Patent application title: Fusion Enzymes
Inventors:
IPC8 Class: AC12N910FI
USPC Class:
1 1
Class name:
Publication date: 2017-01-05
Patent application number: 20170002337
Abstract:
The present disclosure relates to recombinant proteins having
N-acetylglucosaminyltransferase activity. The present disclosure further
relates to methods for producing complex N-glycans including the steps of
providing host cells containing such recombinant proteins and culturing
the host cells such that the recombinant proteins are expressed.Claims:
1-69. (canceled)
70. A fungal host cell comprising an expression vector comprising a polynucleotide encoding a fusion protein comprising an N-acetylglucosaminyltransferase I catalytic domain and an N-acetylglucosaminyltransferase II catalytic domain, wherein the N-acetylglucosaminyltransferase II catalytic domain is positioned N-terminal to the N-acetylglucosaminyltransferase I catalytic domain, and wherein the fusion protein catalyzes the transfer of N-acetylglucosamine to a terminal Man.alpha.3 residue and N-acetylglucosamine to a terminal Man.alpha.6 residue of an acceptor glycan, wherein the acceptor glycan is attached to a heterologous polypeptide.
71. The fungal host cell of claim 1, wherein the host cell is selected from the group consisting of Trichoderma, Aspergillus, Fusarium, Chrysosporium, Magnaporthe, Mycellopthora, Neurospora, or Penicillium.
Description:
CROSS-REFERENCE TO RELATED APPLICATION
[0001] This application claims the benefit of U.S. Provisional Application No. 61/417,144, filed Nov. 24, 2010, which is hereby incorporated by reference in its entirety.
SUBMISSION OF SEQUENCE LISTING ON ASCII TEXT FILE
[0002] The content of the following submission on ASCII text file is incorporated herein by reference in its entirety: a computer readable form (CRF) of the Sequence Listing (file name: 619672001040SEQLIST.txt, date recorded: Nov. 22, 2011, size: 305 KB).
FIELD OF THE INVENTION
[0003] The present disclosure relates to compositions and methods useful for the production of N-glycans.
BACKGROUND
[0004] Posttranslational modification of proteins is often necessary for proper protein folding and function. A common protein modification is the addition of oligosaccharides (glycans) to nascent polypeptides in the endoplasmic reticulum to form glycoproteins, a process known as glycosylation. N-glycosylation is of particular importance in the production of recombinant proteins used for therapeutic purposes. Because standard prokaryotic expression systems lack the proper machinery necessary for such modifications, alternative expression systems have to be used in production of these therapeutic proteins. Yeast and fungi are attractive options for expressing proteins as they can be easily grown at a large scale in simple media, which allows low production costs. Moreover, tools are available to manipulate the relatively simple genetic makeup of yeast and fungal cells as well as more complex eukaryotic cells such as mammalian or insect cells (De Pourcq et al., Appl Microbiol Biotechnol, 87(5):1617-31).
[0005] Fungal cells and mammalian cells share common steps in the early stages of glycosylation that result in the formation of mannose(8)N-acetylglucosamine(2) (Man8GlcNAc2). However, significant differences exist in the later stages of the process.
[0006] For example, in yeast, additional mannose subunits are added to Man8GlcNAc2 by mannosyltransferases and mannan polymerases to yield high-mannose type N-glycans. In contrast, mannose sugars are removed from the human Man8GlcNAc2 to yield Man5GlcNAc2, followed by three sequential reactions involving the enzymes N-acetylglucosaminyltransferase I (GnTI), mannosidase II (Mns II), and N-acetylglucosaminyltransferase II (GnTII), to convert Man5GlcNAc2 into GlcNAc2Man3GlcNAc2.
[0007] The differences between the glycosylation process in mammalian and fungal cells pose a challenge to the expression of glycosylated mammalian proteins in fungal cells since glycoproteins with high-mannose type N-glycans are not suitable for therapeutic use in humans (De Pourcq et al., 2010; Wildt and Gerngross, Nature Reviews Microbiology, 3: 119-128). Consequently, studies have been conducted to re-engineer the glycosylation pathways in yeast and fungal species to enable them to express recombinant human proteins. The general approach in glycoengineering of yeast or fungal cells has been to disrupt endogenous genes that are involved in formation of high-mannose type N-glycans. These gene disruptions can be combined with over-expression of endogenous mannosidases and/or glycosyltransferases and glycosidases from different species (Chiba et al., 1998, J Biol Chem 273: 26298-304; Kainz et al., 2008, Appl Environ Microbiol 74: 1076-86; Maras et al., 1997, Euro J Biochem 249: 701-07; Maras et al., 1999, Febs Letters 452: 365-70; Hamilton et al., 2003, Science 301: 1244-6; De Pourcq et al., 2010). However, the production of glycosylated mammalian proteins in non-mammalian cells still requires complicated and time-consuming genetic engineering and can be inefficient at producing a desired glycoprotein.
