM O,O'-1,3-propanediylbishydroxylamine (NH.sub.2--O--(CH.sub.2).sub.3--O--NH.sub.2) in cleavage buffer pH 6.9, room temperature overnight. The resulting VNAR containing a C-terminal aminoxy group (VNAR aminoxy) was purified by IMAC or SEC and reacted with 3 molar equivalents of benzaldehyde PEG2 vc PAB MMAE or benzaldehyde PEG4 MMAE in 10% acetonitrile with 10 mM aniline catalyst final, room temperature overnight. Conjugates were purified by IMAC or SEC, sterile filtered and formation of the desired material and final purity confirmed by reducing and non-reducing SDS PAGE analysis and mass spectrometry (FIG. 29)
[0532] Generation of VNAR-S-mal-vcMMAE
[0533] The immobilised VNAR intein fusion protein was cleaved with 100 mM cysteamine in cleavage buffer pH 6.9 with 2 mM TCEP, room temperature overnight. The resulting VNAR containing a C-terminal thiol group (VNAR SH) was purified by IMAC or SEC and reacted with 4 molar equivalents of MC vc PAB MMAE or malAF488. Conjugates were purified by IMAC or SEC, and sterile filtered and formation of the desired material and final purity confirmed by reducing and non-reducing SDS PAGE analysis and mass spectrometry (FIG. 29)
[0534] Characterisation of Anti ROR1 VNAR-MMAE Conjugates--Binding to ROR1 and ROR2 by SPR and Cell Surface Binding by Flow Cytometry
[0535] Binding of VNAR Conjugates to ROR1 and ROR2 by SPR
[0536] The ability of the VNAR-MMAE conjugates and VNAR-fluorescein conjugates to bind to human ROR1 ECD was determined by SPR using the procedures described above.
[0537] As shown in Table 12 VNAR conjugates that were prepared through oxime ligation of benzaldehyde payloads to C-terminal aminoxy VNARs; through thioether ligation of maleimide functionalised payloads to C-terminal thiol VNARs and through thioether ligation of maleimide functionalised payloads to C-terminal Cysteine VNARs all maintain high affinity for human ROR1 but do not bind to human ROR2. Conjugates were prepared using enzyme cleavable linkers (Val-Cit) or non-cleavable linkers and showed similar binding to human ROR1.
TABLE-US-00029 TABLE 12 SPR data for binding of VNARs and corresponding Fluorescein and MMAE conjugates to human ROR1 and ROR2. VNARs were expressed with C-terminal His.sub.6Myc tags. hROR1 VNAR Ka (M.sup.-1s.sup.-1) Kd (s.sup.-1) KD (nM) hROR2 B1 4.75E+05 7.56E-04 1.65 No binding B1 -S- mal- 4.7E+05 3.67E-04 0.81 No binding Fluorescein 2V No binding No binding No binding No binding 2V -S-mal- No binding No binding No binding No binding vcMMAE 2V-Ox- No binding No binding No binding No binding vcMMAE 2V-Ox-MMAE No binding No binding No binding No binding P3A1-P3A1 1.86E+06 2.96E-03 1.61 No binding P3A1-P3A1-S- 4.96E+06 2.6E-03 0.59 No binding mal-vcMMAE P3A1-P3A1- 2.07E+06 2.77E-03 1.43 No binding Ox-vcMMAE P3A1-P3A1- 4.20E+06 3.20E-03 0.78 No binding Ox-MMAE 2V-2V No binding No binding No binding No binding 2V-2V-S-mal- No binding No binding No binding No binding vcMMAE 2V-2V-Ox- No specific No specific No specific No binding vcMMAE binding binding binding 2V-2V-Ox- No binding No binding No binding No binding MMAE
[0538] Binding of VNAR Conjugates to Cancer Cell-Lines
[0539] Binding of B1 and P3A1 MMAE conjugates to cancer cell-lines was determined by flow cytometry using methods described above. B1 and P3A1 conjugates maintain binding to the POR1.sup.hi A549 lung adenocarcinoma cells and do not bind the ROR1.sup.low lung cancer cell-line A427 by flow cytometry at a fixed concentration of protein.
[0540] VNAR mFc Fusion Protein Conjugates
[0541] B1 mIgG2a Fc and nonbinding 2V mIgG2a Fc fusion proteins were labelled with mal AF488 and mc vc PAB MMAE via protocols adapted from the partial reduction and labelling of antibody interchain disulfides (Methods in Molecular Biology vol 1045 chapter 9; Sun et al, Bioconj Chem 2005). Briefly VNAR mIgG2a Fc proteins at 1 mg/ml in PBS+100 mM L-Arg with 1 mM EDTA added were partially reduced with 2.75 molar equivalents fresh TCEP; 37.degree. C. 2 hours. 1.1 molar equivalents maleimide label to free protein thiol was added, incubated on ice 45 mins and L-cysteine added to stop the reaction. Reactions were dialysed to remove unreacted label/drug, sterile filtered and analysed by SDS PAGE. Typical DAR of 4.4 for B1-mFc-AF488, and 3.9 for 2V-mFc-AF488.
[0542] VNAR hFc Fusion Protein Drug Conjugates
[0543] Another approach for generating ADCs is to engineer cysteine substitutions or additions at positions on the light and heavy chains of antibodies and these cysteines provide reactive thiol groups for site specific labelling (Junutula 2008 Nature Biotechnology 26, 925-932, Jeffrey 2013, Sutherland 2016).
[0544] Anti ROR1 VNARs were genetically fused to engineered hIgG1 Fc domains that contained a cysteine substitution in the hIgG1 Fc sequence, S252C or S473C (Kabat numbering). This enabled site specific labelling with maleimide derivatives of fluorescent labels (AF488) and cytotoxic drugs (MC vc PAB MMAE, MC vc PAB NHC.sub.6 .alpha.-amanitin, MA PEG4 va PBD, MA PEG8 va PAB SG3199, MA PEG4 vc PAB DMAE PNU 159682) (FIG. 32).
[0545] Generation of VNAR-hFc--Drug Conjugates
[0546] A partial reduction, refolding and labelling method to label the VNAR Fc S252C was adapted from the literature (Junutula et al, 2008 Nat Biotech, Jeffrey et al, 2013 Bioconj Chem). Briefly, 1 mg/ml VNAR hFc solutions were prepared in PBS+100 mM L-Arginine pH 7.4 with 1 mM EDTA. 20 molar equivalents TCEP added and incubated at 4.degree. C. for a minimum of 48 hours. 30 molar equivalents DHAA added, pH adjusted to 6.5 and incubated at room temperature for 1 hour. Refolded VNAR Fc S252C was extensively dialysed or buffer exchanged into PBS+50 mM L-Arginine and quantified by UV before reacting with 4 molar equivalents maleimide label/drug solution, room temperature 1 hour to overnight depending on label/drug. Conjugates were dialysed/buffer exchanged directly or purified further by SEC or IEX before dialysis/buffer exchange.
[0547] This approach was used to generate MMAE conjugates of B1, P3A1 and 2V Fc fusion proteins whereby the corresponding hIgG1 Fc (S252C) derivative was labelled with a maleimide functionalised MMAE payload incorporating an enzyme cleavable (Cathepsin B) linker.
[0548] A similar approach was used to generate MMAE conjugates of B1-hFc-7C12 and P3A1-hFc-7C12 fusion proteins.
[0549] SDS-PAGE and mass spectrometry analysis of the final conjugates determined that the labelling had proceeded in a quantitative fashion to give highly pure homogenous VNAR-hFc-MMAE conjugates with drug to antibody ratio (DAR) of 2 (FIG. 31). Similar procedures were used to generate PBD dimer, .alpha.-amanitin and PNU conjugates of cysteine engineered VNAR-hFc fusion proteins (Levena Biopharma, San Diego). Whereby VNAR (B1, P3A1, 2V) hIgG1 Fc(S252C) fusions were reacted with MC vc PAB NHC.sub.6 .alpha.-amanitin, MA PEG4 va PBD, MA PEG8 va PAB SG3199, MA PEG4 vc PAB DMAE PNU 159682 (FIG. 32).
[0550] Binding of VNAR-hFc-MMAE Conjugates to hROR1 and Cancer Cell-Lines
[0551] The ability of the VNAR-hFc conjugates to bind to human ROR1 ECD was determined by SPR using the procedures described above.
TABLE-US-00030 TABLE 13 SPR data for binding of VNAR human Fc (hFc) and MMAE conjugated versions to human ROR1 and human ROR2 hROR1 Molecule set Ka (M.sup.-1s.sup.-1) Kd (s.sup.-1) KD (nM) hROR2 B1 hFc 3.08E+06 9.53E-05 0.032 No binding B1 hFc- 1.22E+06 1.29E-04 0.105 No binding MMAE P3A1 hFc 1.07E+07 5.64E-04 0.084 No binding P3A1 hFc- 2.68E+06 1.00E-03 0.38 No binding MMAE 2V hFc No binding No binding No binding No binding 2V hFc - No binding No binding No binding No binding MMAE 2V-2V hFc No binding No binding No binding No binding
[0552] B1 and P3A1 VNAR-hIgG Fc (S252C)-vcMMAE conjugates demonstrated high affinity binding to ROR1 but do not bind to human ROR2. 2V is a non-binding VNAR and the corresponding 2V-hFc drug conjugates were generated as non-binding controls.
[0553] Binding of B1 and P3A1 hFc-vcMMAE conjugates to ROR1.sup.hi A549 lung adenocarcinoma cell-line and the ROR1.sup.low A427 lung cancer cell-line was determined by flow cytometry using methods described above.
[0554] FIG. 30 shows that B1 and P3A1 hFc-vcMMAE conjugates bind strongly to the ROR1.sup.hi cancer cells but not the ROR1.sup.low cancer cells. Whilst the 2V-hFc-vcMMAE conjugate does not bind to either cell-line.
[0555] In Vitro Cell Viability Assays for Cancer Cells Treated with Anti EGFR-ROR1 VNAR Drug Conjugates
[0556] Cells were seeded into white, clear bottom 96 well plates (Costar) and incubated at 37.degree. C., 5% CO.sub.2 for 24 hours. On the following day, dilution series were set up for each test agent at .times.10 working stocks. 10 .mu.L of the .times.10 stock solutions were added to the cell plates (90 .mu.l per well) using a multichannel pipette. This resulted in a 1:10 dilution into the well and dose responses ranging from a top concentration 1000 nM (column 1) to 0.05 nM (column 10). 10 .mu.l of vehicle control (PBS) was added to the control wells (columns 11 and 12). Plates were incubated at 37.degree. C., 5% CO2 for 96 hours. Promega Cell Titre Glo reagent was used as per the manufacturer's instructions to assess cell viability. Briefly, assay plates were removed from the incubator and allowed to equilibrate to room temperature before adding 100 .mu.l of room temperature Cell Titre Glo reagent to each 100 .mu.l assay well. Plates were placed on a plate shaker for 2 minutes at 600 rpm. Plates were allowed to sit for a further 10 minutes at room temperature prior to measuring luminescence read-out using a Clariostar plate-reader (BMG). Data was analysed by calculating the average for untreated (vehicle only) control wells and determining the % of control for each treated well. % of control data was then plotted against Log [Treatment] concentration and the IC.sub.50 value derived using non-linear regression fitting in GraphPad Prism software.
[0557] FIG. 33 shows dose response curves, with corresponding IC50 values, for cell-killing of the ROR1 positive cancer cell-lines A549 (lung adenocarcinoma), MDA-MB-231 (breast cancer), DU145 (prostate cancer), Kasumi-2 (ALL cells) and Jeko1 (MCL cells) by B1-mFc-vcMMAE and 2V-mFc-vcMMAE conjugates. B1-hFc-vcMMAE conjugates show potent cell-killing of the ROR1 positive cancer cells and show superior potency to the corresponding 2V-mFc-vcMMAE conjugate across each of the cell-lines.
TABLE-US-00031 TABLE 14 IC50 values for cell-killing by B1-mFc- MMAE and 2V-mFc-MMAE per cell line. IC50 (nM) Cell line B1 mFc MMAE 2V mFc MMAE A549 24.2 228 MDA-231 36.6 212 DU145 15 75 Kasumi-2 26 240 JeKo-1 8.1 66
[0558] FIG. 34 shows dose response curves, with corresponding IC50 values, for cell-killing of A) the ROR1 positive DU145 prostate cancer cells by B1-hFc-PBD, D3-hFc-PBD and 2V-hFc-PBD conjugates and B) ROR1 positive Jeko1 MCL cells by B1-hFc-PBD, P3A1-hFc-PBD, D3-hFc-PBD and 2V-hFc-PBD conjugates. B1-hFc-vcMMAE conjugates show potent cell-killing of the ROR1 positive cancer cells and are significantly more potent than the corresponding 2V-mFc-vcMMAE conjugates.
TABLE-US-00032 TABLE 15 IC50 values (nM) determined for VNAR hFc-PBD molecules in DU145 and Jeko-1 cancer cell lines at 96 hr. IC50 (nM) Cell Line B1 hFc-PBD P3A1 hFc-PBD D3 hFc-PBD 2V hFc-PBD DU145 4.6 / 29.2 226.2 JeKo-1 0.36 1.9 12.6 25.4
[0559] The ROR1 targeting VNAR-PBD conjugates show potent killing of both cancer cell-lines and show increased potency with respect to the 2V-hFc-PBD conjugate, with the IC50 values for the B1-hFc conjugate at least 49 fold lower than 2V-hFc conjugate.
[0560] FIG. 35 shows dose response curves, with corresponding IC50 values, for cell-killing of the ROR1 positive PA-1 ovarian cancer cells (A, C, E) and Kasumi-2 B-cell precursor leukaemia cells (B, D, F) by B1-hFc-PNU, 2V-hFc-PNU conjugates (PEG4-vc PAB DMAE PNU 159682), P3A1-hFc-PBD, D3-hFc-PBD and 2V-hFc-PBD conjugates and B1-hFc SG3199 PBD and 2V-hFc SG3199 PBD conjugates.
TABLE-US-00033 TABLE 16 Calculated IC50 values (nM) for the cell-killing of PA-1 and Kasumi-2 cancer cells by VNAR-hFc conjugates. PA-1 ROR1 ko is a PA-1 cancer cell-line where ROR1 expression has been knocked out. B1 hFc- P3A1 hFc- 2V-hFc- P3A1 hFc- D3 hFc- 2V hFc- B1 hFc- 2V hFc- vc-PAB- vc-PAB- vc-PAB- va-PBD- va-PBD- va-PBD- va-PAB- va-PAB- DMAE- DMAE- DMAE- SGD1882 SGD1882 SGD1882 SG3199 SG3199 PNU159682 PNU159682 PNU159682 Cell IC50 IC50 IC50 IC50 IC50 IC50 IC50 IC50 Line (nM) (nM) (nM) (nM) (nM) (nM) (nM) (nM) PA-1 0.065 0.34 2.5 0.03 5.9 0.028 0.0027 3.13 PA-1 ND ND ND 0.79 10.5 1.5 3.4 4.5 ROR1 ko Kasumi- 0.52 0.25 6.6 0.06 4.4 0.8 5.1 11 2
[0561] The ROR1 targeting VNAR-conjugates show potent killing of both PA-1 and Kasumi-2 cancer cell-lines and show increased potency with respect to the corresponding 2V-hFc conjugates, with the IC50 values for a number of ROR1 targeting conjugates >100 fold lower than the corresponding 2V-hFc conjugate controls.
Example 10
ROR1 VNAR Bi-Specifics
[0562] Bispecific target combinations for ROR1 binding VNARs include, for example,
[0563] HSA for half-life extension; bispecific engagement of ROR1 and serum albumin
[0564] RTKs e.g. EGFR, Her3; bispecific targeting both EGFR and ROR1 or HER3 and ROR1 on the surface of cells.
[0565] CD3 BiTE approach; examples of CD3 binding sequences for use as an ROR1 VNAR bispecific
[0566] Anti CD3 scFv clone OKT3 (WO 2014028776 Zyngenia) and orientation and humanised derivatives thereof
TABLE-US-00034 VH-[G.sub.4S].sub.3-VL (SEQ ID NO: 96) DIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQGLEWIG YINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCAR YYDDHYCLDYWGQGTTLTVSSGGGGSGGGGSGGGGSDIQLTQSPAIMSA SPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKVASGVPYRFS GSGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELKS
[0567] Humanised anti CD3 scFv UCHT1 (Arnett et al PNAS 2004 101(46) 16268-16273) and derivatives thereof
TABLE-US-00035 VL-[G.sub.4S].sub.3-VH (SEQ ID NO: 97) MDIQMTQTTSSLSASLGDRVTISCRASQDIRNYLNWYQQKPDGTVKLLI YYTSRLHSGVPSKFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPWT FAGGTKLEIKGGGGSGGGGSGGGGSEVQLQQSGPELVKPGASMKISCKA SGYSFTGYTMNWVKQSHGKNLEWMGLINPYKGVSTYNQKFKDKATLTVD KSSSTAYMELLSLTSEDSAVYYCARSGYYGDSDWYFDVWGQGTTLTVFS
Example 11
ROR1 CAR-T Approaches
[0568] Chimeric antigen receptors (CARs) based on the ROR1-specific antigen binding molecules described in the present application may be generated. Furthermore, engineered T cells expressing such a CAR may also be generated, which may then be used in, for example, adoptive cell therapy.
[0569] In brief, a nucleic acid construct encoding a ROR1-specific CAR may be produced. The ROR1-specific CAR may include an intracellular activation domain, a transmembrane domain, and an extracellular domain comprising the ROR1-specific antigen binding molecule described herein. The nucleic acid construct may then be incorporated into a viral vector, such as a retroviral vector (e.g., a lentiviral vector).
[0570] T cells may be isolated from a patient in need of treatment, which may then be modified to express the nucleic acid construct encoding the CAR, for example by retroviral transfection or gene-editing using approaches such as CRISPR-CAS-9.
[0571] The engineered T cells may then be re-infused into the patient in order to treat the condition, such as treatment of cancer.
Example 12
Characterisation of ROR1.times.EGFR Bi-Specific Molecules
[0572] Construction of ROR1.times.EGFR Bispecific Antigen Binding Molecule
[0573] ROR1.times.EGFR bispecific antigen binding molecules were constructed using the EGFR nanobody binders 7C12 or 9G8. 7C12 was chosen because it blocks EGF binding, shows high EGFR affinity (low nM), and has a higher off rate than the related 7D12 (5aa seq difference). 9G8, which binds to a slightly different EGFR epitope and elicits EGFR inhibition via a slightly different mechanism was also chosen.
[0574] The EGFR nanobodies were fused to the ROR1-specific VNARs B1, D3 & D3D3, P3A1 using a [G.sub.4S].sub.5 linker sequence. A His6Myc tag was included for purification and detection.
[0575] Fusions were also generated containing a short sequence of QACGA (SEQ ID NO: 79) between the VNAR and the His6Myc tag or alternatively the sequence -ACA- (SEQ ID NO: 81) between the nanobody and the His6Myc tag to facilitate conjugation with thiol reactive payloads and labels.
[0576] In addition, fusion proteins comprising a ROR1-specific antigen binding molecule, an EGFR-specific nanobody and a human Fc region were constructed.
[0577] ROR1 and EGFR Receptor Number Determination
[0578] ROR1 and EGFR cell receptor numbers were determined for a number of human cancer cell lines using a PE-conjugated ROR1 (2A2) mAb and a PE-conjugated EGFR (AY13) mAb (both Biolegend). Briefly, 5.times.10{circumflex over ( )}5 cells were incubated with PE-conjugated ROR1 2A2 mAb at 5 .mu.g/ml or with 5 .mu.g/ml of PE-conjugated EGFR (AY13) mAb, for 1 hour on ice in the dark. Cells were washed twice by re-suspending into 5 ml of ice-cold PBS/2% FCS and centrifuging at 1500 rpm for 5 min at 4.degree. C. Quantibrite beads (BD Biosciences) were used as per the manufacturer's instructions. Analysis was performed on an Attune N.times.T flow cytometer (ThermoFisher). Receptor numbers (average of n=2) are displayed in Table 17.
[0579] Cell Panel Characterisation
[0580] Cell Surface Binding
[0581] Adherent human cancer cells were detached from tissue culture flasks by incubating with 0.1% EDTA/PBS solution at 37.degree. C. for .about.10 minutes or until cells detached easily. Cells were re-suspended in 5 ml ice-cold PBS/2% FCS in 15 ml tubes and centrifuged at 1500 rpm for 5 mins at 4.degree. C. Supernatant was removed and the cell pellet re-suspended in 1-2 ml of PBS/2% FCS. A cell count was performed using a Z1 Coulter Particle Counter (Beckman Coulter) and 5.times.10{circumflex over ( )}5 cells were aliquoted per test sample. Suspension cells were treated similarly but did not require the initial detachment step. Cells were incubated with 100 .mu.l of either VNAR (His.sub.6Myc tagged), VNAR-Fc molecules or ROR1 mAb, EGFR mAb and IgG controls for 1 hour on ice. Excess VNAR, VNAR-Fc or mAb was removed by adding 5 ml of ice-cold PBS/2% FCS, followed by centrifugation at 1500 rpm for 5 mins at 4.degree. C. The supernatant was removed and a second wash performed by re-suspending the cell pellet in 1 ml of ice-cold PBS/2% FCS and adding a further 4 ml of ice-cold PBS/2% FCS. Samples were again centrifuged at 1500 rpm for 5 min at 4.degree. C. Supernatant was removed and excess liquid removed by blotting the tubes on tissue paper. Appropriate secondary antibodies were used to detect bound VNAR (His.sub.6Myc), VNAR-hFc, or mAb (PE-anti-Myc tag antibody (CST), PE-anti-human antibody (JIR labs/Stratech), and PE-anti-mouse antibody (JIR/Stratech). Cells were incubated with chosen secondary antibody for 30 min on ice. Cells were washed to remove excess antibody as described earlier. Cell pellets were re-suspended in 0.5 ml of ice-cold PBS/2% FCS and left on ice in the dark prior to analysis on an Attune N.times.T (ThermoFisher) flow cytometer.
[0582] A panel of 5 cell lines expressing different levels of ROR1-EGFR was selected for screening bispecific molecules. These cell lines are set out in Table 17
TABLE-US-00036 TABLE 17 Receptor Number EGFR ROR1 EGFR Status High ROR1 - High EGFR A549 118793 9316 wt amplification (K-Ras G12S mutation) Equivalent levels of ROR1/EGFR PA-1 6334 12249 * wt High ROR1 - Low EGFR Kasumi-2 0 8087 Low ROR1 - Medium/Low EGFR A427 27662 222 wt (K-Ras G12D mutation) Low ROR1-Low EGFR Mv4-11 0 0 Cell Lines with EGFR Mutations MDA-MB231 84540 6997 EGFR L468W (K-Ras G13D mutation) PC9 122293 9827 EGFR del.E746_A750 H1975 32584 7987 EGFR L858R + T790M
[0583] Cell surface binding of the B1hFc7C12 bispecific molecule was investigated in A549, PA-1, A427, Kasumi-2 and Mv4-11 cells using flow cytometry at 4.degree. C. as described earlier. A signal uplifting was observed in A549 and PA-1 cell lines between B1hFc7C12 bispecific molecule and its parental single domain molecules B1hFc and hFc7C12 (FIGS. 36A & 36B). A signal uplifting was also observed in the ROR1 low, EGFR positive cell line A427. No binding to the receptor negative Mv4-11 cells was observed.
[0584] Binding of the P3A1hFc7C12 bispecific molecule was investigated in A549, PA-1, A427 and Kasumi-2 cells again using flow cytometry at 4.degree. C. A signal uplifting is observed in A549 cell line between P3A1hFc7C12 bispecific molecule and its parental single domain molecules P3A1hFc and hFc7C12 (FIG. 36C).
[0585] ROR1 and EGFR bi-specific binding agents, without an Fc portion, were also assessed for cell-surface binding in the two different orientations ie ROR1-EGFR and EGFR-ROR1 (FIGS. 37A, 37B and 37C) FIG. 37A shows cell surface binding to A549 cells (high ROR1, high EGFR). An uplift in binding for the ROR1-EGFR bi-specific binding agents with respect to the individual ROR1 and EGFR binding domains is clearly observed for certain constructs.
[0586] FIG. 37B shows cell surface binding to PA-1 cells (high ROR1, medium/low EGFR. Again, an uplift in binding for the ROR1-EGFR bi-specific binding agents with respect to the individual ROR1 and EGFR binding domains is clearly observed.
[0587] However, as shown in FIG. 37C no uplift in binding of the ROR1-EGFR bi-specific binding agents is observed for A427 cells (low ROR1, low EGFR), which is consistent with the bi-specific agents targeting both ROR1 and EGFR on the surface of ROR1+EGFR+ cells.
[0588] Surprisingly, the increase in binding to A549 cells and PA1 cells is dependent on the orientation of the EGFR binding domain (9G8 or 7C12) with respect to the ROR1 binding agent. When the EGFR binding agent is fused C-terminal to the ROR1 binding agent the cell-surface binding is compromised as compared to the same construct but with the EGFR binding agent fused N-terminal to the ROR1 binding agent. Changing the orientation of the domains within the construct therefore provides a method for altering the apparent affinity of the bi-specific agent to the cell-surface.
[0589] A similar observation was observed within the context of Fc fusion proteins (FIG. 38). When the EGFR binding agent 7C12 was fused to the C-terminus of the Fc fragment (hFc 7C12) the binding to the EGFR+ve cell-lines A549, PA-1 and A427 was consistently lower as compared to the corresponding N-terminal fusion (7C12 hFc). Thereby, enabling the cell-surface binding characteristics of ROR1-EGFR bispecific binding agents to be modulated through appropriate design of the corresponding Fc fusion proteins.
[0590] Internalisation Experiments
[0591] Internalisation of ROR1.times.EGFR bi-specific antigen binding molecules was investigated using Immunofluorescence (IF) microscopy in A549 cells.
[0592] Black, clear bottom 96-well plates (Greiner) were coated with 100 .mu.g/ml Collagen I (Sigma) to aid cell attachment. Cells were seeded in complete growth media (Gibco) into the coated 96 well plates and incubated at 5% CO2, 37.degree. C. for 24 hr. The media was removed and replaced with serum-free media (Gibco) on the following day and left overnight. On the following morning, media was removed and cells were treated with VNAR-hFc molecules. Plates were incubated on ice for 30 minutes. Treatments were removed and replaced with 100 .mu.l of PBS/2% FCS per well. One plate was kept on ice and the other was placed at 37.degree. C., 5% CO2 for 2 hours. Following this 2 hour incubation, the PBS/2% FCS solution was removed and cells were fixed with 4% Paraformaldehyde in ice cold PBS for 20 min on ice. The PFA solution was removed and replaced with 0.05% Saponin (Sigma) made up in PBS/2% FCS for 15 min at room temperature. This step permeabilises the cell membranes. Secondary antibody staining was performed using; AF488-anti-human Ab (1:250; ThermoFisher) to detect VNAR-hFc fusion proteins. All secondary antibody working stocks were made up in 0.05% Saponin/PBS/2% FCS. Plates were incubated at 4.degree. C. overnight in the dark. On the following day, secondary AF488-conjugated antibodies were removed and the cells were washed .times.3 using 0.05% Saponin/PBS/2% FCS. Lamp-1 antibody (1:200; CST) or EEA1 antibody (1:50; CST) were added to detect lysosome and early endosome compartments respectively. Plates were incubated in the dark at room temperature for 2 hours. The Lamp-1 and EEA1 antibodies were then removed and the cells were washed .times.3 with 0.05% Saponin/PBS/2% FCS. AF647-anti rabbit antibody (1:1000; CST) was then added to detect Lamp1 and EEA1 antibody binding. A further incubation in the dark at room temperature for 2 hours was performed before removing the AF647-secondary antibody and washing the cells .times.3 with 0.05% Saponin/PBS/2% FCS. Cell nuclei were stained using 10 .mu.M Hoechst reagent (Sigma) in 0.05% Saponin/PBS/2% FCS for 20 min at room temperature in the dark. Finally, this solution was removed and replaced with PBS. Plates were stored at 4.degree. C. in the dark prior to imaging using a GE Healthcare InCell 2000 instrument.
[0593] As shown in FIG. 39, B1hFc7C12 is clearly and strongly internalised by A549 cells after 2 h at 37.degree. C. By contrast, the parental molecules B1hFc and hFc7C12 show lower levels of internalisation and for hFc7C12 only in a few cells.
[0594] Similarly, P3A1hFc7C12 is internalised by A549 cells after 2 h at 37.degree. C. (FIG. 40). Parental molecule hFc7C12 show low levels of internalisation and only in a few cells.
[0595] Additionally, B1hFc7C12 was shown to co-localise with Early Endosome Antigen 1 (EEA1) and Lysosomal-associated membrane protein 1 (LAMP-1) in A549 cells (FIG. 41).
[0596] Internalisation of non-Fc ROR1.times.EGFR bi-specific antigen binding molecules was investigated using flow cytometry as previously described (FIGS. 42A and 42B). The fluorescence signal for the ROR1.times.EGFR bi-specific antigen binding molecules was significantly lower after incubation at 37.degree. C. versus 4.degree. C. indicative of internalisation of the bi-specific proteins upon target binding.
[0597] Surface Receptor Downregulation
[0598] Expression of ROR1 and EGFR in A549 cells was monitored over a 24 hour period following treatment with B1hFc7C12. As shown in FIG. 43A, B1hFc7C12 temporarily downregulates ROR1. B1hFc7C12 also downregulates EGFR with a more prolonged effect: EGFR levels do not return to untreated levels even after 24 hours (FIG. 43B).
[0599] Downregulation of ROR1 and EGFR by P3A1hFc7C12 and D3D3hFc7C12 is observed, whilst downregulation of EGFR by these bi-specific constructs is less obvious (FIGS. 44 to 45).
[0600] Binding to ROR1 and EGFR Proteins
[0601] The ability of ROR1.times.EGFR bi-specific antigen binding molecules to simultaneously engage with both ROR1 and EGFR targets was confirmed by BLI (FIG. 46). hROR1 was immobilised on a sensor and the bi-specific constructs or the constituent mono-specific binders were flowed over the sensor to confirm ROR1 binding. EGFR was then immediately passed over the sensor and binding of the ROR1 immobilised bi-specific binding agent to EGFR then assessed by a second increase in signal.
[0602] Representative examples for a selection of different bi-specific constructs are shown in FIG. 46. Mono-specific ROR1 binding VNAR B1 does not contain an EGFR binding moiety, and so no additional increase in signal is observed when EGFR is flowed over the surface of the sensor.
[0603] Cell Killing by ROR1.times.EGFR Fc Fusion Molecules
[0604] The potency of ROR1.times.EGFR Fc fusion molecules was investigated in a number of cell lines. The results are summarised in table 18. Both the B1hFc-7C12-MMAE and P3A1hFc-7C12-MMAE molecules were shown to be more potent than hFc7C12-MMAE alone
TABLE-US-00037 TABLE 18 B1hFc-7C12-, P3A1hFc-7C12 bispecific-MMAE conjugates and hFc7C12-MMAE were tested in a 96 h cell viability assay using Cell Titer Glo read-out. IC50 (nM) are reported. B1hFc-7C12- MMAE and P3A1hFc-7C12 were more potent than hFc7C12-MMAE alone IC50 (nM) 96 hr IC50 (nM) 96 hr Cell ROR1 EGFR B1hFc-7C12- P3A1hFc-7C12- hFc7C12- B1hFc- 2VhFc- line receptor # receptor # MMAE MMAE MMAE MMAE MMAE A549 9316 118,793 11 197 257 83 >1000 PA-1 12,249 6334 14 32 148 46 641 MDA-MB-468 4107 1,825,000 5.2 25 45 ND ND NCI-H1975 7987 35,800 18.3 83 255 ND ND PC-9 9827 122,293 3.4 15 42 98 692
Sequence CWU
1
1
17218PRTArtificial SequenceAntibody CDR 1Asp Thr Ser Tyr Gly Leu Tyr Ser1
528PRTArtificial SequenceAntibody CDR 2Gly Ala Lys Tyr Gly
Leu Ala Ala1 538PRTArtificial SequenceAntibody CDR 3Gly Ala
Lys Tyr Gly Leu Phe Ala1 548PRTArtificial SequenceAntibody
CDR 4Gly Ala Asn Tyr Gly Leu Ala Ala1 558PRTArtificial
SequenceAntibody CDR 5Gly Ala Asn Tyr Gly Leu Ala Ser1
5610PRTArtificial SequenceAntibody CDR 6Thr Thr Asp Trp Glu Arg Met Ser
Ile Gly1 5 10710PRTArtificial
SequenceAntibody Hypervariable Region 7Ser Ser Asn Gln Glu Arg Ile Ser
Ile Ser1 5 10810PRTArtificial
SequenceAntibody Hypervariable Region 8Ser Ser Asn Lys Glu Gln Ile Ser
Ile Ser1 5 1095PRTArtificial
SequenceAntibody Hypervariable Region 9Asn Lys Arg Ala Lys1
5105PRTArtificial SequenceAntibody Hypervariable Region 10Asn Lys Arg Thr
Met1 5115PRTArtificial SequenceAntibody Hypervariable
Region 11Asn Lys Gly Ala Lys1 5125PRTArtificial
SequenceAntibody Hypervariable Region 12Asn Lys Gly Thr Lys1
51317PRTArtificial SequenceAntibody CDR 13Gln Ser Gly Met Ala Ile Ser
Thr Gly Ser Gly His Gly Tyr Asn Trp1 5 10
15Tyr1417PRTArtificial SequenceAntibody CDR 14Gln Ser
Gly Met Ala Ile Asp Ile Gly Ser Gly His Gly Tyr Asn Trp1 5
10 15Tyr1510PRTArtificial
SequenceAntibody CDR 15Tyr Pro Trp Ala Met Trp Gly Gln Trp Tyr1
5 101614PRTArtificial SequenceAntibody CDR 16Val
Phe Met Pro Gln His Trp His Pro Ala Ala His Trp Tyr1 5
101712PRTArtificial SequenceAntibody CDR 17Arg Glu Ala Arg
His Pro Trp Leu Arg Gln Trp Tyr1 5
101814PRTArtificial SequenceAntibody CDR 18Tyr Pro Trp Gly Ala Gly Ala
Pro Trp Leu Val Gln Trp Tyr1 5
101925PRTArtificial SequenceAntibody Framework Region 19Ala Ser Val Asn
Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Leu Thr
20 252025PRTArtificial SequenceAntibody Framework
Region 20Ala Lys Val Asp Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1
5 10 15Ser Leu Thr Ile
Asn Cys Val Leu Thr 20 252125PRTArtificial
SequenceAntibody Framework Region 21Thr Arg Val Asp Gln Thr Pro Arg Thr
Ala Thr Lys Glu Thr Gly Glu1 5 10
15Ser Leu Thr Ile Asn Cys Val Val Thr 20
252225PRTArtificial SequenceAntibody Framework Region 22Thr Arg Val
Asp Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Leu Thr
20 252325PRTArtificial SequenceAntibody
Framework Region 23Ala Ser Val Asn Gln Thr Pro Arg Thr Ala Thr Lys Glu
Thr Gly Glu1 5 10 15Ser
Leu Thr Ile Asn Cys Val Val Thr 20
252425PRTArtificial SequenceAntibody Framework Region 24Thr Arg Val Asp
Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp1 5
10 15Arg Val Thr Ile Thr Cys Val Leu Thr
20 25259PRTArtificial SequenceAntibody Framework
Region 25Thr Ser Trp Phe Arg Lys Asn Pro Gly1
5269PRTArtificial SequenceAntibody Framework Region 26Thr Tyr Trp Tyr Arg
Lys Asn Pro Gly1 5277PRTArtificial SequenceAntibody
Framework Region 27Gly Arg Tyr Val Glu Ser Val1
5287PRTArtificial SequenceAntibody Framework Region 28Gly Arg Tyr Ser Glu
Ser Val1 52921PRTArtificial SequenceAntibody Framework
Region 29Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr1
5 10 15Tyr Tyr Cys Lys
Ala 203021PRTArtificial SequenceAntibody Framework Region
30Ser Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Ser Ala Thr1
5 10 15Tyr Tyr Cys Arg Ala
203121PRTArtificial SequenceAntibody Framework Region 31Ser Phe Thr
Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr1 5
10 15Tyr Tyr Cys Lys Ala
203210PRTArtificial SequenceAntibody Framework Region 32Asp Gly Ala Gly
Thr Val Leu Thr Val Asn1 5
103310PRTArtificial SequenceAntibody Framework Region 33Asp Gly Ala Gly
Thr Lys Val Glu Ile Lys1 5
103415PRTArtificial SequenceLinear Peptide Sequence 34Tyr Met Glu Ser Leu
His Met Gln Gly Glu Ile Glu Asn Gln Ile1 5
10 153520PRTArtificial SequenceLinear Peptide Sequence
35Cys Gln Pro Trp Asn Ser Gln Tyr Pro His Thr His Thr Phe Thr Ala1
5 10 15Leu Arg Phe Pro
203623PRTArtificial SequenceLinear Peptide Sequence 36Arg Ser Thr Ile
Tyr Gly Ser Arg Leu Arg Ile Arg Asn Leu Asp Thr1 5
10 15Thr Asp Thr Gly Tyr Phe Gln
203736PRTArtificial SequenceLinear Peptide Sequence 37Gln Cys Val Ala Thr
Asn Gly Lys Glu Val Val Ser Ser Thr Gly Val1 5
10 15Leu Phe Val Lys Phe Gly Pro Pro Pro Thr Ala
Ser Pro Gly Tyr Ser 20 25
30Asp Glu Tyr Glu 353822PRTArtificial SequenceECD Peptide 38Arg
Ser Thr Ile Tyr Gly Ser Arg Leu Arg Ile Asn Leu Asp Thr Thr1
5 10 15Asp Thr Gly Tyr Phe Gln
2039112PRTArtificial SequenceSpecific Antigen Binding Molecule
Sequence 39Ala Ser Val Asn Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly
Glu1 5 10 15Ser Leu Thr
Ile Asn Cys Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr 20
25 30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly
Thr Thr Asp Trp Glu Arg 35 40
45Met Ser Ile Gly Gly Arg Tyr Val Glu Ser Val Asn Lys Arg Ala Lys 50
55 60Ser Phe Ser Leu Arg Ile Lys Asp Leu
Thr Val Ala Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Gln Ser Gly Met Ala Ile Ser Thr Gly
Ser Gly 85 90 95His Gly
Tyr Asn Trp Tyr Asp Gly Ala Gly Thr Val Leu Thr Val Asn 100
105 11040112PRTArtificial SequenceSpecific
Antigen Binding Molecule Sequence 40Ala Lys Val Asp Gln Thr Pro Arg Thr
Ala Thr Lys Glu Thr Gly Glu1 5 10
15Ser Leu Thr Ile Asn Cys Val Leu Thr Asp Thr Ser Tyr Gly Leu
Tyr 20 25 30Ser Thr Ser Trp
Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg 35
40 45Met Ser Ile Gly Gly Arg Tyr Val Glu Ser Val Asn
Lys Arg Ala Lys 50 55 60Ser Phe Ser
Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65 70
75 80Tyr Tyr Cys Lys Ala Gln Ser Gly
Met Ala Ile Asp Ile Gly Ser Gly 85 90
95His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly Thr Val Leu Thr
Val Asn 100 105
11041105PRTArtificial SequenceSpecific Antigen Binding Molecule Sequence
41Thr Arg Val Asp Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1
5 10 15Ser Leu Thr Ile Asn Cys
Val Val Thr Gly Ala Lys Tyr Gly Leu Ala 20 25
30Ala Thr Tyr Trp Tyr Arg Lys Asn Pro Gly Ser Ser Asn
Gln Glu Arg 35 40 45Ile Ser Ile
Ser Gly Arg Tyr Val Glu Ser Val Asn Lys Arg Thr Met 50
55 60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala
Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Tyr Pro Trp Ala Met Trp Gly Gln Trp Tyr Asp
85 90 95Gly Ala Gly Thr Val Leu
Thr Val Asn 100 10542109PRTArtificial
SequenceSpecific Antigen Binding Molecule Sequence 42Thr Arg Val Asp Gln
Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Val Thr Gly Ala
Lys Tyr Gly Leu Phe 20 25
30Ala Thr Tyr Trp Tyr Arg Lys Asn Pro Gly Ser Ser Asn Gln Glu Arg
35 40 45Ile Ser Ile Ser Gly Arg Tyr Val
Glu Ser Val Asn Lys Arg Thr Met 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys Ala
Val Phe Met Pro Gln His Trp His Pro Ala Ala 85
90 95His Trp Tyr Asp Gly Ala Gly Thr Val Leu Thr
Val Asn 100 10543107PRTArtificial
SequenceSpecific Antigen Binding Molecule Sequence 43Thr Arg Val Asp Gln
Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Leu Thr Asp Thr
Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg
35 40 45Met Ser Ile Gly Gly Arg Tyr Val
Glu Ser Val Asn Lys Gly Ala Lys 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys Ala
Arg Glu Ala Arg His Pro Trp Leu Arg Gln Trp 85
90 95Tyr Asp Gly Ala Gly Thr Val Leu Thr Val Asn
100 10544109PRTArtificial SequenceSpecific
Antigen Binding Molecule Sequence 44Ala Ser Val Asn Gln Thr Pro Arg Thr
Ala Thr Lys Glu Thr Gly Glu1 5 10
15Ser Leu Thr Ile Asn Cys Val Val Thr Gly Ala Asn Tyr Gly Leu
Ala 20 25 30Ala Thr Tyr Trp
Tyr Arg Lys Asn Pro Gly Ser Ser Asn Gln Glu Arg 35
40 45Ile Ser Ile Ser Gly Arg Tyr Val Glu Ser Val Asn
Lys Arg Thr Met 50 55 60Ser Phe Ser
Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65 70
75 80Tyr Tyr Cys Lys Ala Tyr Pro Trp
Gly Ala Gly Ala Pro Trp Leu Val 85 90
95Gln Trp Tyr Asp Gly Ala Gly Thr Val Leu Thr Val Asn
100 10545109PRTArtificial SequenceSpecific Antigen
Binding Molecule Sequence 45Thr Arg Val Asp Gln Ser Pro Ser Ser Leu Ser
Ala Ser Val Gly Asp1 5 10
15Arg Val Thr Ile Thr Cys Val Leu Thr Gly Ala Asn Tyr Gly Leu Ala
20 25 30Ser Thr Tyr Trp Tyr Arg Lys
Asn Pro Gly Ser Ser Asn Lys Glu Gln 35 40
45Ile Ser Ile Ser Gly Arg Tyr Ser Glu Ser Val Asn Lys Gly Thr
Lys 50 55 60Ser Phe Thr Leu Thr Ile
Ser Ser Leu Gln Pro Glu Asp Ser Ala Thr65 70
75 80Tyr Tyr Cys Arg Ala Tyr Pro Trp Gly Ala Gly
Ala Pro Trp Leu Val 85 90
95Gln Trp Tyr Asp Gly Ala Gly Thr Lys Val Glu Ile Lys 100
10546109PRTArtificial SequenceSpecific Antigen Binding
Molecule Sequence 46Thr Arg Val Asp Gln Ser Pro Ser Ser Leu Ser Ala Ser
Val Gly Asp1 5 10 15Arg
Val Thr Ile Thr Cys Val Leu Thr Gly Ala Asn Tyr Gly Leu Ala 20
25 30Ser Thr Tyr Trp Tyr Arg Lys Asn
Pro Gly Ser Ser Asn Gln Glu Arg 35 40
45Ile Ser Ile Ser Gly Arg Tyr Ser Glu Ser Val Asn Lys Arg Thr Met
50 55 60Ser Phe Thr Leu Thr Ile Ser Ser
Leu Gln Pro Glu Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Arg Ala Tyr Pro Trp Gly Ala Gly Ala Pro
Trp Leu Val 85 90 95Gln
Trp Tyr Asp Gly Ala Gly Thr Lys Val Glu Ile Lys 100
10547107PRTArtificial SequenceSpecific Antigen Binding Molecule
Sequence 47Thr Arg Val Asp Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly
Asp1 5 10 15Arg Val Thr
Ile Thr Cys Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr 20
25 30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly
Thr Thr Asp Trp Glu Arg 35 40
45Met Ser Ile Gly Gly Arg Tyr Val Glu Ser Val Asn Lys Gly Ala Lys 50
55 60Ser Phe Thr Leu Thr Ile Ser Ser Leu
Gln Pro Glu Asp Phe Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Arg Glu Ala Arg His Pro Trp Leu Arg
Gln Trp 85 90 95Tyr Asp
Gly Ala Gly Thr Lys Val Glu Ile Lys 100
10548107PRTArtificial SequenceSpecific Antigen Binding Molecule Sequence
48Thr Arg Val Asp Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp1
5 10 15Arg Val Thr Ile Thr Cys
Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Tyr Trp Tyr Arg Lys Asn Pro Gly Ser Ser Asn
Lys Glu Gln 35 40 45Ile Ser Ile
Ser Gly Arg Tyr Ser Glu Ser Val Asn Lys Gly Thr Lys 50
55 60Ser Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu
Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Arg Ala Arg Glu Ala Arg His Pro Trp Leu Arg Gln Trp
85 90 95Tyr Asp Gly Ala Gly Thr
Lys Val Glu Ile Lys 100 10549107PRTArtificial
SequenceSpecific Antigen Binding Molecule Sequence 49Thr Arg Val Asp Gln
Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp1 5
10 15Arg Val Thr Ile Thr Cys Val Leu Thr Asp Thr
Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Tyr Trp Tyr Arg Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg
35 40 45Met Ser Ile Gly Gly Arg Tyr Ser
Glu Ser Val Asn Lys Gly Ala Lys 50 55
60Ser Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Arg Ala
Arg Glu Ala Arg His Pro Trp Leu Arg Gln Trp 85
90 95Tyr Asp Gly Ala Gly Thr Lys Val Glu Ile Lys
100 10550112PRTArtificial SequenceSpecific
Antigen Binding Molecule Sequence 50Ala Ser Val Asn Gln Ser Pro Ser Ser
Leu Ser Ala Ser Val Gly Asp1 5 10
15Arg Val Thr Ile Thr Cys Val Leu Thr Asp Thr Ser Tyr Gly Leu
Tyr 20 25 30Ser Thr Ser Trp
Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg 35
40 45Met Ser Ile Gly Gly Arg Tyr Ser Glu Ser Val Asn
Lys Gly Ala Lys 50 55 60Ser Phe Thr
Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Ser Ala Thr65 70
75 80Tyr Tyr Cys Lys Ala Gln Ser Gly
Met Ala Ile Ser Thr Gly Ser Gly 85 90
95His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly Thr Lys Val Glu
Ile Lys 100 105
11051112PRTArtificial SequenceSpecific Antigen Binding Molecule Sequence
51Thr Arg Val Asp Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp1
5 10 15Arg Val Thr Ile Thr Cys
Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp
Trp Glu Arg 35 40 45Met Ser Ile
Gly Gly Arg Tyr Ser Glu Ser Val Asn Lys Gly Ala Lys 50
55 60Ser Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu
Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly
85 90 95His Gly Tyr Asn Trp Tyr
Asp Gly Ala Gly Thr Lys Val Glu Ile Lys 100