[0008] Thus, a need remains in the art for a simpler and more efficient system to express complex N-glycans in non-mammalian cells.
SUMMARY
[0009] Described herein are compositions including recombinant proteins having N-acetylglucosaminyltransferase activity. Further described herein are methods of producing complex N-glycans and methods of producing Man3GlcNAc2 glycans.
[0010] Thus one aspect includes recombinant proteins having N-acetylglucosaminyltransferase activity, where the recombinant proteins catalyze the transfer of N-acetylglucosamine to a terminal Man.alpha.3 residue and catalyze the transfer of N-acetylglucosamine to a terminal Man.alpha.6 residue of an acceptor glycan, and where the recombinant protein contains catalytic domains from at least two different enzymes. In certain embodiments, the acceptor glycan is attached to a molecule selected from an amino acid, a peptide, or a polypeptide. In certain embodiments, the molecule is a heterologous polypeptide. In certain embodiments that may be combined with the preceding embodiments, the acceptor glycan is Man3. In certain embodiments that may be combined with the preceding embodiments, the recombinant protein is a fusion protein containing an N-acetylglucosaminyltransferase I catalytic domain and an N-acetylglucosaminyltransferase II catalytic domain. In certain embodiments, the N-acetylglucosaminyltransferase I catalytic domain and the N-acetylglucosaminyltransferase II catalytic domain are from human enzymes. In certain embodiments, the N-acetylglucosaminyltransferase I catalytic domain includes a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to amino acid residues 105-445 of SEQ ID NO: 1. In certain embodiments that may be combined with the previous embodiments, the N-acetylglucosaminyltransferase II catalytic domain includes a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical amino acid residues 30-447 of SEQ ID NO: 21. In certain embodiments that may be combined with the preceding embodiments, the N-acetylglucosaminyltransferase I catalytic domain is N-terminal to the N-acetylglucosaminyltransferase II catalytic domain. In certain embodiments that may be combined with the preceding embodiments, the N-acetylglucosaminyltransferase II catalytic domain is N-terminal to the N-acetylglucosaminyltransferase I catalytic domain.
[0011] In certain embodiments that may be combined with the preceding embodiments, the recombinant proteins further contain a spacer in between the N-acetylglucosaminyltransferase I catalytic domain and the N-acetylglucosaminyltransferase II catalytic domain. In certain embodiments, the spacer contains sequence from a stem domain. In certain embodiments that may be combined with the preceding embodiments, the spacer is at least 5, at least 10, at least 15, at least 20, at least 30, at least 40, or at least 50 amino acids in length. In certain embodiments that may be combined with the preceding embodiments, the spacer contains a sequence that is selected from SEQ ID NO: 118, SEQ ID NO: 120, SEQ ID NO: 122, and SEQ ID NO: 124. In certain embodiments, the spacer contains a sequence that is selected from SEQ ID NO: 118, SEQ ID NO: 120, and SEQ ID NO: 124. In certain embodiments, the spacer contains the sequence of SEQ ID NO: 120 or SEQ ID NO: 124. In certain embodiments, the spacer contains the sequence of SEQ ID NO: 124.
[0012] In certain embodiments that may be combined with the preceding embodiments, the recombinant proteins further contain a targeting peptide linked to the N-terminal end of the catalytic domains. In certain embodiments, the targeting peptide contains a stem domain. In certain embodiments, the stem domain is from an N-acetylglucosaminyltransferase I enzyme or an N-acetylglucosaminyltransferase II enzyme. In certain embodiments, the N-acetylglucosaminyltransferase I enzyme and the N-acetylglucosaminyltransferase II enzyme are human enzymes. In certain embodiments that may be combined with the preceding embodiments, the stem domain is from a protein selected from a mannosidase, a mannosyltransferase, a glycosyltransferase, a Type 2 Golgi protein, MNN2, MNN4, MNN6, MNN9, MNN10, MNS1, KRE2, VAN1, or OCH1. In certain embodiments, the protein is from an organism selected from Acremonium, Aspergillus, Aureobasidium, Cryptococcus, Chrysosporium, Chrysosporium lucknowense, Filibasidium, Fusarium, Gibberella, Humicola, Magnaporthe, Mucor, Myceliophthora, Myrothecium, Neocallimastix, Neurospora, Paecilomyces, Penicillium, Piromyces, Schizophyllum, Talaromyces, Thermoascus, Thielavia, Tolypocladium, or Trichoderma. In certain embodiments that may be combined with the preceding embodiments, the