105 11052112PRTArtificial SequenceSpecific Antigen
Binding Molecule Sequence 52Ala Ser Val Asn Gln Ser Pro Ser Ser Ala Ser
Ala Ser Val Gly Asp1 5 10
15Arg Leu Thr Ile Thr Cys Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr
20 25 30Ser Thr Ser Trp Phe Arg Lys
Asn Pro Gly Thr Thr Asp Trp Glu Arg 35 40
45Met Ser Ile Gly Gly Arg Tyr Ser Glu Ser Val Asn Lys Gly Ala
Lys 50 55 60Ser Phe Thr Leu Thr Ile
Ser Ser Leu Gln Pro Glu Asp Ser Ala Thr65 70
75 80Tyr Tyr Cys Lys Ala Gln Ser Gly Met Ala Ile
Ser Thr Gly Ser Gly 85 90
95His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly Thr Lys Leu Glu Val Lys
100 105 11053109PRTArtificial
SequenceSpecific Antigen Binding Molecule Sequence 53Ala Ser Val Asp Gln
Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp1 5
10 15Arg Val Thr Ile Thr Cys Val Val Thr Gly Ala
Asn Tyr Gly Leu Ala 20 25
30Ala Thr Tyr Trp Tyr Arg Lys Asn Pro Gly Ser Ser Asn Gln Glu Arg
35 40 45Ile Ser Ile Ser Gly Arg Tyr Ser
Glu Ser Val Asn Lys Arg Thr Met 50 55
60Ser Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys Ala
Tyr Pro Trp Gly Ala Gly Ala Pro Trp Leu Val 85
90 95Gln Trp Tyr Asp Gly Ala Gly Thr Lys Val Glu
Ile Lys 100 10554109PRTArtificial
SequenceSpecific Antigen Binding Molecule Sequence 54Ala Ser Val Asp Gln
Ser Pro Ser Ser Ala Ser Ala Ser Val Gly Asp1 5
10 15Arg Leu Thr Ile Thr Cys Val Val Thr Gly Ala
Asn Tyr Gly Leu Ala 20 25
30Ala Thr Tyr Trp Tyr Arg Lys Asn Pro Gly Ser Ser Asn Gln Glu Arg
35 40 45Ile Ser Ile Ser Gly Arg Tyr Ser
Glu Ser Val Asn Lys Arg Thr Met 50 55
60Ser Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys Ala
Tyr Pro Trp Gly Ala Gly Ala Pro Trp Leu Val 85
90 95Gln Trp Tyr Asp Gly Ala Gly Thr Lys Leu Glu
Val Lys 100 10555112PRTArtificial
SequenceSpecific Antigen Binding Molecule Sequence 55Ala Ser Val Asn Gln
Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp1 5
10 15Arg Val Thr Ile Thr Cys Val Leu Thr Asp Thr
Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg
35 40 45Met Ser Ile Gly Gly Arg Tyr Val
Glu Ser Val Asn Lys Arg Ala Lys 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys Ala
Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly 85
90 95His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly Thr
Lys Val Glu Ile Lys 100 105
11056112PRTArtificial SequenceSpecific Antigen Binding Molecule Sequence
56Ala Ser Val Asn Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp1
5 10 15Arg Val Thr Ile Thr Cys
Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp
Trp Glu Arg 35 40 45Met Ser Ile
Gly Gly Arg Tyr Val Glu Ser Val Asn Lys Arg Ala Lys 50
55 60Ser Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu
Asp Phe Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly
85 90 95His Gly Tyr Asn Trp Tyr
Asp Gly Ala Gly Thr Lys Val Glu Ile Lys 100
105 11057112PRTArtificial SequenceSpecific Antigen
Binding Molecule Sequence 57Ala Ser Val Asn Gln Ser Pro Ser Ser Leu Ser
Ala Ser Val Gly Asp1 5 10
15Arg Val Thr Ile Thr Cys Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr
20 25 30Ser Thr Ser Trp Phe Arg Lys
Asn Pro Gly Thr Thr Asp Trp Glu Arg 35 40
45Met Ser Ile Gly Gly Arg Phe Ser Gly Ser Gly Ser Lys Arg Ala
Lys 50 55 60Ser Phe Thr Leu Thr Ile
Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr65 70
75 80Tyr Tyr Cys Lys Ala Gln Ser Gly Met Ala Ile
Ser Thr Gly Ser Gly 85 90
95His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly Thr Lys Val Glu Ile Lys
100 105 11058112PRTArtificial
SequenceSpecific Antigen Binding Molecule Sequence 58Ala Ser Val Asn Gln
Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp1 5
10 15Arg Val Thr Ile Thr Cys Val Leu Thr Asp Thr
Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Tyr Gln Gln Lys Pro Gly Thr Thr Asp Trp Glu Arg
35 40 45Met Ser Ile Gly Gly Arg Tyr Val
Glu Ser Val Asn Lys Arg Ala Lys 50 55
60Ser Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr65
70 75 80Tyr Tyr Cys Lys Ala
Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly 85
90 95His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly Thr
Lys Val Glu Ile Lys 100 105
11059112PRTArtificial SequenceSpecific Antigen Binding Molecule Sequence
59Ala Ser Val Asn Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp1
5 10 15Arg Val Thr Ile Thr Cys
Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Tyr Gln Gln Lys Pro Gly Thr Thr Asp
Trp Glu Arg 35 40 45Met Ser Ile
Gly Gly Arg Phe Ser Gly Ser Gly Ser Lys Arg Ala Lys 50
55 60Ser Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu
Asp Phe Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly
85 90 95His Gly Tyr Asn Trp Tyr
Asp Gly Ala Gly Thr Lys Val Glu Ile Lys 100
105 1106015PRTArtificial SequenceLinker Sequence 60Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser1 5
10 156125PRTArtificial SequenceLinker
Sequence 61Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly1 5 10 15Gly Gly Gly
Ser Gly Gly Gly Gly Ser 20 25627PRTArtificial
SequenceLinker Sequence 62Pro Gly Val Gln Pro Ser Pro1
56312PRTArtificial SequenceLinker Sequence 63Pro Gly Val Gln Pro Ser Pro
Gly Gly Gly Gly Ser1 5
106412PRTArtificial SequenceLinker Sequence 64Pro Gly Val Gln Pro Ala Pro
Gly Gly Gly Gly Ser1 5
1065107PRTArtificial SequenceSpecific Antigen Binding Molecule Sequence
65Thr Arg Val Asp Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1
5 10 15Ser Leu Thr Ile Asn Cys
Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp
Trp Glu Arg 35 40 45Met Ser Ile
Gly Gly Arg Tyr Val Glu Ser Val Asn Lys Gly Ala Lys 50
55 60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala
Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Gln Ser Leu Ala Ile Ser Thr Arg Ser Tyr Trp
85 90 95Tyr Asp Gly Ala Gly Thr
Val Leu Thr Val Asn 100 10566103PRTArtificial
SequenceSpecific Antigen Binding Molecule Sequence 66Thr Arg Val Asp Gln
Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp1 5
10 15Arg Val Thr Ile Thr Cys Val Leu Thr Asp Thr
Ser Tyr Pro Leu Tyr 20 25
30Ser Thr Tyr Trp Tyr Arg Lys Asn Pro Gly Ser Ser Asn Lys Glu Gln
35 40 45Ile Ser Ile Ser Gly Arg Tyr Ser
Glu Ser Val Asn Lys Gly Thr Lys 50 55
60Ser Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Arg Ala
Met Ser Thr Asn Ile Trp Thr Gly Asp Gly Ala 85
90 95Gly Thr Lys Val Glu Ile Lys
1006725PRTArtificial SequenceTag Sequence 67Gln Ala Cys Gly Ala His His
His His His His Gly Ala Glu Phe Glu1 5 10
15Gln Lys Leu Ile Ser Glu Glu Asp Leu 20
256810PRTArtificial SequenceTag Sequence 68Glu Gln Lys Leu
Ile Ser Glu Glu Asp Leu1 5
106925PRTArtificial SequenceTag Sequence 69Gln Ala Ser Gly Ala His His
His His His His Gly Ala Glu Phe Glu1 5 10
15Gln Lys Leu Ile Ser Glu Glu Asp Leu 20
257025PRTArtificial SequenceTag Sequence 70Gln Ala Cys Lys
Ala His His His His His His Gly Ala Glu Phe Glu1 5
10 15Gln Lys Leu Ile Ser Glu Glu Asp Leu
20 257123PRTArtificial SequenceTag Sequence 71Ala
Ala Ala His His His His His His Gly Ala Glu Phe Glu Gln Lys1
5 10 15Leu Ile Ser Glu Glu Asp Leu
207223PRTArtificial SequenceTag Sequence 72Ala Cys Ala His His
His His His His Gly Ala Glu Phe Glu Gln Lys1 5
10 15Leu Ile Ser Glu Glu Asp Leu
207311PRTArtificial SequenceTag Sequence 73Gln Ala Ser Gly Ala His His
His His His His1 5 107411PRTArtificial
SequenceTag Sequence 74Gln Ala Cys Gly Ala His His His His His His1
5 107511PRTArtificial SequenceTag Sequence
75Gln Ala Cys Lys Ala His His His His His His1 5
10769PRTArtificial SequenceTag Sequence 76Ala Ala Ala His His His
His His His1 5779PRTArtificial SequenceTag Sequence 77Ala
Cys Ala His His His His His His1 5785PRTArtificial
SequenceTag Sequence 78Gln Ala Ser Gly Ala1
5795PRTArtificial SequenceTag Sequence 79Gln Ala Cys Gly Ala1
5805PRTArtificial SequenceTag Sequence 80Gln Ala Cys Lys Ala1
5813PRTArtificial SequenceTag Sequence 81Ala Cys Ala1825PRTArtificial
SequenceTag Sequence 82Ser Ala Pro Ser Ala1
583124PRTArtificial SequenceSpecific Antigen Binding Molecule Sequence
83Ala Val Gln Leu Val Glu Ser Gly Gly Gly Ser Val Gln Ala Gly Gly1
5 10 15Ser Leu Arg Leu Thr Cys
Ala Ala Ser Gly Arg Thr Ser Arg Ser Tyr 20 25
30Gly Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg
Glu Phe Val 35 40 45Ser Gly Ile
Ser Trp Arg Gly Asp Ser Thr Gly Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Val Asp65 70 75
80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Ile Tyr Tyr Cys
85 90 95Ala Ala Ala Ala Gly Ser
Thr Trp Tyr Gly Thr Leu Tyr Glu Tyr Asp 100
105 110Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser
115 12084124PRTArtificial SequenceSpecific Antigen
Binding Molecule Sequence 84Gln Val Lys Leu Glu Glu Ser Gly Gly Gly Ser
Val Gln Thr Gly Gly1 5 10
15Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly Arg Thr Ser Arg Ser Tyr
20 25 30Gly Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr Gly Tyr Ala Asp Ser
Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Val Asp65 70
75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr
Ala Ile Tyr Tyr Cys 85 90
95Ala Ala Ala Ala Gly Ser Ala Trp Tyr Gly Thr Leu Tyr Glu Tyr Asp
100 105 110Tyr Trp Gly Gln Gly Thr
Gln Val Thr Val Ser Ser 115 12085127PRTArtificial
SequenceSpecific Antigen Binding Molecule Sequence Sequence 85Glu
Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala
Ala Ser Gly Arg Thr Phe Ser Ser Tyr 20 25
30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Phe Val 35 40 45Val Ala Ile Asn
Trp Ser Ser Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn
Thr Met Tyr65 70 75
80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Ala Gly Tyr Gln Ile
Asn Ser Gly Asn Tyr Asn Phe Lys Asp Tyr 100
105 110Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr
Val Ser Ser 115 120
12586129PRTArtificial SequenceSpecific Antigen Binding Molecule Sequence
86Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Arg Thr Phe Ser Ser Tyr 20 25
30Val Met Gly Trp Phe Arg Gln Ala Thr Gly Lys Glu Arg
Glu Phe Val 35 40 45Ala Thr Ile
Ala Trp Asp Ser Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Val His65 70 75
80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Ala Ser Tyr Asn Val
Tyr Tyr Asn Asn Tyr Tyr Tyr Pro Ile Ser 100
105 110Arg Asp Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln
Val Thr Val Ser 115 120
125Ser87232PRTArtificial SequenceSpecific Antigen Binding Molecule
Sequence 87Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro
Ala1 5 10 15Pro Glu Leu
Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro 20
25 30Lys Asp Thr Leu Met Ile Ser Arg Thr Pro
Glu Val Thr Cys Val Val 35 40
45Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val 50
55 60Asp Gly Val Glu Val His Asn Ala Lys
Thr Lys Pro Arg Glu Glu Gln65 70 75
80Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu
His Gln 85 90 95Asp Trp
Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala 100
105 110Leu Pro Ala Pro Ile Glu Lys Thr Ile
Ser Lys Ala Lys Gly Gln Pro 115 120
125Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr
130 135 140Lys Asn Gln Val Ser Leu Thr
Cys Leu Val Lys Gly Phe Tyr Pro Ser145 150
155 160Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro
Glu Asn Asn Tyr 165 170
175Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr
180 185 190Ser Lys Leu Thr Val Asp
Lys Ser Arg Trp Gln Gln Gly Asn Val Phe 195 200
205Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr
Gln Lys 210 215 220Ser Leu Ser Leu Ser
Pro Gly Lys225 23088232PRTArtificial SequenceSpecific
Antigen Binding Molecule Sequence 88Glu Pro Lys Ser Ser Asp Lys Thr His
Thr Cys Pro Pro Cys Pro Ala1 5 10
15Pro Glu Leu Leu Gly Gly Pro Cys Val Phe Leu Phe Pro Pro Lys
Pro 20 25 30Lys Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val 35
40 45Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe
Asn Trp Tyr Val 50 55 60Asp Gly Val
Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln65 70
75 80Tyr Asn Ser Thr Tyr Arg Val Val
Ser Val Leu Thr Val Leu His Gln 85 90
95Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn
Lys Ala 100 105 110Leu Pro Ala
Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro 115
120 125Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser
Arg Asp Glu Leu Thr 130 135 140Lys Asn
Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser145
150 155 160Asp Ile Ala Val Glu Trp Glu
Ser Asn Gly Gln Pro Glu Asn Asn Tyr 165
170 175Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser
Phe Phe Leu Tyr 180 185 190Ser
Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe 195
200 205Ser Cys Ser Val Met His Glu Ala Leu
His Asn His Tyr Thr Gln Lys 210 215
220Ser Leu Ser Leu Ser Pro Gly Lys225
23089232PRTArtificial SequenceSpecific Antigen Binding Molecule Sequence
89Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala1
5 10 15Pro Glu Leu Leu Gly Gly
Pro Ser Val Phe Leu Phe Pro Pro Lys Pro 20 25
30Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr
Cys Val Val 35 40 45Val Asp Val
Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val 50
55 60Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro
Arg Glu Glu Gln65 70 75
80Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln
85 90 95Asp Trp Leu Asn Gly Lys
Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala 100
105 110Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala
Lys Gly Gln Pro 115 120 125Arg Glu
Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr 130
135 140Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys
Gly Phe Tyr Pro Ser145 150 155
160Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
165 170 175Lys Thr Thr Pro
Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr 180
185 190Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln
Gln Gly Asn Val Phe 195 200 205Ser
Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys 210
215 220Ser Leu Cys Leu Ser Pro Gly Lys225
23090147PRTArtificial SequenceSpecific Antigen Binding Molecule
Sequence 90Ala Val Gln Leu Val Glu Ser Gly Gly Gly Ser Val Gln Ala Gly
Gly1 5 10 15Ser Leu Arg
Leu Thr Cys Ala Ala Ser Gly Arg Thr Ser Arg Ser Tyr 20
25 30Gly Met Gly Trp Phe Arg Gln Ala Pro Gly
Lys Glu Arg Glu Phe Val 35 40
45Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr Gly Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asn Ala Lys Asn Thr Val Asp65 70 75
80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Ile Tyr
Tyr Cys 85 90 95Ala Ala
Ala Ala Gly Ser Thr Trp Tyr Gly Thr Leu Tyr Glu Tyr Asp 100
105 110Tyr Trp Gly Gln Gly Thr Gln Val Thr
Val Ser Ser Ala Ala Ala His 115 120
125His His His His His Gly Ala Glu Phe Glu Gln Lys Leu Ile Ser Glu
130 135 140Glu Asp
Leu14591151PRTArtificial SequenceSpecific Antigen Binding Molecule
Sequence 91Met Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala
Gly1 5 10 15Gly Ser Leu
Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Ser 20
25 30Tyr Ala Met Gly Trp Phe Arg Gln Ala Pro
Gly Lys Glu Arg Glu Phe 35 40
45Val Val Ala Ile Asn Trp Ser Ser Gly Ser Thr Tyr Tyr Ala Asp Ser 50
55 60Val Lys Gly Arg Phe Thr Ile Ser Arg
Asp Asn Ala Lys Asn Thr Met65 70 75
80Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val
Tyr Tyr 85 90 95Cys Ala
Ala Gly Tyr Gln Ile Asn Ser Gly Asn Tyr Asn Phe Lys Asp 100
105 110Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly
Thr Gln Val Thr Val Ser Ser 115 120
125Ala Ala Ala His His His His His His Gly Ala Glu Phe Glu Gln Lys
130 135 140Leu Ile Ser Glu Glu Asp Leu145
15092249PRTArtificial SequenceSpecific Antigen Binding
Molecule Sequence 92Ala Ser Val Asn Gln Thr Pro Arg Thr Ala Thr Lys Glu
Thr Gly Glu1 5 10 15Ser
Leu Thr Ile Asn Cys Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr 20
25 30Ser Thr Ser Trp Phe Arg Lys Asn
Pro Gly Thr Thr Asp Trp Glu Arg 35 40
45Met Ser Ile Gly Gly Arg Tyr Val Glu Ser Val Asn Lys Arg Ala Lys
50 55 60Ser Phe Ser Leu Arg Ile Lys Asp
Leu Thr Val Ala Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Gln Ser Gly Met Ala Ile Ser Thr
Gly Ser Gly 85 90 95His
Gly Tyr Asn Trp Tyr Asp Gly Ala Gly Thr Val Leu Thr Val Asn
100 105 110Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala Ser Val Asn Gln Thr
Pro 130 135 140Arg Thr Ala Thr Lys Glu
Thr Gly Glu Ser Leu Thr Ile Asn Cys Val145 150
155 160Leu Thr Asp Thr Ser Tyr Gly Leu Tyr Ser Thr
Ser Trp Phe Arg Lys 165 170
175Asn Pro Gly Thr Thr Asp Trp Glu Arg Met Ser Ile Gly Gly Arg Tyr
180 185 190Val Glu Ser Val Asn Lys
Arg Ala Lys Ser Phe Ser Leu Arg Ile Lys 195 200
205Asp Leu Thr Val Ala Asp Ser Ala Thr Tyr Tyr Cys Lys Ala
Gln Ser 210 215 220Gly Met Ala Ile Ser
Thr Gly Ser Gly His Gly Tyr Asn Trp Tyr Asp225 230
235 240Gly Ala Gly Thr Val Leu Thr Val Asn
24593233PRTArtificial SequenceSpecific Antigen Binding Molecule
Sequence 93Glu Pro Arg Gly Pro Thr Ile Lys Pro Cys Pro Pro Cys Lys Cys
Pro1 5 10 15Ala Pro Asn
Leu Leu Gly Gly Pro Ser Val Phe Ile Phe Pro Pro Lys 20
25 30Ile Lys Asp Val Leu Met Ile Ser Leu Ser
Pro Ile Val Thr Cys Val 35 40
45Val Val Asp Val Ser Glu Asp Asp Pro Asp Val Gln Ile Ser Trp Phe 50
55 60Val Asn Asn Val Glu Val His Thr Ala
Gln Thr Gln Thr His Arg Glu65 70 75
80Asp Tyr Asn Ser Thr Leu Arg Val Val Ser Ala Leu Pro Ile
Gln His 85 90 95Gln Asp
Trp Met Ser Gly Lys Glu Phe Lys Cys Lys Val Asn Asn Lys 100
105 110Asp Leu Pro Ala Pro Ile Glu Arg Thr
Ile Ser Lys Pro Lys Gly Ser 115 120
125Val Arg Ala Pro Gln Val Tyr Val Leu Pro Pro Pro Glu Glu Glu Met
130 135 140Thr Lys Lys Gln Val Thr Leu
Thr Cys Met Val Thr Asp Phe Met Pro145 150
155 160Glu Asp Ile Tyr Val Glu Trp Thr Asn Asn Gly Lys
Thr Glu Leu Asn 165 170
175Tyr Lys Asn Thr Glu Pro Val Leu Asp Ser Asp Gly Ser Tyr Phe Met
180 185 190Tyr Ser Lys Leu Arg Val
Glu Lys Lys Asn Trp Val Glu Arg Asn Ser 195 200
205Tyr Ser Cys Ser Val Val His Glu Gly Leu His Asn His His
Thr Thr 210 215 220Lys Ser Phe Ser Arg
Thr Pro Gly Lys225 23094232PRTArtificial SequenceSpecific
Antigen Binding Molecule Sequence 94Glu Pro Lys Ser Ser Asp Lys Thr His
Thr Cys Pro Pro Cys Pro Ala1 5 10
15Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys
Pro 20 25 30Lys Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val 35
40 45Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe
Asn Trp Tyr Val 50 55 60Asp Gly Val
Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln65 70
75 80Tyr Asn Ser Thr Tyr Arg Val Val
Ser Val Leu Thr Val Leu His Gln 85 90
95Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn
Lys Ala 100 105 110Leu Pro Ala
Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro 115
120 125Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser
Arg Asp Glu Leu Thr 130 135 140Lys Asn
Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser145
150 155 160Asp Ile Ala Val Glu Trp Glu
Ser Asn Gly Gln Pro Glu Asn Asn Tyr 165
170 175Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser
Phe Phe Leu Tyr 180 185 190Ser
Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe 195
200 205Ser Cys Ser Val Met His Glu Ala Leu
His Asn His Tyr Thr Gln Lys 210 215
220Ser Leu Ser Leu Ser Pro Gly Lys225
2309526PRTArtificial SequenceTag Sequence 95Gln Ala Ser Gly Ala His His
His His His His Gly Ala Glu Phe Glu1 5 10
15Gln Lys Leu Ile Ser Glu Glu Asp Leu Gly 20
2596241PRTArtificial SequenceSpecific Antigen Binding
Molecule Sequence 96Asp Ile Lys Leu Gln Gln Ser Gly Ala Glu Leu Ala Arg
Pro Gly Ala1 5 10 15Ser
Val Lys Met Ser Cys Lys Thr Ser Gly Tyr Thr Phe Thr Arg Tyr 20
25 30Thr Met His Trp Val Lys Gln Arg
Pro Gly Gln Gly Leu Glu Trp Ile 35 40
45Gly Tyr Ile Asn Pro Ser Arg Gly Tyr Thr Asn Tyr Asn Gln Lys Phe
50 55 60Lys Asp Lys Ala Thr Leu Thr Thr
Asp Lys Ser Ser Ser Thr Ala Tyr65 70 75
80Met Gln Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val
Tyr Tyr Cys 85 90 95Ala
Arg Tyr Tyr Asp Asp His Tyr Cys Leu Asp Tyr Trp Gly Gln Gly
100 105 110Thr Thr Leu Thr Val Ser Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly 115 120
125Ser Gly Gly Gly Gly Ser Asp Ile Gln Leu Thr Gln Ser Pro Ala
Ile 130 135 140Met Ser Ala Ser Pro Gly
Glu Lys Val Thr Met Thr Cys Arg Ala Ser145 150
155 160Ser Ser Val Ser Tyr Met Asn Trp Tyr Gln Gln
Lys Ser Gly Thr Ser 165 170
175Pro Lys Arg Trp Ile Tyr Asp Thr Ser Lys Val Ala Ser Gly Val Pro
180 185 190Tyr Arg Phe Ser Gly Ser
Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile 195 200