targeting peptide is a Kre2 targeting peptide. In certain embodiments, the targeting peptide contains a transmembrane domain. In certain embodiments that may be combined with the preceding embodiments, the targeting peptide further contains a transmembrane domain linked to the N-terminal end of the stem domain. In certain embodiments that may be combined with the preceding embodiments, the transmembrane domain is from an N-acetylglucosaminyltransferase I enzyme or an N-acetylglucosaminyltransferase II enzyme. In certain embodiments, the N-acetylglucosaminyltransferase I enzyme and the N-acetylglucosaminyltransferase II enzyme are human enzymes. In certain embodiments that may be combined with the preceding embodiments, the transmembrane domain is from a protein selected from a mannosidase, a mannosyltransferase, a glycosyltransferase, a Type 2 Golgi protein, MNN2, MNN4, MNN6, MNN9, MNN10, MNS1, KRE2, VAN1, or OCH1. In certain embodiments, the protein is from an organism selected from Acremonium, Aspergillus, Aureobasidium, Cryptococcus, Chrysosporium, Chrysosporium lucknowense, Filibasidium, Fusarium, Gibberella, Humicola, Magnaporthe, Mucor, Myceliophthora, Myrothecium, Neocallimastix, Neurospora, Paecilomyces, Penicillium, Piromyces, Schizophyllum, Talaromyces, Thermoascus, Thielavia, Tolypocladium, or Trichoderma. In certain embodiments, the targeting peptide contains a cytoplasmic domain. In certain embodiments that may be combined with the preceding embodiments, the targeting peptide further contains a cytoplasmic domain linked to the N-terminal end of the stem domain. In certain embodiments that may be combined with the preceding embodiments, the targeting peptide further contains a cytoplasmic domain linked to the N-terminal end of the transmembrane domain. In certain embodiments that may be combined with the preceding embodiments, the cytoplasmic domain is from an N-acetylglucosaminyltransferase I enzyme or an N-acetylglucosaminyltransferase II enzyme. In certain embodiments, the N-acetylglucosaminyltransferase I enzyme and the N-acetylglucosaminyltransferase II enzyme are human enzymes. In certain embodiments that may be combined with the preceding embodiments, the cytoplasmic domain is from a protein selected from a mannosidase, a mannosyltransferase, a glycosyltransferase, a Type 2 Golgi protein, MNN2, MNN4, MNN6, MNN9, MNN10, MNS1, KRE2, VAN1, or OCH1. In certain embodiments, the protein is from an organism selected from Acremonium, Aspergillus, Aureobasidium, Cryptococcus, Chrysosporium, Chrysosporium lucknowense, Filibasidium, Fusarium, Gibberella, Humicola, Magnaporthe, Mucor, Myceliophthora, Myrothecium, Neocallimastix, Neurospora, Paecilomyces, Penicillium, Piromyces, Schizophyllum, Talaromyces, Thermoascus, Thielavia, Tolypocladium, or Trichoderma.
[0013] Another aspect includes recombinant proteins containing a human N-acetylglucosaminyltransferase II catalytic domain and a human N-acetylglucosaminyltransferase I catalytic domain where the N-acetylglucosaminyltransferase II catalytic domain is located N-terminal to the N-acetylglucosaminyltransferase I catalytic domain, a spacer sequence containing sequence from a human N-acetylglucosaminyltransferase I stem domain located in between the catalytic domains, and a targeting peptide located N-terminal to the N-acetylglucosaminyltransferase II catalytic domain where the targeting peptide contains a cytoplasmic domain, a transmembrane domain, and a stem domain from human N-acetylglucosaminyltransferase II. Another aspect includes a recombinant protein containing a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 95.
[0014] Another aspect includes recombinant proteins containing N-acetylglucosaminyltransferase II catalytic domain and a N-acetylglucosaminyltransferase I catalytic domain, where the N-acetylglucosaminyltransferase II catalytic domain is located N-terminal to the N-acetylglucosaminyltransferase I catalytic domain; a spacer located in between the catalytic domains, where the spacer contains a sequence selected from SEQ ID NO: 118, SEQ ID NO: 120, SEQ ID NO: 122, and SEQ ID NO: 124; and a targeting peptide located N-terminal to the N-acetylglucosaminyltransferase II catalytic domain where the targeting peptide contains a cytoplasmic domain, a transmembrane domain, and a stem domain from human N-acetylglucosaminyltransferase II. In certain embodiments, the spacer contains a sequence that is selected from SEQ ID NO: 118, SEQ ID NO: 120, and SEQ ID NO: 124. In certain embodiments, the spacer contains the sequence of SEQ ID NO: 120 or SEQ ID NO: 124. In certain embodiments, the spacer contains the sequence of SEQ ID NO: 124.
[0015] Another aspect includes isolated polynucleotides encoding the recombinant protein of any of the preceding embodiments. Another aspect includes expression vectors containing the isolated polynucleotide of the preceding embodiment operably linked to a promoter. In certain embodiments, the promoter is a constitutive promoter. In certain embodiments, the promoter is an inducible promoter. In certain embodiments, the promoter is from a gene selected from gpdA, cbh1, Aspergillus oryzae TAKA amylase, Rhizomucor miehei aspartic proteinase, Aspergillus niger neutral alpha-amylase, Aspergillus niger acid stable alpha-amylase, Aspergillus niger glucoamylase (glaA), Aspergillus awamori glaA, Rhizomucor miehei lipase, Aspergillus oryzae alkaline protease, Aspergillus oryzae triose phosphate isomerase, Aspergillus nidulans acetamidase, Aspergillus oryzae acetamidase, Fusarium oxysporum trypsin-like protease, fungal endo .alpha.-L-arabinase (abnA), fungal .alpha.-L-arabinofuranosidase A (abfA), fungal .alpha.-L-arabinofuranosidase B (abfB), fungal xylanase (xlnA), fungal phytase, fungal ATP-synthetase, fungal subunit 9 (oliC), fungal triose phosphate isomerase (tpi), fungal alcohol dehydrogenase (adhA), fungal .alpha.-amylase (amy), fungal amyloglucosidase (glaA), fungal acetamidase (amdS), fungal glyceraldehyde-3-phosphate dehydrogenase (gpd), yeast alcohol dehydrogenase, yeast alcohol oxidase, yeast lactase, yeast 3-phosphoglycerate kinase, yeast triosephosphate isomerase, bacterial .alpha.-amylase, bacterial Spo2, or SSO. Another aspect includes host cells containing the expression vector of any of the preceding embodiments.
[0016] Another aspect includes methods of producing the recombinant protein of any the preceding embodiments, including the steps of introducing an isolated polynucleotide that encodes the recombinant protein into a host cell, and culturing the host cell such that the recombinant protein is expressed. In certain embodiments, the methods further include a step of purifying the recombinant protein from the host cell. In certain embodiments that may be combined with the preceding embodiments, the host cell is a fungal cell. In certain embodiments, the fungal cell is selected from yeast or filamentous fungus.
[0017] Another aspect includes methods of producing a complex N-glycan including the steps of providing a host cell, where the host cell contains a polynucleotide encoding a fusion protein containing an N-acetylglucosaminyltransferase I catalytic domain and an N-acetylglucosaminyltransferase II catalytic domain, and culturing the host cell such that the fusion protein is expressed, where the fusion protein catalyzes the transfer of N-acetylglucosamine to a terminal Man.alpha.3 residue and N-acetylglucosamine to a terminal Man.alpha.6 residue of an acceptor glycan to produce a complex N-glycan. In certain embodiments, the complex N-glycan is attached to a molecule selected from an amino acid, a peptide, or a polypeptide. In certain embodiments, the molecule is a heterologous polypeptide. In certain embodiments that may be combined with the preceding embodiments, the acceptor glycan is Man3. In certain embodiments that may be combined with the preceding embodiments, the complex N-glycan is GlcNAc.beta.2Man.alpha.3(GlcNAc.beta.2Man.alpha.6)Man.beta.4GlcNAc.beta.4- GlcNAc. In certain embodiments that may be combined with the preceding embodiments, the host cell is a eukaryotic cell. In certain embodiments that may be combined with the preceding embodiments, the host cell is a fungal cell. In certain embodiments, the fungal cell is a yeast cell selected from S. cerevisiae, K. lactis, P. pastoris, H. polymorpha, C. albicans, Schizosaccharomyces, or Yarrowia. In certain embodiments that may be combined with the preceding embodiments, the fungal cell is a filamentous fungal cell selected from Trichoderma sp., Acremonium, Aspergillus, Aureobasidium, Cryptococcus, Chrysosporium, Chrysosporium lucknowense, Filibasidium, Fusarium, Gibberella, Magnaporthe, Mucor, Myceliophthora, Myrothecium, Neocallimastix, Neurospora, Paecilomyces, Penicillium, Piromyces, Schizophyllum, Talaromyces, Thermoascus, Thielavia, or Tolypocladium. In certain embodiments that may be combined with the preceding embodiments, the host cell further contains a polynucleotide encoding a UDP-GlcNAc transporter. In certain embodiments that may be combined with the preceding embodiments, the host cell has a reduced level of activity of a dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase compared to the level of activity in a wild-type host cell. In certain embodiments, the host cell has a reduced level of expression of an alg3 gene compared to the level of expression in a wild-type host cell. In certain embodiments, the alg3 gene is deleted from the host cell. In certain embodiments that may be combined with the preceding embodiments, the host cell has a reduced level of activity of an .alpha.-1,6-mannosyltransferase compared to the level of activity in a wild-type host cell. In certain embodiments, the host cell has a reduced level of expression of an och1 gene compared to the level of expression in a wild-type