205Ser Ser Met Glu Ala Glu Asp Ala Ala Thr Tyr Tyr Cys Gln
Gln Trp 210 215 220Ser Ser Asn Pro Leu
Thr Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys225 230
235 240Ser97245PRTArtificial SequenceSpecific
Antigen Binding Molecule Sequence 97Met Asp Ile Gln Met Thr Gln Thr Thr
Ser Ser Leu Ser Ala Ser Leu1 5 10
15Gly Asp Arg Val Thr Ile Ser Cys Arg Ala Ser Gln Asp Ile Arg
Asn 20 25 30Tyr Leu Asn Trp
Tyr Gln Gln Lys Pro Asp Gly Thr Val Lys Leu Leu 35
40 45Ile Tyr Tyr Thr Ser Arg Leu His Ser Gly Val Pro
Ser Lys Phe Ser 50 55 60Gly Ser Gly
Ser Gly Thr Asp Tyr Ser Leu Thr Ile Ser Asn Leu Glu65 70
75 80Gln Glu Asp Ile Ala Thr Tyr Phe
Cys Gln Gln Gly Asn Thr Leu Pro 85 90
95Trp Thr Phe Ala Gly Gly Thr Lys Leu Glu Ile Lys Gly Gly
Gly Gly 100 105 110Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Gln 115
120 125Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala
Ser Met Lys Ile Ser 130 135 140Cys Lys
Ala Ser Gly Tyr Ser Phe Thr Gly Tyr Thr Met Asn Trp Val145
150 155 160Lys Gln Ser His Gly Lys Asn
Leu Glu Trp Met Gly Leu Ile Asn Pro 165
170 175Tyr Lys Gly Val Ser Thr Tyr Asn Gln Lys Phe Lys
Asp Lys Ala Thr 180 185 190Leu
Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr Met Glu Leu Leu Ser 195
200 205Leu Thr Ser Glu Asp Ser Ala Val Tyr
Tyr Cys Ala Arg Ser Gly Tyr 210 215
220Tyr Gly Asp Ser Asp Trp Tyr Phe Asp Val Trp Gly Gln Gly Thr Thr225
230 235 240Leu Thr Val Phe
Ser 24598105PRTArtificial SequenceE7 Protein Sequence
98Thr Arg Val Asp Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1
5 10 15Ser Leu Thr Ile Asn Cys
Val Val Thr Gly Ala Lys Tyr Gly Leu Ala 20 25
30Ala Thr Tyr Trp Tyr Arg Lys Asn Pro Gly Ser Ser Asn
Gln Glu Arg 35 40 45Ile Ser Ile
Ser Gly Arg Tyr Val Glu Ser Val Asn Lys Arg Thr Met 50
55 60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala
Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Tyr Pro Trp Ala Met Trp Gly Gln Trp Tyr Asp
85 90 95Gly Ala Gly Thr Val Leu
Thr Val Asn 100 10599109PRTArtificial
SequenceCPF7 Protein Sequence 99Thr Arg Val Asp Gln Thr Pro Arg Thr Ala
Thr Lys Glu Thr Gly Glu1 5 10
15Ser Leu Thr Ile Asn Cys Val Val Thr Gly Ala Lys Tyr Gly Leu Phe
20 25 30Ala Thr Tyr Trp Tyr Arg
Lys Asn Pro Gly Ser Ser Asn Gln Glu Arg 35 40
45Ile Ser Ile Ser Gly Arg Tyr Val Glu Ser Val Asn Lys Arg
Thr Met 50 55 60Ser Phe Ser Leu Arg
Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65 70
75 80Tyr Tyr Cys Lys Ala Val Phe Met Pro Gln
His Trp His Pro Ala Ala 85 90
95His Trp Tyr Asp Gly Ala Gly Thr Val Leu Thr Val Asn 100
105100130PRTArtificial SequenceE7 Protein Sequence 100Thr
Arg Val Asp Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1
5 10 15Ser Leu Thr Ile Asn Cys Val
Val Thr Gly Ala Lys Tyr Gly Leu Ala 20 25
30Ala Thr Tyr Trp Tyr Arg Lys Asn Pro Gly Ser Ser Asn Gln
Glu Arg 35 40 45Ile Ser Ile Ser
Gly Arg Tyr Val Glu Ser Val Asn Lys Arg Thr Met 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp
Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Tyr Pro Trp Ala Met Trp Gly Gln Trp Tyr Asp
85 90 95Gly Ala Gly Thr Val Leu
Thr Val Asn Gln Ala Ser Gly Ala His His 100
105 110His His His His Gly Ala Glu Phe Glu Gln Lys Leu
Ile Ser Glu Glu 115 120 125Asp Leu
130101134PRTArtificial SequenceCPF7 Protein Sequence 101Thr Arg Val
Asp Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Val Thr
Gly Ala Lys Tyr Gly Leu Phe 20 25
30Ala Thr Tyr Trp Tyr Arg Lys Asn Pro Gly Ser Ser Asn Gln Glu Arg
35 40 45Ile Ser Ile Ser Gly Arg Tyr
Val Glu Ser Val Asn Lys Arg Thr Met 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys
Ala Val Phe Met Pro Gln His Trp His Pro Ala Ala 85
90 95His Trp Tyr Asp Gly Ala Gly Thr Val Leu
Thr Val Asn Gln Ala Ser 100 105
110Gly Ala His His His His His His Gly Ala Glu Phe Glu Gln Lys Leu
115 120 125Ile Ser Glu Glu Asp Leu
130102132PRTArtificial SequenceP3A1 Protein Sequence 102Thr Arg Val Asp
Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Leu Thr Asp
Thr Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg
35 40 45Met Ser Ile Gly Gly Arg Tyr Val
Glu Ser Val Asn Lys Gly Ala Lys 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys Ala
Arg Glu Ala Arg His Pro Trp Leu Arg Gln Trp 85
90 95Tyr Asp Gly Ala Gly Thr Val Leu Thr Val Asn
Gln Ala Ser Gly Ala 100 105
110His His His His His His Gly Ala Glu Phe Glu Gln Lys Leu Ile Ser
115 120 125Glu Glu Asp Leu
130103134PRTArtificial SequenceB1 Protein Sequence 103Ala Ser Val Asn Gln
Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Val Thr Gly Ala
Asn Tyr Gly Leu Ala 20 25
30Ala Thr Tyr Trp Tyr Arg Lys Asn Pro Gly Ser Ser Asn Gln Glu Arg
35 40 45Ile Ser Ile Ser Gly Arg Tyr Val
Glu Ser Val Asn Lys Arg Thr Met 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys Ala
Tyr Pro Trp Gly Ala Gly Ala Pro Trp Leu Val 85
90 95Gln Trp Tyr Asp Gly Ala Gly Thr Val Leu Thr
Val Asn Gln Ala Ser 100 105
110Gly Ala His His His His His His Gly Ala Glu Phe Glu Gln Lys Leu
115 120 125Ile Ser Glu Glu Asp Leu
130104137PRTArtificial SequenceD3 Protein Sequence 104Ala Ser Val Asn Gln
Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Leu Thr Asp Thr
Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg
35 40 45Met Ser Ile Gly Gly Arg Tyr Val
Glu Ser Val Asn Lys Arg Ala Lys 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys Ala
Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly 85
90 95His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly Thr
Val Leu Thr Val Asn 100 105
110Gln Ala Ser Gly Ala His His His His His His Gly Ala Glu Phe Glu
115 120 125Gln Lys Leu Ile Ser Glu Glu
Asp Leu 130 135105137PRTArtificial SequenceE9 Protein
Sequence 105Ala Lys Val Asp Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly
Glu1 5 10 15Ser Leu Thr
Ile Asn Cys Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr 20
25 30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly
Thr Thr Asp Trp Glu Arg 35 40
45Met Ser Ile Gly Gly Arg Tyr Val Glu Ser Val Asn Lys Arg Ala Lys 50
55 60Ser Phe Ser Leu Arg Ile Lys Asp Leu
Thr Val Ala Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Gln Ser Gly Met Ala Ile Asp Ile Gly
Ser Gly 85 90 95His Gly
Tyr Asn Trp Tyr Asp Gly Ala Gly Thr Val Leu Thr Val Asn 100
105 110Gln Ala Ser Gly Ala His His His His
His His Gly Ala Glu Phe Glu 115 120
125Gln Lys Leu Ile Ser Glu Glu Asp Leu 130
135106248PRTArtificial SequenceLinker Mouse IgG2a Sequence 106Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu1 5
10 15Pro Arg Gly Pro Thr Ile Lys Pro Cys
Pro Pro Cys Lys Cys Pro Ala 20 25
30Pro Asn Leu Leu Gly Gly Pro Ser Val Phe Ile Phe Pro Pro Lys Ile
35 40 45Lys Asp Val Leu Met Ile Ser
Leu Ser Pro Ile Val Thr Cys Val Val 50 55
60Val Asp Val Ser Glu Asp Asp Pro Asp Val Gln Ile Ser Trp Phe Val65
70 75 80Asn Asn Val Glu
Val His Thr Ala Gln Thr Gln Thr His Arg Glu Asp 85
90 95Tyr Asn Ser Thr Leu Arg Val Val Ser Ala
Leu Pro Ile Gln His Gln 100 105
110Asp Trp Met Ser Gly Lys Glu Phe Lys Cys Lys Val Asn Asn Lys Asp
115 120 125Leu Pro Ala Pro Ile Glu Arg
Thr Ile Ser Lys Pro Lys Gly Ser Val 130 135
140Arg Ala Pro Gln Val Tyr Val Leu Pro Pro Pro Glu Glu Glu Met
Thr145 150 155 160Lys Lys
Gln Val Thr Leu Thr Cys Met Val Thr Asp Phe Met Pro Glu
165 170 175Asp Ile Tyr Val Glu Trp Thr
Asn Asn Gly Lys Thr Glu Leu Asn Tyr 180 185
190Lys Asn Thr Glu Pro Val Leu Asp Ser Asp Gly Ser Tyr Phe
Met Tyr 195 200 205Ser Lys Leu Arg
Val Glu Lys Lys Asn Trp Val Glu Arg Asn Ser Tyr 210
215 220Ser Cys Ser Val Val His Glu Gly Leu His Asn His
His Thr Thr Lys225 230 235
240Ser Phe Ser Arg Thr Pro Gly Lys 245107247PRTArtificial
SequenceLinker Human IgG1 Sequence 107Gly Gly Gly Gly Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Glu1 5 10
15Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala
Pro 20 25 30Glu Leu Leu Gly
Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys 35
40 45Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr
Cys Val Val Val 50 55 60Asp Val Ser
His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp65 70
75 80Gly Val Glu Val His Asn Ala Lys
Thr Lys Pro Arg Glu Glu Gln Tyr 85 90
95Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His
Gln Asp 100 105 110Trp Leu Asn
Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu 115
120 125Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala
Lys Gly Gln Pro Arg 130 135 140Glu Pro
Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys145
150 155 160Asn Gln Val Ser Leu Thr Cys
Leu Val Lys Gly Phe Tyr Pro Ser Asp 165
170 175Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu
Asn Asn Tyr Lys 180 185 190Thr
Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 195
200 205Lys Leu Thr Val Asp Lys Ser Arg Trp
Gln Gln Gly Asn Val Phe Ser 210 215
220Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser225
230 235 240Leu Ser Leu Ser
Pro Gly Lys 245108247PRTArtificial SequenceLinker Human
IgG1 Sequence 108Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
Ser Glu1 5 10 15Pro Lys
Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro 20
25 30Glu Leu Leu Gly Gly Pro Cys Val Phe
Leu Phe Pro Pro Lys Pro Lys 35 40
45Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val 50
55 60Asp Val Ser His Glu Asp Pro Glu Val
Lys Phe Asn Trp Tyr Val Asp65 70 75
80Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu
Gln Tyr 85 90 95Asn Ser
Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp 100
105 110Trp Leu Asn Gly Lys Glu Tyr Lys Cys
Lys Val Ser Asn Lys Ala Leu 115 120
125Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg
130 135 140Glu Pro Gln Val Tyr Thr Leu
Pro Pro Ser Arg Asp Glu Leu Thr Lys145 150
155 160Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe
Tyr Pro Ser Asp 165 170
175Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys
180 185 190Thr Thr Pro Pro Val Leu
Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 195 200
205Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val
Phe Ser 210 215 220Cys Ser Val Met His
Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser225 230
235 240Leu Ser Leu Ser Pro Gly Lys
245109247PRTArtificial SequenceLinker Human IgG1 Sequence 109Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu1 5
10 15Pro Lys Ser Ser Asp Lys Thr His Thr
Cys Pro Pro Cys Pro Ala Pro 20 25
30Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys
35 40 45Asp Thr Leu Met Ile Ser Arg
Thr Pro Glu Val Thr Cys Val Val Val 50 55
60Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp65
70 75 80Gly Val Glu Val
His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr 85
90 95Asn Ser Thr Tyr Arg Val Val Ser Val Leu
Thr Val Leu His Gln Asp 100 105
110Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu
115 120 125Pro Ala Pro Ile Glu Lys Thr
Ile Ser Lys Ala Lys Gly Gln Pro Arg 130 135
140Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr
Lys145 150 155 160Asn Gln
Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp
165 170 175Ile Ala Val Glu Trp Glu Ser
Asn Gly Gln Pro Glu Asn Asn Tyr Lys 180 185
190Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
Tyr Ser 195 200 205Lys Leu Thr Val
Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser 210
215 220Cys Ser Val Met His Glu Ala Leu His Asn His Tyr
Thr Gln Lys Ser225 230 235
240Leu Cys Leu Ser Pro Gly Lys 245110252PRTArtificial
SequenceLinker Human IgG1 Sequence 110Asp Lys Thr His Thr Cys Pro Pro Cys
Pro Ala Pro Glu Leu Leu Gly1 5 10
15Gly Pro Cys Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu
Met 20 25 30Ile Ser Arg Thr
Pro Glu Val Thr Cys Val Val Val Asp Val Ser His 35
40 45Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp
Gly Val Glu Val 50 55 60His Asn Ala
Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr65 70
75 80Arg Val Val Ser Val Leu Thr Val
Leu His Gln Asp Trp Leu Asn Gly 85 90
95Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala
Pro Ile 100 105 110Glu Lys Thr
Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val 115
120 125Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr
Lys Asn Gln Val Ser 130 135 140Leu Thr
Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu145
150 155 160Trp Glu Ser Asn Gly Gln Pro
Glu Asn Asn Tyr Lys Thr Thr Pro Pro 165
170 175Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser
Lys Leu Thr Val 180 185 190Asp
Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met 195
200 205His Glu Ala Leu His Asn His Tyr Thr
Gln Lys Ser Leu Ser Leu Ser 210 215
220Pro Gly Lys Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly225
230 235 240Gly Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser 245
250111371PRTArtificial Sequence7C12 hFc (S252C) 111Ala Val Gln Leu Val
Glu Ser Gly Gly Gly Ser Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly Arg
Thr Ser Arg Ser Tyr 20 25
30Gly Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ser Gly Ile Ser Trp Arg Gly Asp
Ser Thr Gly Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asp65
70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Ile Tyr Tyr Cys 85
90 95Ala Ala Ala Ala Gly Ser Thr Trp Tyr Gly Thr
Leu Tyr Glu Tyr Asp 100 105
110Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly Gly Gly Gly
115 120 125Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Glu Pro Lys Ser Ser 130 135
140Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu
Gly145 150 155 160Gly Pro
Cys Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met
165 170 175Ile Ser Arg Thr Pro Glu Val
Thr Cys Val Val Val Asp Val Ser His 180 185
190Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val
Glu Val 195 200 205His Asn Ala Lys
Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr 210
215 220Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp
Trp Leu Asn Gly225 230 235
240Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile
245 250 255Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val 260
265 270Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys
Asn Gln Val Ser 275 280 285Leu Thr
Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu 290
295 300Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
Lys Thr Thr Pro Pro305 310 315
320Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val
325 330 335Asp Lys Ser Arg
Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met 340
345 350His Glu Ala Leu His Asn His Tyr Thr Gln Lys
Ser Leu Ser Leu Ser 355 360 365Pro
Gly Lys 370112382PRTArtificial SequencehFc (S252C) 7C12 112Glu Pro Lys
Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala1 5
10 15Pro Glu Leu Leu Gly Gly Pro Cys Val
Phe Leu Phe Pro Pro Lys Pro 20 25
30Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val
35 40 45Val Asp Val Ser His Glu Asp
Pro Glu Val Lys Phe Asn Trp Tyr Val 50 55
60Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln65
70 75 80Tyr Asn Ser Thr
Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln 85
90 95Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys
Lys Val Ser Asn Lys Ala 100 105
110Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro
115 120 125Arg Glu Pro Gln Val Tyr Thr
Leu Pro Pro Ser Arg Asp Glu Leu Thr 130 135
140Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro
Ser145 150 155 160Asp Ile
Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
165 170 175Lys Thr Thr Pro Pro Val Leu
Asp Ser Asp Gly Ser Phe Phe Leu Tyr 180 185
190Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn
Val Phe 195 200 205Ser Cys Ser Val
Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys 210
215 220Ser Leu Ser Leu Ser Pro Gly Lys Gly Gly Gly Gly
Ser Gly Gly Gly225 230 235
240Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
245 250 255Ser Ala Val Gln Leu
Val Glu Ser Gly Gly Gly Ser Val Gln Ala Gly 260
265 270Gly Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly Arg
Thr Ser Arg Ser 275 280 285Tyr Gly
Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe 290
295 300Val Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr
Gly Tyr Ala Asp Ser305 310 315
320Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val
325 330 335Asp Leu Gln Met
Asn Ser Leu Lys Pro Glu Asp Thr Ala Ile Tyr Tyr 340
345 350Cys Ala Ala Ala Ala Gly Ser Thr Trp Tyr Gly
Thr Leu Tyr Glu Tyr 355 360 365Asp
Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly 370
375 380113506PRTArtificial SequenceB1 hFc (S252C) 7C12
113Ala Ser Val Asn Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1
5 10 15Ser Leu Thr Ile Asn Cys
Val Val Thr Gly Ala Asn Tyr Gly Leu Ala 20 25
30Ala Thr Tyr Trp Tyr Arg Lys Asn Pro Gly Ser Ser Asn
Gln Glu Arg 35 40 45Ile Ser Ile
Ser Gly Arg Tyr Val Glu Ser Val Asn Lys Arg Thr Met 50
55 60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala
Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Tyr Pro Trp Gly Ala Gly Ala Pro Trp Leu Val
85 90 95Gln Trp Tyr Asp Gly Ala
Gly Thr Val Leu Thr Val Asn Gly Gly Gly 100
105 110Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Glu Pro Lys Ser 115 120 125Ser Asp
Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu 130
135 140Gly Gly Pro Cys Val Phe Leu Phe Pro Pro Lys
Pro Lys Asp Thr Leu145 150 155
160Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser
165 170 175His Glu Asp Pro
Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu 180
185 190Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu
Gln Tyr Asn Ser Thr 195 200 205Tyr
Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn 210
215 220Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn
Lys Ala Leu Pro Ala Pro225 230 235
240Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro
Gln 245 250 255Val Tyr Thr
Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val 260
265 270Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr
Pro Ser Asp Ile Ala Val 275 280
285Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro 290
295 300Pro Val Leu Asp Ser Asp Gly Ser
Phe Phe Leu Tyr Ser Lys Leu Thr305 310
315 320Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe
Ser Cys Ser Val 325 330
335Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu
340 345 350Ser Pro Gly Lys Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 355 360
365Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala
Val Gln 370 375 380Leu Val Glu Ser Gly
Gly Gly Ser Val Gln Ala Gly Gly Ser Leu Arg385 390
395 400Leu Thr Cys Ala Ala Ser Gly Arg Thr Ser
Arg Ser Tyr Gly Met Gly 405 410
415Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ser Gly Ile
420 425 430Ser Trp Arg Gly Asp
Ser Thr Gly Tyr Ala Asp Ser Val Lys Gly Arg 435
440 445Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val
Asp Leu Gln Met 450 455 460Asn Ser Leu
Lys Pro Glu Asp Thr Ala Ile Tyr Tyr Cys Ala Ala Ala465
470 475 480Ala Gly Ser Thr Trp Tyr Gly
Thr Leu Tyr Glu Tyr Asp Tyr Trp Gly 485
490 495Gln Gly Thr Gln Val Thr Val Ser Ser Gly
500 505114504PRTArtificial SequenceP3A1 hFc (S252C) 7C12
114Thr Arg Val Asp Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1
5 10 15Ser Leu Thr Ile Asn Cys
Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp
Trp Glu Arg 35 40 45Met Ser Ile
Gly Gly Arg Tyr Val Glu Ser Val Asn Lys Gly Ala Lys 50
55 60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala
Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Arg Glu Ala Arg His Pro Trp Leu Arg Gln Trp
85 90 95Tyr Asp Gly Ala Gly Thr
Val Leu Thr Val Asn Gly Gly Gly Gly Ser 100
105 110Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Pro
Lys Ser Ser Asp 115 120 125Lys Thr
His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly 130
135 140Pro Cys Val Phe Leu Phe Pro Pro Lys Pro Lys
Asp Thr Leu Met Ile145 150 155
160Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu
165 170 175Asp Pro Glu Val
Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His 180
185 190Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr
Asn Ser Thr Tyr Arg 195 200 205Val
Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys 210
215 220Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala
Leu Pro Ala Pro Ile Glu225 230 235
240Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val
Tyr 245 250 255Thr Leu Pro
Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu 260
265 270Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser
Asp Ile Ala Val Glu Trp 275 280
285Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val 290
295 300Leu Asp Ser Asp Gly Ser Phe Phe
Leu Tyr Ser Lys Leu Thr Val Asp305 310
315 320Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys
Ser Val Met His 325 330
335Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro
340 345 350Gly Lys Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly 355 360
365Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala Val Gln
Leu Val 370 375 380Glu Ser Gly Gly Gly
Ser Val Gln Ala Gly Gly Ser Leu Arg Leu Thr385 390
395 400Cys Ala Ala Ser Gly Arg Thr Ser Arg Ser
Tyr Gly Met Gly Trp Phe 405 410
415Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ser Gly Ile Ser Trp
420 425 430Arg Gly Asp Ser Thr
Gly Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr 435
440 445Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asp Leu
Gln Met Asn Ser 450 455 460Leu Lys Pro
Glu Asp Thr Ala Ile Tyr Tyr Cys Ala Ala Ala Ala Gly465
470 475 480Ser Thr Trp Tyr Gly Thr Leu
Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly 485
490 495Thr Gln Val Thr Val Ser Ser Gly
500115646PRTArtificial SequenceD3D3 hFc (S252C) 7C12 115Ala Ser Val Asn
Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Leu Thr Asp
Thr Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg
35 40 45Met Ser Ile Gly Gly Arg Tyr Val
Glu Ser Val Asn Lys Arg Ala Lys 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys Ala
Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly 85
90 95His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly Thr
Val Leu Thr Val Asn 100 105
110Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Ala Ser Val Asn Gln Thr Pro 130 135
140Arg Thr Ala Thr Lys Glu Thr Gly Glu Ser Leu Thr Ile Asn Cys
Val145 150 155 160Leu Thr
Asp Thr Ser Tyr Gly Leu Tyr Ser Thr Ser Trp Phe Arg Lys
165 170 175Asn Pro Gly Thr Thr Asp Trp
Glu Arg Met Ser Ile Gly Gly Arg Tyr 180 185
190Val Glu Ser Val Asn Lys Arg Ala Lys Ser Phe Ser Leu Arg
Ile Lys 195 200 205Asp Leu Thr Val
Ala Asp Ser Ala Thr Tyr Tyr Cys Lys Ala Gln Ser 210
215 220Gly Met Ala Ile Ser Thr Gly Ser Gly His Gly Tyr
Asn Trp Tyr Asp225 230 235
240Gly Ala Gly Thr Val Leu Thr Val Asn Gly Gly Gly Gly Ser Gly Gly
245 250 255Gly Gly Ser Gly Gly
Gly Gly Ser Glu Pro Lys Ser Ser Asp Lys Thr 260
265 270His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu
Gly Gly Pro Cys 275 280 285Val Phe
Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg 290
295 300Thr Pro Glu Val Thr Cys Val Val Val Asp Val
Ser His Glu Asp Pro305 310 315
320Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala
325 330 335Lys Thr Lys Pro
Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 340
345 350Ser Val Leu Thr Val Leu His Gln Asp Trp Leu
Asn Gly Lys Glu Tyr 355 360 365Lys
Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 370
375 380Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr Leu385 390 395
400Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr
Cys 405 410 415Leu Val Lys
Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 420
425 430Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr
Thr Pro Pro Val Leu Asp 435 440
445Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser 450
455 460Arg Trp Gln Gln Gly Asn Val Phe
Ser Cys Ser Val Met His Glu Ala465 470
475 480Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu
Ser Pro Gly Lys 485 490
495Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
500 505 510Gly Gly Gly Ser Gly Gly
Gly Gly Ser Ala Val Gln Leu Val Glu Ser 515 520
525Gly Gly Gly Ser Val Gln Ala Gly Gly Ser Leu Arg Leu Thr
Cys Ala 530 535 540Ala Ser Gly Arg Thr
Ser Arg Ser Tyr Gly Met Gly Trp Phe Arg Gln545 550
555 560Ala Pro Gly Lys Glu Arg Glu Phe Val Ser
Gly Ile Ser Trp Arg Gly 565 570
575Asp Ser Thr Gly Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser
580 585 590Arg Asp Asn Ala Lys
Asn Thr Val Asp Leu Gln Met Asn Ser Leu Lys 595
600 605Pro Glu Asp Thr Ala Ile Tyr Tyr Cys Ala Ala Ala
Ala Gly Ser Thr 610 615 620Trp Tyr Gly
Thr Leu Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln625
630 635 640Val Thr Val Ser Ser Gly
645116281PRTArtificial SequenceB1-7C12 AAA his myc 116Ala Ser Val
Asn Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Val Thr
Gly Ala Asn Tyr Gly Leu Ala 20 25
30Ala Thr Tyr Trp Tyr Arg Lys Asn Pro Gly Ser Ser Asn Gln Glu Arg
35 40 45Ile Ser Ile Ser Gly Arg Tyr
Val Glu Ser Val Asn Lys Arg Thr Met 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys
Ala Tyr Pro Trp Gly Ala Gly Ala Pro Trp Leu Val 85
90 95Gln Trp Tyr Asp Gly Ala Gly Thr Val Leu
Thr Val Asn Gly Gly Gly 100 105
110Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
115 120 125Ser Gly Gly Gly Gly Ser Ala
Val Gln Leu Val Glu Ser Gly Gly Gly 130 135
140Ser Val Gln Ala Gly Gly Ser Leu Arg Leu Thr Cys Ala Ala Ser
Gly145 150 155 160Arg Thr
Ser Arg Ser Tyr Gly Met Gly Trp Phe Arg Gln Ala Pro Gly
165 170 175Lys Glu Arg Glu Phe Val Ser
Gly Ile Ser Trp Arg Gly Asp Ser Thr 180 185
190Gly Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg
Asp Asn 195 200 205Ala Lys Asn Thr
Val Asp Leu Gln Met Asn Ser Leu Lys Pro Glu Asp 210
215 220Thr Ala Ile Tyr Tyr Cys Ala Ala Ala Ala Gly Ser
Thr Trp Tyr Gly225 230 235
240Thr Leu Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val
245 250 255Ser Ser Ala Ala Ala
His His His His His His Gly Ala Glu Phe Glu 260
265 270Gln Lys Leu Ile Ser Glu Glu Asp Leu 275
280117281PRTArtificial SequenceB1-7C12 ACA his myc 117Ala
Ser Val Asn Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1
5 10 15Ser Leu Thr Ile Asn Cys Val
Val Thr Gly Ala Asn Tyr Gly Leu Ala 20 25
30Ala Thr Tyr Trp Tyr Arg Lys Asn Pro Gly Ser Ser Asn Gln
Glu Arg 35 40 45Ile Ser Ile Ser
Gly Arg Tyr Val Glu Ser Val Asn Lys Arg Thr Met 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp
Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Tyr Pro Trp Gly Ala Gly Ala Pro Trp Leu Val
85 90 95Gln Trp Tyr Asp Gly Ala
Gly Thr Val Leu Thr Val Asn Gly Gly Gly 100
105 110Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly 115 120 125Ser Gly
Gly Gly Gly Ser Ala Val Gln Leu Val Glu Ser Gly Gly Gly 130
135 140Ser Val Gln Ala Gly Gly Ser Leu Arg Leu Thr
Cys Ala Ala Ser Gly145 150 155
160Arg Thr Ser Arg Ser Tyr Gly Met Gly Trp Phe Arg Gln Ala Pro Gly
165 170 175Lys Glu Arg Glu
Phe Val Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr 180
185 190Gly Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr
Ile Ser Arg Asp Asn 195 200 205Ala
Lys Asn Thr Val Asp Leu Gln Met Asn Ser Leu Lys Pro Glu Asp 210
215 220Thr Ala Ile Tyr Tyr Cys Ala Ala Ala Ala
Gly Ser Thr Trp Tyr Gly225 230 235
240Thr Leu Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr
Val 245 250 255Ser Ser Ala
Cys Ala His His His His His His Gly Ala Glu Phe Glu 260
265 270Gln Lys Leu Ile Ser Glu Glu Asp Leu
275 280118283PRTArtificial Sequence7C12-B1 QASGA his myc
118Ala Val Gln Leu Val Glu Ser Gly Gly Gly Ser Val Gln Ala Gly Gly1
5 10 15Ser Leu Arg Leu Thr Cys
Ala Ala Ser Gly Arg Thr Ser Arg Ser Tyr 20 25
30Gly Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg
Glu Phe Val 35 40 45Ser Gly Ile
Ser Trp Arg Gly Asp Ser Thr Gly Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Val Asp65 70 75
80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Ile Tyr Tyr Cys
85 90 95Ala Ala Ala Ala Gly Ser
Thr Trp Tyr Gly Thr Leu Tyr Glu Tyr Asp 100
105 110Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser
Gly Gly Gly Gly 115 120 125Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser 130
135 140Gly Gly Gly Gly Ser Ala Ser Val Asn Gln Thr
Pro Arg Thr Ala Thr145 150 155
160Lys Glu Thr Gly Glu Ser Leu Thr Ile Asn Cys Val Val Thr Gly Ala
165 170 175Asn Tyr Gly Leu
Ala Ala Thr Tyr Trp Tyr Arg Lys Asn Pro Gly Ser 180
185 190Ser Asn Gln Glu Arg Ile Ser Ile Ser Gly Arg
Tyr Val Glu Ser Val 195 200 205Asn
Lys Arg Thr Met Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val 210
215 220Ala Asp Ser Ala Thr Tyr Tyr Cys Lys Ala
Tyr Pro Trp Gly Ala Gly225 230 235
240Ala Pro Trp Leu Val Gln Trp Tyr Asp Gly Ala Gly Thr Val Leu
Thr 245 250 255Val Asn Gln
Ala Ser Gly Ala His His His His His His Gly Ala Glu 260
265 270Phe Glu Gln Lys Leu Ile Ser Glu Glu Asp
Leu 275 280119283PRTArtificial Sequence7C12-B1
QACGA his myc 119Ala Val Gln Leu Val Glu Ser Gly Gly Gly Ser Val Gln Ala
Gly Gly1 5 10 15Ser Leu
Arg Leu Thr Cys Ala Ala Ser Gly Arg Thr Ser Arg Ser Tyr 20
25 30Gly Met Gly Trp Phe Arg Gln Ala Pro
Gly Lys Glu Arg Glu Phe Val 35 40
45Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr Gly Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asn Ala Lys Asn Thr Val Asp65 70 75
80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Ile Tyr
Tyr Cys 85 90 95Ala Ala
Ala Ala Gly Ser Thr Trp Tyr Gly Thr Leu Tyr Glu Tyr Asp 100
105 110Tyr Trp Gly Gln Gly Thr Gln Val Thr
Val Ser Ser Gly Gly Gly Gly 115 120
125Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
130 135 140Gly Gly Gly Gly Ser Ala Ser
Val Asn Gln Thr Pro Arg Thr Ala Thr145 150
155 160Lys Glu Thr Gly Glu Ser Leu Thr Ile Asn Cys Val
Val Thr Gly Ala 165 170
175Asn Tyr Gly Leu Ala Ala Thr Tyr Trp Tyr Arg Lys Asn Pro Gly Ser
180 185 190Ser Asn Gln Glu Arg Ile
Ser Ile Ser Gly Arg Tyr Val Glu Ser Val 195 200
205Asn Lys Arg Thr Met Ser Phe Ser Leu Arg Ile Lys Asp Leu
Thr Val 210 215 220Ala Asp Ser Ala Thr
Tyr Tyr Cys Lys Ala Tyr Pro Trp Gly Ala Gly225 230
235 240Ala Pro Trp Leu Val Gln Trp Tyr Asp Gly
Ala Gly Thr Val Leu Thr 245 250
255Val Asn Gln Ala Cys Gly Ala His His His His His His Gly Ala Glu
260 265 270Phe Glu Gln Lys Leu
Ile Ser Glu Glu Asp Leu 275 280120284PRTArtificial
SequenceB1-9G8 AAA his myc 120Ala Ser Val Asn Gln Thr Pro Arg Thr Ala Thr
Lys Glu Thr Gly Glu1 5 10
15Ser Leu Thr Ile Asn Cys Val Val Thr Gly Ala Asn Tyr Gly Leu Ala
20 25 30Ala Thr Tyr Trp Tyr Arg Lys
Asn Pro Gly Ser Ser Asn Gln Glu Arg 35 40
45Ile Ser Ile Ser Gly Arg Tyr Val Glu Ser Val Asn Lys Arg Thr
Met 50 55 60Ser Phe Ser Leu Arg Ile
Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65 70
75 80Tyr Tyr Cys Lys Ala Tyr Pro Trp Gly Ala Gly
Ala Pro Trp Leu Val 85 90
95Gln Trp Tyr Asp Gly Ala Gly Thr Val Leu Thr Val Asn Gly Gly Gly
100 105 110Gly Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly 115 120
125Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly
Gly Gly 130 135 140Leu Val Gln Ala Gly
Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly145 150
155 160Arg Thr Phe Ser Ser Tyr Ala Met Gly Trp
Phe Arg Gln Ala Pro Gly 165 170
175Lys Glu Arg Glu Phe Val Val Ala Ile Asn Trp Ser Ser Gly Ser Thr
180 185 190Tyr Tyr Ala Asp Ser
Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn 195
200 205Ala Lys Asn Thr Met Tyr Leu Gln Met Asn Ser Leu
Lys Pro Glu Asp 210 215 220Thr Ala Val
Tyr Tyr Cys Ala Ala Gly Tyr Gln Ile Asn Ser Gly Asn225
230 235 240Tyr Asn Phe Lys Asp Tyr Glu
Tyr Asp Tyr Trp Gly Gln Gly Thr Gln 245
250 255Val Thr Val Ser Ser Ala Ala Ala His His His His
His His Gly Ala 260 265 270Glu
Phe Glu Gln Lys Leu Ile Ser Glu Glu Asp Leu 275
280121286PRTArtificial Sequence9G8-B1 QASGA his myc 121Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Arg Thr Phe Ser Ser Tyr 20 25
30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Val Ala Ile Asn Trp Ser Ser Gly
Ser Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Met Tyr65
70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Ala Ala Gly Tyr Gln Ile Asn Ser Gly Asn Tyr
Asn Phe Lys Asp Tyr 100 105
110Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Ala Ser Val Asn Gln Thr Pro
Arg145 150 155 160Thr Ala
Thr Lys Glu Thr Gly Glu Ser Leu Thr Ile Asn Cys Val Val
165 170 175Thr Gly Ala Asn Tyr Gly Leu
Ala Ala Thr Tyr Trp Tyr Arg Lys Asn 180 185
190Pro Gly Ser Ser Asn Gln Glu Arg Ile Ser Ile Ser Gly Arg
Tyr Val 195 200 205Glu Ser Val Asn
Lys Arg Thr Met Ser Phe Ser Leu Arg Ile Lys Asp 210
215 220Leu Thr Val Ala Asp Ser Ala Thr Tyr Tyr Cys Lys
Ala Tyr Pro Trp225 230 235
240Gly Ala Gly Ala Pro Trp Leu Val Gln Trp Tyr Asp Gly Ala Gly Thr
245 250 255Val Leu Thr Val Asn
Gln Ala Ser Gly Ala His His His His His His 260
265 270Gly Ala Glu Phe Glu Gln Lys Leu Ile Ser Glu Glu
Asp Leu 275 280
285122284PRTArtificial SequenceD3-7C12 AAA his myc 122Ala Ser Val Asn Gln
Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Leu Thr Asp Thr
Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg
35 40 45Met Ser Ile Gly Gly Arg Tyr Val
Glu Ser Val Asn Lys Arg Ala Lys 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys Ala
Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly 85
90 95His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly Thr
Val Leu Thr Val Asn 100 105
110Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Ala Val Gln Leu Val Glu Ser 130 135
140Gly Gly Gly Ser Val Gln Ala Gly Gly Ser Leu Arg Leu Thr Cys
Ala145 150 155 160Ala Ser
Gly Arg Thr Ser Arg Ser Tyr Gly Met Gly Trp Phe Arg Gln
165 170 175Ala Pro Gly Lys Glu Arg Glu
Phe Val Ser Gly Ile Ser Trp Arg Gly 180 185
190Asp Ser Thr Gly Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr
Ile Ser 195 200 205Arg Asp Asn Ala
Lys Asn Thr Val Asp Leu Gln Met Asn Ser Leu Lys 210
215 220Pro Glu Asp Thr Ala Ile Tyr Tyr Cys Ala Ala Ala
Ala Gly Ser Thr225 230 235
240Trp Tyr Gly Thr Leu Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln
245 250 255Val Thr Val Ser Ser
Ala Ala Ala His His His His His His Gly Ala 260
265 270Glu Phe Glu Gln Lys Leu Ile Ser Glu Glu Asp Leu
275 280123284PRTArtificial SequenceD3-7C12 ACA his
myc 123Ala Ser Val Asn Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1
5 10 15Ser Leu Thr Ile Asn
Cys Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr 20
25 30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr
Asp Trp Glu Arg 35 40 45Met Ser
Ile Gly Gly Arg Tyr Val Glu Ser Val Asn Lys Arg Ala Lys 50
55 60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val
Ala Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly
85 90 95His Gly Tyr Asn Trp
Tyr Asp Gly Ala Gly Thr Val Leu Thr Val Asn 100
105 110Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly 115 120 125Gly Gly
Gly Ser Gly Gly Gly Gly Ser Ala Val Gln Leu Val Glu Ser 130
135 140Gly Gly Gly Ser Val Gln Ala Gly Gly Ser Leu
Arg Leu Thr Cys Ala145 150 155
160Ala Ser Gly Arg Thr Ser Arg Ser Tyr Gly Met Gly Trp Phe Arg Gln
165 170 175Ala Pro Gly Lys
Glu Arg Glu Phe Val Ser Gly Ile Ser Trp Arg Gly 180
185 190Asp Ser Thr Gly Tyr Ala Asp Ser Val Lys Gly
Arg Phe Thr Ile Ser 195 200 205Arg
Asp Asn Ala Lys Asn Thr Val Asp Leu Gln Met Asn Ser Leu Lys 210
215 220Pro Glu Asp Thr Ala Ile Tyr Tyr Cys Ala
Ala Ala Ala Gly Ser Thr225 230 235
240Trp Tyr Gly Thr Leu Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly Thr
Gln 245 250 255Val Thr Val
Ser Ser Ala Cys Ala His His His His His His Gly Ala 260
265 270Glu Phe Glu Gln Lys Leu Ile Ser Glu Glu
Asp Leu 275 280124286PRTArtificial Sequence7C12-D3
QASGA his myc 124Ala Val Gln Leu Val Glu Ser Gly Gly Gly Ser Val Gln Ala
Gly Gly1 5 10 15Ser Leu
Arg Leu Thr Cys Ala Ala Ser Gly Arg Thr Ser Arg Ser Tyr 20
25 30Gly Met Gly Trp Phe Arg Gln Ala Pro
Gly Lys Glu Arg Glu Phe Val 35 40
45Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr Gly Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asn Ala Lys Asn Thr Val Asp65 70 75
80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Ile Tyr
Tyr Cys 85 90 95Ala Ala
Ala Ala Gly Ser Thr Trp Tyr Gly Thr Leu Tyr Glu Tyr Asp 100
105 110Tyr Trp Gly Gln Gly Thr Gln Val Thr
Val Ser Ser Gly Gly Gly Gly 115 120
125Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
130 135 140Gly Gly Gly Gly Ser Ala Ser
Val Asn Gln Thr Pro Arg Thr Ala Thr145 150
155 160Lys Glu Thr Gly Glu Ser Leu Thr Ile Asn Cys Val
Leu Thr Asp Thr 165 170
175Ser Tyr Gly Leu Tyr Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr
180 185 190Thr Asp Trp Glu Arg Met
Ser Ile Gly Gly Arg Tyr Val Glu Ser Val 195 200
205Asn Lys Arg Ala Lys Ser Phe Ser Leu Arg Ile Lys Asp Leu
Thr Val 210 215 220Ala Asp Ser Ala Thr
Tyr Tyr Cys Lys Ala Gln Ser Gly Met Ala Ile225 230
235 240Ser Thr Gly Ser Gly His Gly Tyr Asn Trp
Tyr Asp Gly Ala Gly Thr 245 250
255Val Leu Thr Val Asn Gln Ala Ser Gly Ala His His His His His His
260 265 270Gly Ala Glu Phe Glu
Gln Lys Leu Ile Ser Glu Glu Asp Leu 275 280
285125286PRTArtificial Sequence7C12-D3 QACGA his myc 125Ala Val
Gln Leu Val Glu Ser Gly Gly Gly Ser Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Thr Cys Ala Ala
Ser Gly Arg Thr Ser Arg Ser Tyr 20 25
30Gly Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe
Val 35 40 45Ser Gly Ile Ser Trp
Arg Gly Asp Ser Thr Gly Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr
Val Asp65 70 75 80Leu
Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Ile Tyr Tyr Cys
85 90 95Ala Ala Ala Ala Gly Ser Thr
Trp Tyr Gly Thr Leu Tyr Glu Tyr Asp 100 105
110Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly Gly
Gly Gly 115 120 125Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser 130
135 140Gly Gly Gly Gly Ser Ala Ser Val Asn Gln Thr Pro
Arg Thr Ala Thr145 150 155
160Lys Glu Thr Gly Glu Ser Leu Thr Ile Asn Cys Val Leu Thr Asp Thr
165 170 175Ser Tyr Gly Leu Tyr
Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr 180
185 190Thr Asp Trp Glu Arg Met Ser Ile Gly Gly Arg Tyr
Val Glu Ser Val 195 200 205Asn Lys
Arg Ala Lys Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val 210
215 220Ala Asp Ser Ala Thr Tyr Tyr Cys Lys Ala Gln
Ser Gly Met Ala Ile225 230 235
240Ser Thr Gly Ser Gly His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly Thr
245 250 255Val Leu Thr Val
Asn Gln Ala Cys Gly Ala His His His His His His 260
265 270Gly Ala Glu Phe Glu Gln Lys Leu Ile Ser Glu
Glu Asp Leu 275 280
285126287PRTArtificial SequenceD3-9G8 AAA his myc 126Ala Ser Val Asn Gln
Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Leu Thr Asp Thr
Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg
35 40 45Met Ser Ile Gly Gly Arg Tyr Val
Glu Ser Val Asn Lys Arg Ala Lys 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys Ala
Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly 85
90 95His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly Thr
Val Leu Thr Val Asn 100 105
110Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Glu Val Gln Leu Val Glu Ser 130 135
140Gly Gly Gly Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys
Ala145 150 155 160Ala Ser
Gly Arg Thr Phe Ser Ser Tyr Ala Met Gly Trp Phe Arg Gln
165 170 175Ala Pro Gly Lys Glu Arg Glu
Phe Val Val Ala Ile Asn Trp Ser Ser 180 185
190Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr
Ile Ser 195 200 205Arg Asp Asn Ala
Lys Asn Thr Met Tyr Leu Gln Met Asn Ser Leu Lys 210
215 220Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala Ala Gly
Tyr Gln Ile Asn225 230 235
240Ser Gly Asn Tyr Asn Phe Lys Asp Tyr Glu Tyr Asp Tyr Trp Gly Gln
245 250 255Gly Thr Gln Val Thr
Val Ser Ser Ala Ala Ala His His His His His 260
265 270His Gly Ala Glu Phe Glu Gln Lys Leu Ile Ser Glu
Glu Asp Leu 275 280
285127289PRTArtificial Sequence9G8-D3 QASGA his myc 127Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Arg Thr Phe Ser Ser Tyr 20 25
30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Val Ala Ile Asn Trp Ser Ser Gly
Ser Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Met Tyr65
70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Ala Ala Gly Tyr Gln Ile Asn Ser Gly Asn Tyr
Asn Phe Lys Asp Tyr 100 105
110Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Ala Ser Val Asn Gln Thr Pro
Arg145 150 155 160Thr Ala
Thr Lys Glu Thr Gly Glu Ser Leu Thr Ile Asn Cys Val Leu
165 170 175Thr Asp Thr Ser Tyr Gly Leu
Tyr Ser Thr Ser Trp Phe Arg Lys Asn 180 185
190Pro Gly Thr Thr Asp Trp Glu Arg Met Ser Ile Gly Gly Arg
Tyr Val 195 200 205Glu Ser Val Asn
Lys Arg Ala Lys Ser Phe Ser Leu Arg Ile Lys Asp 210
215 220Leu Thr Val Ala Asp Ser Ala Thr Tyr Tyr Cys Lys
Ala Gln Ser Gly225 230 235
240Met Ala Ile Ser Thr Gly Ser Gly His Gly Tyr Asn Trp Tyr Asp Gly
245 250 255Ala Gly Thr Val Leu
Thr Val Asn Gln Ala Ser Gly Ala His His His 260
265 270His His His Gly Ala Glu Phe Glu Gln Lys Leu Ile
Ser Glu Glu Asp 275 280
285Leu128421PRTArtificial SequenceD3D3-7C12 AAA his myc 128Ala Ser Val
Asn Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Leu Thr
Asp Thr Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg
35 40 45Met Ser Ile Gly Gly Arg Tyr
Val Glu Ser Val Asn Lys Arg Ala Lys 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys
Ala Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly 85
90 95His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly
Thr Val Leu Thr Val Asn 100 105
110Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Ala Ser Val Asn Gln Thr Pro 130 135
140Arg Thr Ala Thr Lys Glu Thr Gly Glu Ser Leu Thr Ile Asn Cys
Val145 150 155 160Leu Thr
Asp Thr Ser Tyr Gly Leu Tyr Ser Thr Ser Trp Phe Arg Lys
165 170 175Asn Pro Gly Thr Thr Asp Trp
Glu Arg Met Ser Ile Gly Gly Arg Tyr 180 185
190Val Glu Ser Val Asn Lys Arg Ala Lys Ser Phe Ser Leu Arg
Ile Lys 195 200 205Asp Leu Thr Val
Ala Asp Ser Ala Thr Tyr Tyr Cys Lys Ala Gln Ser 210
215 220Gly Met Ala Ile Ser Thr Gly Ser Gly His Gly Tyr
Asn Trp Tyr Asp225 230 235
240Gly Ala Gly Thr Val Leu Thr Val Asn Gly Gly Gly Gly Ser Gly Gly
245 250 255Gly Gly Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly 260
265 270Gly Ser Ala Val Gln Leu Val Glu Ser Gly Gly Gly
Ser Val Gln Ala 275 280 285Gly Gly
Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly Arg Thr Ser Arg 290
295 300Ser Tyr Gly Met Gly Trp Phe Arg Gln Ala Pro
Gly Lys Glu Arg Glu305 310 315
320Phe Val Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr Gly Tyr Ala Asp
325 330 335Ser Val Lys Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr 340
345 350Val Asp Leu Gln Met Asn Ser Leu Lys Pro Glu
Asp Thr Ala Ile Tyr 355 360 365Tyr
Cys Ala Ala Ala Ala Gly Ser Thr Trp Tyr Gly Thr Leu Tyr Glu 370
375 380Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val
Thr Val Ser Ser Ala Ala385 390 395
400Ala His His His His His His Gly Ala Glu Phe Glu Gln Lys Leu
Ile 405 410 415Ser Glu Glu
Asp Leu 420129421PRTArtificial SequenceD3D3-7C12 ACA his myc
129Ala Ser Val Asn Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1
5 10 15Ser Leu Thr Ile Asn Cys
Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp
Trp Glu Arg 35 40 45Met Ser Ile
Gly Gly Arg Tyr Val Glu Ser Val Asn Lys Arg Ala Lys 50
55 60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala
Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly
85 90 95His Gly Tyr Asn Trp Tyr
Asp Gly Ala Gly Thr Val Leu Thr Val Asn 100
105 110Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly 115 120 125Gly Gly
Gly Ser Gly Gly Gly Gly Ser Ala Ser Val Asn Gln Thr Pro 130
135 140Arg Thr Ala Thr Lys Glu Thr Gly Glu Ser Leu
Thr Ile Asn Cys Val145 150 155
160Leu Thr Asp Thr Ser Tyr Gly Leu Tyr Ser Thr Ser Trp Phe Arg Lys
165 170 175Asn Pro Gly Thr
Thr Asp Trp Glu Arg Met Ser Ile Gly Gly Arg Tyr 180
185 190Val Glu Ser Val Asn Lys Arg Ala Lys Ser Phe
Ser Leu Arg Ile Lys 195 200 205Asp
Leu Thr Val Ala Asp Ser Ala Thr Tyr Tyr Cys Lys Ala Gln Ser 210
215 220Gly Met Ala Ile Ser Thr Gly Ser Gly His
Gly Tyr Asn Trp Tyr Asp225 230 235
240Gly Ala Gly Thr Val Leu Thr Val Asn Gly Gly Gly Gly Ser Gly
Gly 245 250 255Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly 260
265 270Gly Ser Ala Val Gln Leu Val Glu Ser Gly
Gly Gly Ser Val Gln Ala 275 280
285Gly Gly Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly Arg Thr Ser Arg 290
295 300Ser Tyr Gly Met Gly Trp Phe Arg
Gln Ala Pro Gly Lys Glu Arg Glu305 310
315 320Phe Val Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr
Gly Tyr Ala Asp 325 330
335Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr
340 345 350Val Asp Leu Gln Met Asn
Ser Leu Lys Pro Glu Asp Thr Ala Ile Tyr 355 360
365Tyr Cys Ala Ala Ala Ala Gly Ser Thr Trp Tyr Gly Thr Leu
Tyr Glu 370 375 380Tyr Asp Tyr Trp Gly
Gln Gly Thr Gln Val Thr Val Ser Ser Ala Cys385 390
395 400Ala His His His His His His Gly Ala Glu
Phe Glu Gln Lys Leu Ile 405 410
415Ser Glu Glu Asp Leu 420130423PRTArtificial
Sequence7C12-D3D3 QASGA his myc 130Ala Val Gln Leu Val Glu Ser Gly Gly
Gly Ser Val Gln Ala Gly Gly1 5 10
15Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly Arg Thr Ser Arg Ser
Tyr 20 25 30Gly Met Gly Trp
Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35
40 45Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr Gly Tyr
Ala Asp Ser Val 50 55 60Lys Gly Arg
Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asp65 70
75 80Leu Gln Met Asn Ser Leu Lys Pro
Glu Asp Thr Ala Ile Tyr Tyr Cys 85 90
95Ala Ala Ala Ala Gly Ser Thr Trp Tyr Gly Thr Leu Tyr Glu
Tyr Asp 100 105 110Tyr Trp Gly
Gln Gly Thr Gln Val Thr Val Ser Ser Gly Gly Gly Gly 115
120 125Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser 130 135 140Gly Gly
Gly Gly Ser Ala Ser Val Asn Gln Thr Pro Arg Thr Ala Thr145
150 155 160Lys Glu Thr Gly Glu Ser Leu
Thr Ile Asn Cys Val Leu Thr Asp Thr 165
170 175Ser Tyr Gly Leu Tyr Ser Thr Ser Trp Phe Arg Lys
Asn Pro Gly Thr 180 185 190Thr
Asp Trp Glu Arg Met Ser Ile Gly Gly Arg Tyr Val Glu Ser Val 195
200 205Asn Lys Arg Ala Lys Ser Phe Ser Leu
Arg Ile Lys Asp Leu Thr Val 210 215
220Ala Asp Ser Ala Thr Tyr Tyr Cys Lys Ala Gln Ser Gly Met Ala Ile225
230 235 240Ser Thr Gly Ser
Gly His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly Thr 245
250 255Val Leu Thr Val Asn Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly 260 265
270Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala Ser
275 280 285Val Asn Gln Thr Pro Arg Thr
Ala Thr Lys Glu Thr Gly Glu Ser Leu 290 295
300Thr Ile Asn Cys Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr Ser
Thr305 310 315 320Ser Trp
Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg Met Ser
325 330 335Ile Gly Gly Arg Tyr Val Glu
Ser Val Asn Lys Arg Ala Lys Ser Phe 340 345
350Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr
Tyr Tyr 355 360 365Cys Lys Ala Gln
Ser Gly Met Ala Ile Ser Thr Gly Ser Gly His Gly 370
375 380Tyr Asn Trp Tyr Asp Gly Ala Gly Thr Val Leu Thr
Val Asn Gln Ala385 390 395
400Ser Gly Ala His His His His His His Gly Ala Glu Phe Glu Gln Lys
405 410 415Leu Ile Ser Glu Glu
Asp Leu 420131423PRTArtificial Sequence7C12-D3D3 QACGA his myc
131Ala Val Gln Leu Val Glu Ser Gly Gly Gly Ser Val Gln Ala Gly Gly1
5 10 15Ser Leu Arg Leu Thr Cys
Ala Ala Ser Gly Arg Thr Ser Arg Ser Tyr 20 25
30Gly Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg
Glu Phe Val 35 40 45Ser Gly Ile
Ser Trp Arg Gly Asp Ser Thr Gly Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Val Asp65 70 75
80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Ile Tyr Tyr Cys
85 90 95Ala Ala Ala Ala Gly Ser
Thr Trp Tyr Gly Thr Leu Tyr Glu Tyr Asp 100
105 110Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser
Gly Gly Gly Gly 115 120 125Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser 130
135 140Gly Gly Gly Gly Ser Ala Ser Val Asn Gln Thr
Pro Arg Thr Ala Thr145 150 155
160Lys Glu Thr Gly Glu Ser Leu Thr Ile Asn Cys Val Leu Thr Asp Thr
165 170 175Ser Tyr Gly Leu
Tyr Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr 180
185 190Thr Asp Trp Glu Arg Met Ser Ile Gly Gly Arg
Tyr Val Glu Ser Val 195 200 205Asn
Lys Arg Ala Lys Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val 210
215 220Ala Asp Ser Ala Thr Tyr Tyr Cys Lys Ala
Gln Ser Gly Met Ala Ile225 230 235
240Ser Thr Gly Ser Gly His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly
Thr 245 250 255Val Leu Thr
Val Asn Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 260
265 270Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Ala Ser 275 280
285Val Asn Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu Ser Leu 290
295 300Thr Ile Asn Cys Val Leu Thr Asp
Thr Ser Tyr Gly Leu Tyr Ser Thr305 310
315 320Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp
Glu Arg Met Ser 325 330
335Ile Gly Gly Arg Tyr Val Glu Ser Val Asn Lys Arg Ala Lys Ser Phe
340 345 350Ser Leu Arg Ile Lys Asp
Leu Thr Val Ala Asp Ser Ala Thr Tyr Tyr 355 360
365Cys Lys Ala Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly
His Gly 370 375 380Tyr Asn Trp Tyr Asp
Gly Ala Gly Thr Val Leu Thr Val Asn Gln Ala385 390
395 400Cys Gly Ala His His His His His His Gly
Ala Glu Phe Glu Gln Lys 405 410
415Leu Ile Ser Glu Glu Asp Leu 420132279PRTArtificial
SequenceP3A1-7C12 AAA his myc 132Thr Arg Val Asp Gln Thr Pro Arg Thr Ala
Thr Lys Glu Thr Gly Glu1 5 10
15Ser Leu Thr Ile Asn Cys Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr
20 25 30Ser Thr Ser Trp Phe Arg
Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg 35 40
45Met Ser Ile Gly Gly Arg Tyr Val Glu Ser Val Asn Lys Gly
Ala Lys 50 55 60Ser Phe Ser Leu Arg
Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65 70
75 80Tyr Tyr Cys Lys Ala Arg Glu Ala Arg His
Pro Trp Leu Arg Gln Trp 85 90
95Tyr Asp Gly Ala Gly Thr Val Leu Thr Val Asn Gly Gly Gly Gly Ser
100 105 110Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 115
120 125Gly Gly Gly Ser Ala Val Gln Leu Val Glu Ser Gly
Gly Gly Ser Val 130 135 140Gln Ala Gly
Gly Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly Arg Thr145
150 155 160Ser Arg Ser Tyr Gly Met Gly
Trp Phe Arg Gln Ala Pro Gly Lys Glu 165
170 175Arg Glu Phe Val Ser Gly Ile Ser Trp Arg Gly Asp
Ser Thr Gly Tyr 180 185 190Ala
Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys 195
200 205Asn Thr Val Asp Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala 210 215
220Ile Tyr Tyr Cys Ala Ala Ala Ala Gly Ser Thr Trp Tyr Gly Thr Leu225
230 235 240Tyr Glu Tyr Asp
Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 245
250 255Ala Ala Ala His His His His His His Gly
Ala Glu Phe Glu Gln Lys 260 265
270Leu Ile Ser Glu Glu Asp Leu 275133279PRTArtificial
SequenceP3A1-7C12 ACA his myc 133Thr Arg Val Asp Gln Thr Pro Arg Thr Ala
Thr Lys Glu Thr Gly Glu1 5 10
15Ser Leu Thr Ile Asn Cys Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr
20 25 30Ser Thr Ser Trp Phe Arg
Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg 35 40
45Met Ser Ile Gly Gly Arg Tyr Val Glu Ser Val Asn Lys Gly
Ala Lys 50 55 60Ser Phe Ser Leu Arg
Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65 70
75 80Tyr Tyr Cys Lys Ala Arg Glu Ala Arg His
Pro Trp Leu Arg Gln Trp 85 90
95Tyr Asp Gly Ala Gly Thr Val Leu Thr Val Asn Gly Gly Gly Gly Ser
100 105 110Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 115
120 125Gly Gly Gly Ser Ala Val Gln Leu Val Glu Ser Gly
Gly Gly Ser Val 130 135 140Gln Ala Gly
Gly Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly Arg Thr145
150 155 160Ser Arg Ser Tyr Gly Met Gly
Trp Phe Arg Gln Ala Pro Gly Lys Glu 165
170 175Arg Glu Phe Val Ser Gly Ile Ser Trp Arg Gly Asp
Ser Thr Gly Tyr 180 185 190Ala
Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys 195
200 205Asn Thr Val Asp Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala 210 215
220Ile Tyr Tyr Cys Ala Ala Ala Ala Gly Ser Thr Trp Tyr Gly Thr Leu225
230 235 240Tyr Glu Tyr Asp
Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 245
250 255Ala Cys Ala His His His His His His Gly
Ala Glu Phe Glu Gln Lys 260 265
270Leu Ile Ser Glu Glu Asp Leu 275134281PRTArtificial
Sequence7C12-P3A1 QASGA his myc 134Ala Val Gln Leu Val Glu Ser Gly Gly
Gly Ser Val Gln Ala Gly Gly1 5 10
15Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly Arg Thr Ser Arg Ser
Tyr 20 25 30Gly Met Gly Trp
Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35
40 45Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr Gly Tyr
Ala Asp Ser Val 50 55 60Lys Gly Arg
Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asp65 70
75 80Leu Gln Met Asn Ser Leu Lys Pro
Glu Asp Thr Ala Ile Tyr Tyr Cys 85 90
95Ala Ala Ala Ala Gly Ser Thr Trp Tyr Gly Thr Leu Tyr Glu
Tyr Asp 100 105 110Tyr Trp Gly
Gln Gly Thr Gln Val Thr Val Ser Ser Gly Gly Gly Gly 115
120 125Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser 130 135 140Gly Gly
Gly Gly Ser Thr Arg Val Asp Gln Thr Pro Arg Thr Ala Thr145
150 155 160Lys Glu Thr Gly Glu Ser Leu
Thr Ile Asn Cys Val Leu Thr Asp Thr 165
170 175Ser Tyr Gly Leu Tyr Ser Thr Ser Trp Phe Arg Lys
Asn Pro Gly Thr 180 185 190Thr
Asp Trp Glu Arg Met Ser Ile Gly Gly Arg Tyr Val Glu Ser Val 195
200 205Asn Lys Gly Ala Lys Ser Phe Ser Leu
Arg Ile Lys Asp Leu Thr Val 210 215
220Ala Asp Ser Ala Thr Tyr Tyr Cys Lys Ala Arg Glu Ala Arg His Pro225
230 235 240Trp Leu Arg Gln
Trp Tyr Asp Gly Ala Gly Thr Val Leu Thr Val Asn 245
250 255Gln Ala Ser Gly Ala His His His His His
His Gly Ala Glu Phe Glu 260 265
270Gln Lys Leu Ile Ser Glu Glu Asp Leu 275
280135281PRTArtificial Sequence7C12-P3A1 QACGA his myc 135Ala Val Gln Leu
Val Glu Ser Gly Gly Gly Ser Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly
Arg Thr Ser Arg Ser Tyr 20 25
30Gly Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ser Gly Ile Ser Trp Arg Gly Asp
Ser Thr Gly Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asp65
70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Ile Tyr Tyr Cys 85
90 95Ala Ala Ala Ala Gly Ser Thr Trp Tyr Gly Thr
Leu Tyr Glu Tyr Asp 100 105
110Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly Gly Gly Gly
115 120 125Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser 130 135
140Gly Gly Gly Gly Ser Thr Arg Val Asp Gln Thr Pro Arg Thr Ala
Thr145 150 155 160Lys Glu
Thr Gly Glu Ser Leu Thr Ile Asn Cys Val Leu Thr Asp Thr
165 170 175Ser Tyr Gly Leu Tyr Ser Thr
Ser Trp Phe Arg Lys Asn Pro Gly Thr 180 185
190Thr Asp Trp Glu Arg Met Ser Ile Gly Gly Arg Tyr Val Glu
Ser Val 195 200 205Asn Lys Gly Ala
Lys Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val 210
215 220Ala Asp Ser Ala Thr Tyr Tyr Cys Lys Ala Arg Glu
Ala Arg His Pro225 230 235
240Trp Leu Arg Gln Trp Tyr Asp Gly Ala Gly Thr Val Leu Thr Val Asn
245 250 255Gln Ala Cys Gly Ala
His His His His His His Gly Ala Glu Phe Glu 260
265 270Gln Lys Leu Ile Ser Glu Glu Asp Leu 275
280136279PRTArtificial Sequence2V-7C12 ACA his myc 136Thr
Arg Val Asp Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1
5 10 15Ser Leu Thr Ile Asn Cys Val
Leu Thr Asp Thr Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp
Glu Arg 35 40 45Met Ser Ile Gly
Gly Arg Tyr Val Glu Ser Val Asn Lys Gly Ala Lys 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp
Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Gln Ser Leu Ala Ile Ser Thr Arg Ser Tyr Trp
85 90 95Tyr Asp Gly Ala Gly Thr
Val Leu Thr Val Asn Gly Gly Gly Gly Ser 100
105 110Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly 115 120 125Gly Gly
Gly Ser Ala Val Gln Leu Val Glu Ser Gly Gly Gly Ser Val 130
135 140Gln Ala Gly Gly Ser Leu Arg Leu Thr Cys Ala
Ala Ser Gly Arg Thr145 150 155
160Ser Arg Ser Tyr Gly Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu
165 170 175Arg Glu Phe Val
Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr Gly Tyr 180
185 190Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ala Lys 195 200 205Asn
Thr Val Asp Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala 210
215 220Ile Tyr Tyr Cys Ala Ala Ala Ala Gly Ser
Thr Trp Tyr Gly Thr Leu225 230 235
240Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser
Ser 245 250 255Ala Cys Ala
His His His His His His Gly Ala Glu Phe Glu Gln Lys 260
265 270Leu Ile Ser Glu Glu Asp Leu
275137281PRTArtificial Sequence7C12-2V QACGA his myc 137Ala Val Gln Leu
Val Glu Ser Gly Gly Gly Ser Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly
Arg Thr Ser Arg Ser Tyr 20 25
30Gly Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ser Gly Ile Ser Trp Arg Gly Asp
Ser Thr Gly Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asp65
70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Ile Tyr Tyr Cys 85
90 95Ala Ala Ala Ala Gly Ser Thr Trp Tyr Gly Thr
Leu Tyr Glu Tyr Asp 100 105
110Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly Gly Gly Gly
115 120 125Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser 130 135
140Gly Gly Gly Gly Ser Thr Arg Val Asp Gln Thr Pro Arg Thr Ala
Thr145 150 155 160Lys Glu
Thr Gly Glu Ser Leu Thr Ile Asn Cys Val Leu Thr Asp Thr
165 170 175Ser Tyr Gly Leu Tyr Ser Thr
Ser Trp Phe Arg Lys Asn Pro Gly Thr 180 185
190Thr Asp Trp Glu Arg Met Ser Ile Gly Gly Arg Tyr Val Glu
Ser Val 195 200 205Asn Lys Gly Ala
Lys Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val 210
215 220Ala Asp Ser Ala Thr Tyr Tyr Cys Lys Ala Gln Ser
Leu Ala Ile Ser225 230 235
240Thr Arg Ser Tyr Trp Tyr Asp Gly Ala Gly Thr Val Leu Thr Val Asn
245 250 255Gln Ala Cys Gly Ala
His His His His His His Gly Ala Glu Phe Glu 260
265 270Gln Lys Leu Ile Ser Glu Glu Asp Leu 275
280138282PRTArtificial Sequence2V-9G8 ACA his myc 138Thr Arg
Val Asp Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Leu
Thr Asp Thr Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp Glu
Arg 35 40 45Met Ser Ile Gly Gly
Arg Tyr Val Glu Ser Val Asn Lys Gly Ala Lys 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser
Ala Thr65 70 75 80Tyr
Tyr Cys Lys Ala Gln Ser Leu Ala Ile Ser Thr Arg Ser Tyr Trp
85 90 95Tyr Asp Gly Ala Gly Thr Val
Leu Thr Val Asn Gly Gly Gly Gly Ser 100 105
110Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
Ser Gly 115 120 125Gly Gly Gly Ser
Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val 130
135 140Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Arg Thr145 150 155
160Phe Ser Ser Tyr Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu
165 170 175Arg Glu Phe Val Val
Ala Ile Asn Trp Ser Ser Gly Ser Thr Tyr Tyr 180
185 190Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg
Asp Asn Ala Lys 195 200 205Asn Thr
Met Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala 210
215 220Val Tyr Tyr Cys Ala Ala Gly Tyr Gln Ile Asn
Ser Gly Asn Tyr Asn225 230 235
240Phe Lys Asp Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr
245 250 255Val Ser Ser Ala
Cys Ala His His His His His His Gly Ala Glu Phe 260
265 270Glu Gln Lys Leu Ile Ser Glu Glu Asp Leu
275 280139284PRTArtificial Sequence9G8-2V QACGA his myc
139Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Arg Thr Phe Ser Ser Tyr 20 25
30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg
Glu Phe Val 35 40 45Val Ala Ile
Asn Trp Ser Ser Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Met Tyr65 70 75
80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Ala Gly Tyr Gln Ile
Asn Ser Gly Asn Tyr Asn Phe Lys Asp Tyr 100
105 110Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr
Val Ser Ser Gly 115 120 125Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 130
135 140Gly Gly Ser Gly Gly Gly Gly Ser Thr Arg Val
Asp Gln Thr Pro Arg145 150 155
160Thr Ala Thr Lys Glu Thr Gly Glu Ser Leu Thr Ile Asn Cys Val Leu
165 170 175Thr Asp Thr Ser
Tyr Gly Leu Tyr Ser Thr Ser Trp Phe Arg Lys Asn 180
185 190Pro Gly Thr Thr Asp Trp Glu Arg Met Ser Ile
Gly Gly Arg Tyr Val 195 200 205Glu
Ser Val Asn Lys Gly Ala Lys Ser Phe Ser Leu Arg Ile Lys Asp 210
215 220Leu Thr Val Ala Asp Ser Ala Thr Tyr Tyr
Cys Lys Ala Gln Ser Leu225 230 235
240Ala Ile Ser Thr Arg Ser Tyr Trp Tyr Asp Gly Ala Gly Thr Val
Leu 245 250 255Thr Val Asn
Gln Ala Cys Gly Ala His His His His His His Gly Ala 260
265 270Glu Phe Glu Gln Lys Leu Ile Ser Glu Glu
Asp Leu 275 280140147PRTArtificial Sequence7C12
AAA his myc 140Ala Val Gln Leu Val Glu Ser Gly Gly Gly Ser Val Gln Ala
Gly Gly1 5 10 15Ser Leu
Arg Leu Thr Cys Ala Ala Ser Gly Arg Thr Ser Arg Ser Tyr 20
25 30Gly Met Gly Trp Phe Arg Gln Ala Pro
Gly Lys Glu Arg Glu Phe Val 35 40
45Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr Gly Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asn Ala Lys Asn Thr Val Asp65 70 75
80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Ile Tyr
Tyr Cys 85 90 95Ala Ala
Ala Ala Gly Ser Thr Trp Tyr Gly Thr Leu Tyr Glu Tyr Asp 100
105 110Tyr Trp Gly Gln Gly Thr Gln Val Thr
Val Ser Ser Ala Ala Ala His 115 120
125His His His His His Gly Ala Glu Phe Glu Gln Lys Leu Ile Ser Glu
130 135 140Glu Asp
Leu145141150PRTArtificial Sequence9G8 AAA his myc 141Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg
Thr Phe Ser Ser Tyr 20 25
30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Val Ala Ile Asn Trp Ser Ser Gly
Ser Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Met Tyr65
70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Ala Ala Gly Tyr Gln Ile Asn Ser Gly Asn Tyr
Asn Phe Lys Asp Tyr 100 105
110Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Ala
115 120 125Ala Ala His His His His His
His Gly Ala Glu Phe Glu Gln Lys Leu 130 135
140Ile Ser Glu Glu Asp Leu145 150142134PRTArtificial
SequenceB1 QASGA his myc 142Ala Ser Val Asn Gln Thr Pro Arg Thr Ala Thr
Lys Glu Thr Gly Glu1 5 10
15Ser Leu Thr Ile Asn Cys Val Val Thr Gly Ala Asn Tyr Gly Leu Ala
20 25 30Ala Thr Tyr Trp Tyr Arg Lys
Asn Pro Gly Ser Ser Asn Gln Glu Arg 35 40
45Ile Ser Ile Ser Gly Arg Tyr Val Glu Ser Val Asn Lys Arg Thr
Met 50 55 60Ser Phe Ser Leu Arg Ile
Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65 70
75 80Tyr Tyr Cys Lys Ala Tyr Pro Trp Gly Ala Gly
Ala Pro Trp Leu Val 85 90
95Gln Trp Tyr Asp Gly Ala Gly Thr Val Leu Thr Val Asn Gln Ala Ser
100 105 110Gly Ala His His His His
His His Gly Ala Glu Phe Glu Gln Lys Leu 115 120
125Ile Ser Glu Glu Asp Leu 130143137PRTArtificial
SequenceD3 QASGA his myc 143Ala Ser Val Asn Gln Thr Pro Arg Thr Ala Thr
Lys Glu Thr Gly Glu1 5 10
15Ser Leu Thr Ile Asn Cys Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr
20 25 30Ser Thr Ser Trp Phe Arg Lys
Asn Pro Gly Thr Thr Asp Trp Glu Arg 35 40
45Met Ser Ile Gly Gly Arg Tyr Val Glu Ser Val Asn Lys Arg Ala
Lys 50 55 60Ser Phe Ser Leu Arg Ile
Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65 70
75 80Tyr Tyr Cys Lys Ala Gln Ser Gly Met Ala Ile
Ser Thr Gly Ser Gly 85 90
95His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly Thr Val Leu Thr Val Asn
100 105 110Gln Ala Ser Gly Ala His
His His His His His Gly Ala Glu Phe Glu 115 120
125Gln Lys Leu Ile Ser Glu Glu Asp Leu 130
135144274PRTArtificial SequenceD3-D3 QASGA his myc 144Ala Ser Val Asn
Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Leu Thr Asp
Thr Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg
35 40 45Met Ser Ile Gly Gly Arg Tyr Val
Glu Ser Val Asn Lys Arg Ala Lys 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys Ala
Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly 85
90 95His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly Thr
Val Leu Thr Val Asn 100 105
110Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Ala Ser Val Asn Gln Thr Pro 130 135
140Arg Thr Ala Thr Lys Glu Thr Gly Glu Ser Leu Thr Ile Asn Cys
Val145 150 155 160Leu Thr
Asp Thr Ser Tyr Gly Leu Tyr Ser Thr Ser Trp Phe Arg Lys
165 170 175Asn Pro Gly Thr Thr Asp Trp
Glu Arg Met Ser Ile Gly Gly Arg Tyr 180 185
190Val Glu Ser Val Asn Lys Arg Ala Lys Ser Phe Ser Leu Arg
Ile Lys 195 200 205Asp Leu Thr Val
Ala Asp Ser Ala Thr Tyr Tyr Cys Lys Ala Gln Ser 210
215 220Gly Met Ala Ile Ser Thr Gly Ser Gly His Gly Tyr
Asn Trp Tyr Asp225 230 235
240Gly Ala Gly Thr Val Leu Thr Val Asn Gln Ala Ser Gly Ala His His
245 250 255His His His His Gly
Ala Glu Phe Glu Gln Lys Leu Ile Ser Glu Glu 260
265 270Asp Leu145132PRTArtificial SequenceP3A1 QASGA his
myc 145Thr Arg Val Asp Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1
5 10 15Ser Leu Thr Ile Asn
Cys Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr 20
25 30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr
Asp Trp Glu Arg 35 40 45Met Ser
Ile Gly Gly Arg Tyr Val Glu Ser Val Asn Lys Gly Ala Lys 50
55 60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val
Ala Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Arg Glu Ala Arg His Pro Trp Leu Arg Gln Trp
85 90 95Tyr Asp Gly Ala Gly
Thr Val Leu Thr Val Asn Gln Ala Ser Gly Ala 100
105 110His His His His His His Gly Ala Glu Phe Glu Gln
Lys Leu Ile Ser 115 120 125Glu Glu
Asp Leu 130146371PRTArtificial Sequence7C12 hFc (S252C) 146Ala Val Gln
Leu Val Glu Ser Gly Gly Gly Ser Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Thr Cys Ala Ala Ser
Gly Arg Thr Ser Arg Ser Tyr 20 25
30Gly Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ser Gly Ile Ser Trp Arg Gly
Asp Ser Thr Gly Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asp65
70 75 80Leu Gln Met Asn
Ser Leu Lys Pro Glu Asp Thr Ala Ile Tyr Tyr Cys 85
90 95Ala Ala Ala Ala Gly Ser Thr Trp Tyr Gly
Thr Leu Tyr Glu Tyr Asp 100 105
110Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly Gly Gly Gly
115 120 125Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Glu Pro Lys Ser Ser 130 135
140Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu
Gly145 150 155 160Gly Pro
Cys Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met
165 170 175Ile Ser Arg Thr Pro Glu Val
Thr Cys Val Val Val Asp Val Ser His 180 185
190Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val
Glu Val 195 200 205His Asn Ala Lys
Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr 210
215 220Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp
Trp Leu Asn Gly225 230 235
240Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile
245 250 255Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val 260
265 270Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys
Asn Gln Val Ser 275 280 285Leu Thr
Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu 290
295 300Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
Lys Thr Thr Pro Pro305 310 315
320Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val
325 330 335Asp Lys Ser Arg
Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met 340
345 350His Glu Ala Leu His Asn His Tyr Thr Gln Lys
Ser Leu Ser Leu Ser 355 360 365Pro
Gly Lys 370147382PRTArtificial SequencehFc (S252C) 7C12 147Glu Pro Lys
Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala1 5
10 15Pro Glu Leu Leu Gly Gly Pro Cys Val
Phe Leu Phe Pro Pro Lys Pro 20 25
30Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val
35 40 45Val Asp Val Ser His Glu Asp
Pro Glu Val Lys Phe Asn Trp Tyr Val 50 55
60Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln65
70 75 80Tyr Asn Ser Thr
Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln 85
90 95Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys
Lys Val Ser Asn Lys Ala 100 105
110Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro
115 120 125Arg Glu Pro Gln Val Tyr Thr
Leu Pro Pro Ser Arg Asp Glu Leu Thr 130 135
140Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro
Ser145 150 155 160Asp Ile
Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
165 170 175Lys Thr Thr Pro Pro Val Leu
Asp Ser Asp Gly Ser Phe Phe Leu Tyr 180 185
190Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn
Val Phe 195 200 205Ser Cys Ser Val
Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys 210
215 220Ser Leu Ser Leu Ser Pro Gly Lys Gly Gly Gly Gly
Ser Gly Gly Gly225 230 235
240Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
245 250 255Ser Ala Val Gln Leu
Val Glu Ser Gly Gly Gly Ser Val Gln Ala Gly 260
265 270Gly Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly Arg
Thr Ser Arg Ser 275 280 285Tyr Gly
Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe 290
295 300Val Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr
Gly Tyr Ala Asp Ser305 310 315
320Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val
325 330 335Asp Leu Gln Met
Asn Ser Leu Lys Pro Glu Asp Thr Ala Ile Tyr Tyr 340
345 350Cys Ala Ala Ala Ala Gly Ser Thr Trp Tyr Gly
Thr Leu Tyr Glu Tyr 355 360 365Asp
Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly 370
375 380148506PRTArtificial SequenceB1 hFc (S252C) 7C12
148Ala Ser Val Asn Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1
5 10 15Ser Leu Thr Ile Asn Cys
Val Val Thr Gly Ala Asn Tyr Gly Leu Ala 20 25
30Ala Thr Tyr Trp Tyr Arg Lys Asn Pro Gly Ser Ser Asn
Gln Glu Arg 35 40 45Ile Ser Ile
Ser Gly Arg Tyr Val Glu Ser Val Asn Lys Arg Thr Met 50
55 60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala
Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Tyr Pro Trp Gly Ala Gly Ala Pro Trp Leu Val
85 90 95Gln Trp Tyr Asp Gly Ala
Gly Thr Val Leu Thr Val Asn Gly Gly Gly 100
105 110Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Glu Pro Lys Ser 115 120 125Ser Asp
Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu 130
135 140Gly Gly Pro Cys Val Phe Leu Phe Pro Pro Lys
Pro Lys Asp Thr Leu145 150 155
160Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser
165 170 175His Glu Asp Pro
Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu 180
185 190Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu
Gln Tyr Asn Ser Thr 195 200 205Tyr
Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn 210
215 220Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn
Lys Ala Leu Pro Ala Pro225 230 235
240Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro
Gln 245 250 255Val Tyr Thr
Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val 260
265 270Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr
Pro Ser Asp Ile Ala Val 275 280
285Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro 290
295 300Pro Val Leu Asp Ser Asp Gly Ser
Phe Phe Leu Tyr Ser Lys Leu Thr305 310
315 320Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe
Ser Cys Ser Val 325 330
335Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu
340 345 350Ser Pro Gly Lys Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 355 360
365Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala
Val Gln 370 375 380Leu Val Glu Ser Gly
Gly Gly Ser Val Gln Ala Gly Gly Ser Leu Arg385 390
395 400Leu Thr Cys Ala Ala Ser Gly Arg Thr Ser
Arg Ser Tyr Gly Met Gly 405 410
415Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ser Gly Ile
420 425 430Ser Trp Arg Gly Asp
Ser Thr Gly Tyr Ala Asp Ser Val Lys Gly Arg 435
440 445Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val
Asp Leu Gln Met 450 455 460Asn Ser Leu
Lys Pro Glu Asp Thr Ala Ile Tyr Tyr Cys Ala Ala Ala465
470 475 480Ala Gly Ser Thr Trp Tyr Gly
Thr Leu Tyr Glu Tyr Asp Tyr Trp Gly 485
490 495Gln Gly Thr Gln Val Thr Val Ser Ser Gly
500 505149504PRTArtificial SequenceP3A1 hFc (S252C) 7C12
149Thr Arg Val Asp Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1
5 10 15Ser Leu Thr Ile Asn Cys
Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp
Trp Glu Arg 35 40 45Met Ser Ile
Gly Gly Arg Tyr Val Glu Ser Val Asn Lys Gly Ala Lys 50
55 60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala
Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Arg Glu Ala Arg His Pro Trp Leu Arg Gln Trp
85 90 95Tyr Asp Gly Ala Gly Thr
Val Leu Thr Val Asn Gly Gly Gly Gly Ser 100
105 110Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Pro
Lys Ser Ser Asp 115 120 125Lys Thr
His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly 130
135 140Pro Cys Val Phe Leu Phe Pro Pro Lys Pro Lys
Asp Thr Leu Met Ile145 150 155
160Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu
165 170 175Asp Pro Glu Val
Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His 180
185 190Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr
Asn Ser Thr Tyr Arg 195 200 205Val
Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys 210
215 220Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala
Leu Pro Ala Pro Ile Glu225 230 235
240Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val
Tyr 245 250 255Thr Leu Pro
Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu 260
265 270Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser
Asp Ile Ala Val Glu Trp 275 280
285Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val 290
295 300Leu Asp Ser Asp Gly Ser Phe Phe
Leu Tyr Ser Lys Leu Thr Val Asp305 310
315 320Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys
Ser Val Met His 325 330
335Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro
340 345 350Gly Lys Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly 355 360
365Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala Val Gln
Leu Val 370 375 380Glu Ser Gly Gly Gly
Ser Val Gln Ala Gly Gly Ser Leu Arg Leu Thr385 390
395 400Cys Ala Ala Ser Gly Arg Thr Ser Arg Ser
Tyr Gly Met Gly Trp Phe 405 410
415Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ser Gly Ile Ser Trp
420 425 430Arg Gly Asp Ser Thr
Gly Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr 435
440 445Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asp Leu
Gln Met Asn Ser 450 455 460Leu Lys Pro
Glu Asp Thr Ala Ile Tyr Tyr Cys Ala Ala Ala Ala Gly465
470 475 480Ser Thr Trp Tyr Gly Thr Leu
Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly 485
490 495Thr Gln Val Thr Val Ser Ser Gly
500150646PRTArtificial SequenceD3D3 hFc (S252C) 7C12 150Ala Ser Val Asn
Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Leu Thr Asp
Thr Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg
35 40 45Met Ser Ile Gly Gly Arg Tyr Val
Glu Ser Val Asn Lys Arg Ala Lys 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys Ala
Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly 85
90 95His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly Thr
Val Leu Thr Val Asn 100 105
110Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Ala Ser Val Asn Gln Thr Pro 130 135
140Arg Thr Ala Thr Lys Glu Thr Gly Glu Ser Leu Thr Ile Asn Cys
Val145 150 155 160Leu Thr
Asp Thr Ser Tyr Gly Leu Tyr Ser Thr Ser Trp Phe Arg Lys
165 170 175Asn Pro Gly Thr Thr Asp Trp
Glu Arg Met Ser Ile Gly Gly Arg Tyr 180 185
190Val Glu Ser Val Asn Lys Arg Ala Lys Ser Phe Ser Leu Arg
Ile Lys 195 200 205Asp Leu Thr Val
Ala Asp Ser Ala Thr Tyr Tyr Cys Lys Ala Gln Ser 210
215 220Gly Met Ala Ile Ser Thr Gly Ser Gly His Gly Tyr
Asn Trp Tyr Asp225 230 235
240Gly Ala Gly Thr Val Leu Thr Val Asn Gly Gly Gly Gly Ser Gly Gly
245 250 255Gly Gly Ser Gly Gly
Gly Gly Ser Glu Pro Lys Ser Ser Asp Lys Thr 260
265 270His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu
Gly Gly Pro Cys 275 280 285Val Phe
Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg 290
295 300Thr Pro Glu Val Thr Cys Val Val Val Asp Val
Ser His Glu Asp Pro305 310 315
320Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala
325 330 335Lys Thr Lys Pro
Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 340
345 350Ser Val Leu Thr Val Leu His Gln Asp Trp Leu
Asn Gly Lys Glu Tyr 355 360 365Lys
Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 370
375 380Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr Leu385 390 395
400Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr
Cys 405 410 415Leu Val Lys
Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 420
425 430Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr
Thr Pro Pro Val Leu Asp 435 440
445Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser 450
455 460Arg Trp Gln Gln Gly Asn Val Phe
Ser Cys Ser Val Met His Glu Ala465 470
475 480Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu
Ser Pro Gly Lys 485 490
495Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
500 505 510Gly Gly Gly Ser Gly Gly
Gly Gly Ser Ala Val Gln Leu Val Glu Ser 515 520
525Gly Gly Gly Ser Val Gln Ala Gly Gly Ser Leu Arg Leu Thr
Cys Ala 530 535 540Ala Ser Gly Arg Thr
Ser Arg Ser Tyr Gly Met Gly Trp Phe Arg Gln545 550
555 560Ala Pro Gly Lys Glu Arg Glu Phe Val Ser
Gly Ile Ser Trp Arg Gly 565 570
575Asp Ser Thr Gly Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser
580 585 590Arg Asp Asn Ala Lys
Asn Thr Val Asp Leu Gln Met Asn Ser Leu Lys 595
600 605Pro Glu Asp Thr Ala Ile Tyr Tyr Cys Ala Ala Ala
Ala Gly Ser Thr 610 615 620Trp Tyr Gly
Thr Leu Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln625
630 635 640Val Thr Val Ser Ser Gly
645151258PRTArtificial SequenceB1-7C12 151Ala Ser Val Asn Gln Thr
Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Val Thr Gly Ala Asn
Tyr Gly Leu Ala 20 25 30Ala
Thr Tyr Trp Tyr Arg Lys Asn Pro Gly Ser Ser Asn Gln Glu Arg 35
40 45Ile Ser Ile Ser Gly Arg Tyr Val Glu
Ser Val Asn Lys Arg Thr Met 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys Ala
Tyr Pro Trp Gly Ala Gly Ala Pro Trp Leu Val 85
90 95Gln Trp Tyr Asp Gly Ala Gly Thr Val Leu Thr
Val Asn Gly Gly Gly 100 105
110Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
115 120 125Ser Gly Gly Gly Gly Ser Ala
Val Gln Leu Val Glu Ser Gly Gly Gly 130 135
140Ser Val Gln Ala Gly Gly Ser Leu Arg Leu Thr Cys Ala Ala Ser
Gly145 150 155 160Arg Thr
Ser Arg Ser Tyr Gly Met Gly Trp Phe Arg Gln Ala Pro Gly
165 170 175Lys Glu Arg Glu Phe Val Ser
Gly Ile Ser Trp Arg Gly Asp Ser Thr 180 185
190Gly Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg
Asp Asn 195 200 205Ala Lys Asn Thr
Val Asp Leu Gln Met Asn Ser Leu Lys Pro Glu Asp 210
215 220Thr Ala Ile Tyr Tyr Cys Ala Ala Ala Ala Gly Ser
Thr Trp Tyr Gly225 230 235
240Thr Leu Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val
245 250 255Ser
Ser152258PRTArtificial Sequence7C12-B1 152Ala Val Gln Leu Val Glu Ser Gly
Gly Gly Ser Val Gln Ala Gly Gly1 5 10
15Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly Arg Thr Ser Arg
Ser Tyr 20 25 30Gly Met Gly
Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35
40 45Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr Gly
Tyr Ala Asp Ser Val 50 55 60Lys Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asp65
70 75 80Leu Gln Met Asn Ser Leu Lys
Pro Glu Asp Thr Ala Ile Tyr Tyr Cys 85 90
95Ala Ala Ala Ala Gly Ser Thr Trp Tyr Gly Thr Leu Tyr
Glu Tyr Asp 100 105 110Tyr Trp
Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly Gly Gly Gly 115
120 125Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser 130 135 140Gly
Gly Gly Gly Ser Ala Ser Val Asn Gln Thr Pro Arg Thr Ala Thr145
150 155 160Lys Glu Thr Gly Glu Ser
Leu Thr Ile Asn Cys Val Val Thr Gly Ala 165
170 175Asn Tyr Gly Leu Ala Ala Thr Tyr Trp Tyr Arg Lys
Asn Pro Gly Ser 180 185 190Ser
Asn Gln Glu Arg Ile Ser Ile Ser Gly Arg Tyr Val Glu Ser Val 195
200 205Asn Lys Arg Thr Met Ser Phe Ser Leu
Arg Ile Lys Asp Leu Thr Val 210 215
220Ala Asp Ser Ala Thr Tyr Tyr Cys Lys Ala Tyr Pro Trp Gly Ala Gly225
230 235 240Ala Pro Trp Leu
Val Gln Trp Tyr Asp Gly Ala Gly Thr Val Leu Thr 245
250 255Val Asn153261PRTArtificial SequenceB1-9G8
153Ala Ser Val Asn Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1
5 10 15Ser Leu Thr Ile Asn Cys
Val Val Thr Gly Ala Asn Tyr Gly Leu Ala 20 25
30Ala Thr Tyr Trp Tyr Arg Lys Asn Pro Gly Ser Ser Asn
Gln Glu Arg 35 40 45Ile Ser Ile
Ser Gly Arg Tyr Val Glu Ser Val Asn Lys Arg Thr Met 50
55 60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala
Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Tyr Pro Trp Gly Ala Gly Ala Pro Trp Leu Val
85 90 95Gln Trp Tyr Asp Gly Ala
Gly Thr Val Leu Thr Val Asn Gly Gly Gly 100
105 110Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly 115 120 125Ser Gly
Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 130
135 140Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly145 150 155
160Arg Thr Phe Ser Ser Tyr Ala Met Gly Trp Phe Arg Gln Ala Pro Gly
165 170 175Lys Glu Arg Glu
Phe Val Val Ala Ile Asn Trp Ser Ser Gly Ser Thr 180
185 190Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr
Ile Ser Arg Asp Asn 195 200 205Ala
Lys Asn Thr Met Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp 210
215 220Thr Ala Val Tyr Tyr Cys Ala Ala Gly Tyr
Gln Ile Asn Ser Gly Asn225 230 235
240Tyr Asn Phe Lys Asp Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly Thr
Gln 245 250 255Val Thr Val
Ser Ser 260154261PRTArtificial Sequence9G8-B1 154Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Arg Thr Phe Ser Ser Tyr 20 25
30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Val Ala Ile Asn Trp Ser Ser
Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Met Tyr65
70 75 80Leu Gln Met Asn
Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Ala Ala Gly Tyr Gln Ile Asn Ser Gly Asn
Tyr Asn Phe Lys Asp Tyr 100 105
110Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Ala Ser Val Asn Gln Thr Pro
Arg145 150 155 160Thr Ala
Thr Lys Glu Thr Gly Glu Ser Leu Thr Ile Asn Cys Val Val
165 170 175Thr Gly Ala Asn Tyr Gly Leu
Ala Ala Thr Tyr Trp Tyr Arg Lys Asn 180 185
190Pro Gly Ser Ser Asn Gln Glu Arg Ile Ser Ile Ser Gly Arg
Tyr Val 195 200 205Glu Ser Val Asn
Lys Arg Thr Met Ser Phe Ser Leu Arg Ile Lys Asp 210
215 220Leu Thr Val Ala Asp Ser Ala Thr Tyr Tyr Cys Lys
Ala Tyr Pro Trp225 230 235
240Gly Ala Gly Ala Pro Trp Leu Val Gln Trp Tyr Asp Gly Ala Gly Thr
245 250 255Val Leu Thr Val Asn
260155261PRTArtificial SequenceD3-7C12 155Ala Ser Val Asn Gln
Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Leu Thr Asp Thr
Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg
35 40 45Met Ser Ile Gly Gly Arg Tyr Val
Glu Ser Val Asn Lys Arg Ala Lys 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys Ala
Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly 85
90 95His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly Thr
Val Leu Thr Val Asn 100 105
110Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Ala Val Gln Leu Val Glu Ser 130 135
140Gly Gly Gly Ser Val Gln Ala Gly Gly Ser Leu Arg Leu Thr Cys
Ala145 150 155 160Ala Ser
Gly Arg Thr Ser Arg Ser Tyr Gly Met Gly Trp Phe Arg Gln
165 170 175Ala Pro Gly Lys Glu Arg Glu
Phe Val Ser Gly Ile Ser Trp Arg Gly 180 185
190Asp Ser Thr Gly Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr
Ile Ser 195 200 205Arg Asp Asn Ala
Lys Asn Thr Val Asp Leu Gln Met Asn Ser Leu Lys 210
215 220Pro Glu Asp Thr Ala Ile Tyr Tyr Cys Ala Ala Ala
Ala Gly Ser Thr225 230 235
240Trp Tyr Gly Thr Leu Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln
245 250 255Val Thr Val Ser Ser
260156261PRTArtificial Sequence7C12-D3 156Ala Val Gln Leu Val
Glu Ser Gly Gly Gly Ser Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly Arg
Thr Ser Arg Ser Tyr 20 25
30Gly Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ser Gly Ile Ser Trp Arg Gly Asp
Ser Thr Gly Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asp65
70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Ile Tyr Tyr Cys 85
90 95Ala Ala Ala Ala Gly Ser Thr Trp Tyr Gly Thr
Leu Tyr Glu Tyr Asp 100 105
110Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly Gly Gly Gly
115 120 125Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser 130 135
140Gly Gly Gly Gly Ser Ala Ser Val Asn Gln Thr Pro Arg Thr Ala
Thr145 150 155 160Lys Glu
Thr Gly Glu Ser Leu Thr Ile Asn Cys Val Leu Thr Asp Thr
165 170 175Ser Tyr Gly Leu Tyr Ser Thr
Ser Trp Phe Arg Lys Asn Pro Gly Thr 180 185
190Thr Asp Trp Glu Arg Met Ser Ile Gly Gly Arg Tyr Val Glu
Ser Val 195 200 205Asn Lys Arg Ala
Lys Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val 210
215 220Ala Asp Ser Ala Thr Tyr Tyr Cys Lys Ala Gln Ser
Gly Met Ala Ile225 230 235
240Ser Thr Gly Ser Gly His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly Thr
245 250 255Val Leu Thr Val Asn
260157264PRTArtificial SequenceD3-9G8 157Ala Ser Val Asn Gln Thr
Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Leu Thr Asp Thr Ser
Tyr Gly Leu Tyr 20 25 30Ser
Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg 35
40 45Met Ser Ile Gly Gly Arg Tyr Val Glu
Ser Val Asn Lys Arg Ala Lys 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys Ala
Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly 85
90 95His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly Thr
Val Leu Thr Val Asn 100 105
110Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Glu Val Gln Leu Val Glu Ser 130 135
140Gly Gly Gly Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys
Ala145 150 155 160Ala Ser
Gly Arg Thr Phe Ser Ser Tyr Ala Met Gly Trp Phe Arg Gln
165 170 175Ala Pro Gly Lys Glu Arg Glu
Phe Val Val Ala Ile Asn Trp Ser Ser 180 185
190Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr
Ile Ser 195 200 205Arg Asp Asn Ala
Lys Asn Thr Met Tyr Leu Gln Met Asn Ser Leu Lys 210
215 220Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala Ala Gly
Tyr Gln Ile Asn225 230 235
240Ser Gly Asn Tyr Asn Phe Lys Asp Tyr Glu Tyr Asp Tyr Trp Gly Gln
245 250 255Gly Thr Gln Val Thr
Val Ser Ser 260158264PRTArtificial Sequence9G8-D3 158Glu Val
Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Arg Thr Phe Ser Ser Tyr 20 25
30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe
Val 35 40 45Val Ala Ile Asn Trp
Ser Ser Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr
Met Tyr65 70 75 80Leu
Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Ala Gly Tyr Gln Ile Asn
Ser Gly Asn Tyr Asn Phe Lys Asp Tyr 100 105
110Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser
Ser Gly 115 120 125Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 130
135 140Gly Gly Ser Gly Gly Gly Gly Ser Ala Ser Val Asn
Gln Thr Pro Arg145 150 155
160Thr Ala Thr Lys Glu Thr Gly Glu Ser Leu Thr Ile Asn Cys Val Leu
165 170 175Thr Asp Thr Ser Tyr
Gly Leu Tyr Ser Thr Ser Trp Phe Arg Lys Asn 180
185 190Pro Gly Thr Thr Asp Trp Glu Arg Met Ser Ile Gly
Gly Arg Tyr Val 195 200 205Glu Ser
Val Asn Lys Arg Ala Lys Ser Phe Ser Leu Arg Ile Lys Asp 210
215 220Leu Thr Val Ala Asp Ser Ala Thr Tyr Tyr Cys
Lys Ala Gln Ser Gly225 230 235
240Met Ala Ile Ser Thr Gly Ser Gly His Gly Tyr Asn Trp Tyr Asp Gly
245 250 255Ala Gly Thr Val
Leu Thr Val Asn 260159398PRTArtificial SequenceD3D3-7C12
159Ala Ser Val Asn Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1
5 10 15Ser Leu Thr Ile Asn Cys
Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp
Trp Glu Arg 35 40 45Met Ser Ile
Gly Gly Arg Tyr Val Glu Ser Val Asn Lys Arg Ala Lys 50
55 60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala
Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly
85 90 95His Gly Tyr Asn Trp Tyr
Asp Gly Ala Gly Thr Val Leu Thr Val Asn 100
105 110Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly 115 120 125Gly Gly
Gly Ser Gly Gly Gly Gly Ser Ala Ser Val Asn Gln Thr Pro 130
135 140Arg Thr Ala Thr Lys Glu Thr Gly Glu Ser Leu
Thr Ile Asn Cys Val145 150 155
160Leu Thr Asp Thr Ser Tyr Gly Leu Tyr Ser Thr Ser Trp Phe Arg Lys
165 170 175Asn Pro Gly Thr
Thr Asp Trp Glu Arg Met Ser Ile Gly Gly Arg Tyr 180
185 190Val Glu Ser Val Asn Lys Arg Ala Lys Ser Phe
Ser Leu Arg Ile Lys 195 200 205Asp
Leu Thr Val Ala Asp Ser Ala Thr Tyr Tyr Cys Lys Ala Gln Ser 210
215 220Gly Met Ala Ile Ser Thr Gly Ser Gly His
Gly Tyr Asn Trp Tyr Asp225 230 235
240Gly Ala Gly Thr Val Leu Thr Val Asn Gly Gly Gly Gly Ser Gly
Gly 245 250 255Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly 260
265 270Gly Ser Ala Val Gln Leu Val Glu Ser Gly
Gly Gly Ser Val Gln Ala 275 280
285Gly Gly Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly Arg Thr Ser Arg 290
295 300Ser Tyr Gly Met Gly Trp Phe Arg
Gln Ala Pro Gly Lys Glu Arg Glu305 310
315 320Phe Val Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr
Gly Tyr Ala Asp 325 330
335Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr
340 345 350Val Asp Leu Gln Met Asn
Ser Leu Lys Pro Glu Asp Thr Ala Ile Tyr 355 360
365Tyr Cys Ala Ala Ala Ala Gly Ser Thr Trp Tyr Gly Thr Leu
Tyr Glu 370 375 380Tyr Asp Tyr Trp Gly
Gln Gly Thr Gln Val Thr Val Ser Ser385 390
395160398PRTArtificial Sequence7C12-D3D3 160Ala Val Gln Leu Val Glu Ser
Gly Gly Gly Ser Val Gln Ala Gly Gly1 5 10
15Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly Arg Thr Ser
Arg Ser Tyr 20 25 30Gly Met
Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35
40 45Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr
Gly Tyr Ala Asp Ser Val 50 55 60Lys
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asp65
70 75 80Leu Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Ile Tyr Tyr Cys 85
90 95Ala Ala Ala Ala Gly Ser Thr Trp Tyr Gly Thr Leu
Tyr Glu Tyr Asp 100 105 110Tyr
Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly Gly Gly Gly 115
120 125Ser Gly Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser 130 135
140Gly Gly Gly Gly Ser Ala Ser Val Asn Gln Thr Pro Arg Thr Ala Thr145
150 155 160Lys Glu Thr Gly
Glu Ser Leu Thr Ile Asn Cys Val Leu Thr Asp Thr 165
170 175Ser Tyr Gly Leu Tyr Ser Thr Ser Trp Phe
Arg Lys Asn Pro Gly Thr 180 185
190Thr Asp Trp Glu Arg Met Ser Ile Gly Gly Arg Tyr Val Glu Ser Val
195 200 205Asn Lys Arg Ala Lys Ser Phe
Ser Leu Arg Ile Lys Asp Leu Thr Val 210 215
220Ala Asp Ser Ala Thr Tyr Tyr Cys Lys Ala Gln Ser Gly Met Ala
Ile225 230 235 240Ser Thr
Gly Ser Gly His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly Thr
245 250 255Val Leu Thr Val Asn Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Gly 260 265
270Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Ala Ser 275 280 285Val Asn Gln Thr
Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu Ser Leu 290
295 300Thr Ile Asn Cys Val Leu Thr Asp Thr Ser Tyr Gly
Leu Tyr Ser Thr305 310 315
320Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg Met Ser
325 330 335Ile Gly Gly Arg Tyr
Val Glu Ser Val Asn Lys Arg Ala Lys Ser Phe 340
345 350Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser
Ala Thr Tyr Tyr 355 360 365Cys Lys
Ala Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly His Gly 370
375 380Tyr Asn Trp Tyr Asp Gly Ala Gly Thr Val Leu
Thr Val Asn385 390 395161256PRTArtificial
SequenceP3A1-7C12 161Thr Arg Val Asp Gln Thr Pro Arg Thr Ala Thr Lys Glu
Thr Gly Glu1 5 10 15Ser
Leu Thr Ile Asn Cys Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr 20
25 30Ser Thr Ser Trp Phe Arg Lys Asn
Pro Gly Thr Thr Asp Trp Glu Arg 35 40
45Met Ser Ile Gly Gly Arg Tyr Val Glu Ser Val Asn Lys Gly Ala Lys
50 55 60Ser Phe Ser Leu Arg Ile Lys Asp
Leu Thr Val Ala Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Arg Glu Ala Arg His Pro Trp Leu
Arg Gln Trp 85 90 95Tyr
Asp Gly Ala Gly Thr Val Leu Thr Val Asn Gly Gly Gly Gly Ser
100 105 110Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Gly 115 120
125Gly Gly Gly Ser Ala Val Gln Leu Val Glu Ser Gly Gly Gly Ser
Val 130 135 140Gln Ala Gly Gly Ser Leu
Arg Leu Thr Cys Ala Ala Ser Gly Arg Thr145 150
155 160Ser Arg Ser Tyr Gly Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu 165 170
175Arg Glu Phe Val Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr Gly Tyr
180 185 190Ala Asp Ser Val Lys Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys 195 200
205Asn Thr Val Asp Leu Gln Met Asn Ser Leu Lys Pro Glu Asp
Thr Ala 210 215 220Ile Tyr Tyr Cys Ala
Ala Ala Ala Gly Ser Thr Trp Tyr Gly Thr Leu225 230
235 240Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly Thr
Gln Val Thr Val Ser Ser 245 250
255162256PRTArtificial Sequence7C12-P3A1 162Ala Val Gln Leu Val Glu
Ser Gly Gly Gly Ser Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly Arg Thr
Ser Arg Ser Tyr 20 25 30Gly
Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35
40 45Ser Gly Ile Ser Trp Arg Gly Asp Ser
Thr Gly Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asp65
70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Ile Tyr Tyr Cys 85
90 95Ala Ala Ala Ala Gly Ser Thr Trp Tyr Gly Thr
Leu Tyr Glu Tyr Asp 100 105
110Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly Gly Gly Gly
115 120 125Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser 130 135
140Gly Gly Gly Gly Ser Thr Arg Val Asp Gln Thr Pro Arg Thr Ala
Thr145 150 155 160Lys Glu
Thr Gly Glu Ser Leu Thr Ile Asn Cys Val Leu Thr Asp Thr
165 170 175Ser Tyr Gly Leu Tyr Ser Thr
Ser Trp Phe Arg Lys Asn Pro Gly Thr 180 185
190Thr Asp Trp Glu Arg Met Ser Ile Gly Gly Arg Tyr Val Glu
Ser Val 195 200 205Asn Lys Gly Ala
Lys Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val 210
215 220Ala Asp Ser Ala Thr Tyr Tyr Cys Lys Ala Arg Glu
Ala Arg His Pro225 230 235
240Trp Leu Arg Gln Trp Tyr Asp Gly Ala Gly Thr Val Leu Thr Val Asn
245 250 255163256PRTArtificial
Sequence2V-7C12 163Thr Arg Val Asp Gln Thr Pro Arg Thr Ala Thr Lys Glu
Thr Gly Glu1 5 10 15Ser
Leu Thr Ile Asn Cys Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr 20
25 30Ser Thr Ser Trp Phe Arg Lys Asn
Pro Gly Thr Thr Asp Trp Glu Arg 35 40
45Met Ser Ile Gly Gly Arg Tyr Val Glu Ser Val Asn Lys Gly Ala Lys
50 55 60Ser Phe Ser Leu Arg Ile Lys Asp
Leu Thr Val Ala Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Gln Ser Leu Ala Ile Ser Thr Arg
Ser Tyr Trp 85 90 95Tyr
Asp Gly Ala Gly Thr Val Leu Thr Val Asn Gly Gly Gly Gly Ser
100 105 110Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Gly 115 120
125Gly Gly Gly Ser Ala Val Gln Leu Val Glu Ser Gly Gly Gly Ser
Val 130 135 140Gln Ala Gly Gly Ser Leu
Arg Leu Thr Cys Ala Ala Ser Gly Arg Thr145 150
155 160Ser Arg Ser Tyr Gly Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu 165 170
175Arg Glu Phe Val Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr Gly Tyr
180 185 190Ala Asp Ser Val Lys Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys 195 200
205Asn Thr Val Asp Leu Gln Met Asn Ser Leu Lys Pro Glu Asp
Thr Ala 210 215 220Ile Tyr Tyr Cys Ala
Ala Ala Ala Gly Ser Thr Trp Tyr Gly Thr Leu225 230
235 240Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly Thr
Gln Val Thr Val Ser Ser 245 250
255164256PRTArtificial Sequence7C12-2V 164Ala Val Gln Leu Val Glu
Ser Gly Gly Gly Ser Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly Arg Thr
Ser Arg Ser Tyr 20 25 30Gly
Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35
40 45Ser Gly Ile Ser Trp Arg Gly Asp Ser
Thr Gly Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asp65
70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Ile Tyr Tyr Cys 85
90 95Ala Ala Ala Ala Gly Ser Thr Trp Tyr Gly Thr
Leu Tyr Glu Tyr Asp 100 105
110Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly Gly Gly Gly
115 120 125Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser 130 135
140Gly Gly Gly Gly Ser Thr Arg Val Asp Gln Thr Pro Arg Thr Ala
Thr145 150 155 160Lys Glu
Thr Gly Glu Ser Leu Thr Ile Asn Cys Val Leu Thr Asp Thr
165 170 175Ser Tyr Gly Leu Tyr Ser Thr
Ser Trp Phe Arg Lys Asn Pro Gly Thr 180 185
190Thr Asp Trp Glu Arg Met Ser Ile Gly Gly Arg Tyr Val Glu
Ser Val 195 200 205Asn Lys Gly Ala
Lys Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val 210
215 220Ala Asp Ser Ala Thr Tyr Tyr Cys Lys Ala Gln Ser
Leu Ala Ile Ser225 230 235
240Thr Arg Ser Tyr Trp Tyr Asp Gly Ala Gly Thr Val Leu Thr Val Asn
245 250 255165259PRTArtificial
Sequence2V-9G8 165Thr Arg Val Asp Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr
Gly Glu1 5 10 15Ser Leu
Thr Ile Asn Cys Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr 20
25 30Ser Thr Ser Trp Phe Arg Lys Asn Pro
Gly Thr Thr Asp Trp Glu Arg 35 40
45Met Ser Ile Gly Gly Arg Tyr Val Glu Ser Val Asn Lys Gly Ala Lys 50
55 60Ser Phe Ser Leu Arg Ile Lys Asp Leu
Thr Val Ala Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Gln Ser Leu Ala Ile Ser Thr Arg Ser
Tyr Trp 85 90 95Tyr Asp
Gly Ala Gly Thr Val Leu Thr Val Asn Gly Gly Gly Gly Ser 100
105 110Gly Gly Gly Gly Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Gly 115 120
125Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val
130 135 140Gln Ala Gly Gly Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Arg Thr145 150
155 160Phe Ser Ser Tyr Ala Met Gly Trp Phe Arg Gln Ala
Pro Gly Lys Glu 165 170
175Arg Glu Phe Val Val Ala Ile Asn Trp Ser Ser Gly Ser Thr Tyr Tyr
180 185 190Ala Asp Ser Val Lys Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys 195 200
205Asn Thr Met Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp
Thr Ala 210 215 220Val Tyr Tyr Cys Ala
Ala Gly Tyr Gln Ile Asn Ser Gly Asn Tyr Asn225 230
235 240Phe Lys Asp Tyr Glu Tyr Asp Tyr Trp Gly
Gln Gly Thr Gln Val Thr 245 250
255Val Ser Ser166259PRTArtificial Sequence9G8-2V 166Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Arg Thr Phe Ser Ser Tyr 20 25
30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Val Ala Ile Asn Trp Ser Ser Gly
Ser Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Met Tyr65
70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Ala Ala Gly Tyr Gln Ile Asn Ser Gly Asn Tyr
Asn Phe Lys Asp Tyr 100 105
110Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Thr Arg Val Asp Gln Thr Pro
Arg145 150 155 160Thr Ala
Thr Lys Glu Thr Gly Glu Ser Leu Thr Ile Asn Cys Val Leu
165 170 175Thr Asp Thr Ser Tyr Gly Leu
Tyr Ser Thr Ser Trp Phe Arg Lys Asn 180 185
190Pro Gly Thr Thr Asp Trp Glu Arg Met Ser Ile Gly Gly Arg
Tyr Val 195 200 205Glu Ser Val Asn
Lys Gly Ala Lys Ser Phe Ser Leu Arg Ile Lys Asp 210
215 220Leu Thr Val Ala Asp Ser Ala Thr Tyr Tyr Cys Lys
Ala Gln Ser Leu225 230 235
240Ala Ile Ser Thr Arg Ser Tyr Trp Tyr Asp Gly Ala Gly Thr Val Leu
245 250 255Thr Val
Asn167124PRTArtificial Sequence7C12 167Ala Val Gln Leu Val Glu Ser Gly
Gly Gly Ser Val Gln Ala Gly Gly1 5 10
15Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly Arg Thr Ser Arg
Ser Tyr 20 25 30Gly Met Gly
Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35
40 45Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr Gly
Tyr Ala Asp Ser Val 50 55 60Lys Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asp65
70 75 80Leu Gln Met Asn Ser Leu Lys
Pro Glu Asp Thr Ala Ile Tyr Tyr Cys 85 90
95Ala Ala Ala Ala Gly Ser Thr Trp Tyr Gly Thr Leu Tyr
Glu Tyr Asp 100 105 110Tyr Trp
Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115
120168127PRTArtificial Sequence9G8 168Glu Val Gln Leu Val Glu Ser Gly Gly
Gly Leu Val Gln Ala Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Ser
Tyr 20 25 30Ala Met Gly Trp
Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35
40 45Val Ala Ile Asn Trp Ser Ser Gly Ser Thr Tyr Tyr
Ala Asp Ser Val 50 55 60Lys Gly Arg
Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Met Tyr65 70
75 80Leu Gln Met Asn Ser Leu Lys Pro
Glu Asp Thr Ala Val Tyr Tyr Cys 85 90
95Ala Ala Gly Tyr Gln Ile Asn Ser Gly Asn Tyr Asn Phe Lys
Asp Tyr 100 105 110Glu Tyr Asp
Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115
120 125169109PRTArtificial SequenceB1 169Ala Ser Val Asn
Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Val Thr Gly
Ala Asn Tyr Gly Leu Ala 20 25
30Ala Thr Tyr Trp Tyr Arg Lys Asn Pro Gly Ser Ser Asn Gln Glu Arg
35 40 45Ile Ser Ile Ser Gly Arg Tyr Val
Glu Ser Val Asn Lys Arg Thr Met 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys Ala
Tyr Pro Trp Gly Ala Gly Ala Pro Trp Leu Val 85
90 95Gln Trp Tyr Asp Gly Ala Gly Thr Val Leu Thr
Val Asn 100 105170112PRTArtificial SequenceD3
170Ala Ser Val Asn Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1
5 10 15Ser Leu Thr Ile Asn Cys
Val Leu Thr Asp Thr Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp
Trp Glu Arg 35 40 45Met Ser Ile
Gly Gly Arg Tyr Val Glu Ser Val Asn Lys Arg Ala Lys 50
55 60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala
Asp Ser Ala Thr65 70 75
80Tyr Tyr Cys Lys Ala Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly
85 90 95His Gly Tyr Asn Trp Tyr
Asp Gly Ala Gly Thr Val Leu Thr Val Asn 100
105 110171249PRTArtificial SequenceD3-D3 171Ala Ser Val
Asn Gln Thr Pro Arg Thr Ala Thr Lys Glu Thr Gly Glu1 5
10 15Ser Leu Thr Ile Asn Cys Val Leu Thr
Asp Thr Ser Tyr Gly Leu Tyr 20 25
30Ser Thr Ser Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg
35 40 45Met Ser Ile Gly Gly Arg Tyr
Val Glu Ser Val Asn Lys Arg Ala Lys 50 55
60Ser Phe Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys
Ala Gln Ser Gly Met Ala Ile Ser Thr Gly Ser Gly 85
90 95His Gly Tyr Asn Trp Tyr Asp Gly Ala Gly
Thr Val Leu Thr Val Asn 100 105
110Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Ala Ser Val Asn Gln Thr Pro 130 135
140Arg Thr Ala Thr Lys Glu Thr Gly Glu Ser Leu Thr Ile Asn Cys
Val145 150 155 160Leu Thr
Asp Thr Ser Tyr Gly Leu Tyr Ser Thr Ser Trp Phe Arg Lys
165 170 175Asn Pro Gly Thr Thr Asp Trp
Glu Arg Met Ser Ile Gly Gly Arg Tyr 180 185
190Val Glu Ser Val Asn Lys Arg Ala Lys Ser Phe Ser Leu Arg
Ile Lys 195 200 205Asp Leu Thr Val
Ala Asp Ser Ala Thr Tyr Tyr Cys Lys Ala Gln Ser 210
215 220Gly Met Ala Ile Ser Thr Gly Ser Gly His Gly Tyr
Asn Trp Tyr Asp225 230 235
240Gly Ala Gly Thr Val Leu Thr Val Asn
245172107PRTArtificial SequenceP3A1 172Thr Arg Val Asp Gln Thr Pro Arg
Thr Ala Thr Lys Glu Thr Gly Glu1 5 10
15Ser Leu Thr Ile Asn Cys Val Leu Thr Asp Thr Ser Tyr Gly
Leu Tyr 20 25 30Ser Thr Ser
Trp Phe Arg Lys Asn Pro Gly Thr Thr Asp Trp Glu Arg 35
40 45Met Ser Ile Gly Gly Arg Tyr Val Glu Ser Val
Asn Lys Gly Ala Lys 50 55 60Ser Phe
Ser Leu Arg Ile Lys Asp Leu Thr Val Ala Asp Ser Ala Thr65
70 75 80Tyr Tyr Cys Lys Ala Arg Glu
Ala Arg His Pro Trp Leu Arg Gln Trp 85 90
95Tyr Asp Gly Ala Gly Thr Val Leu Thr Val Asn
100 105
User Contributions:
Comment about this patent or add new information about this topic: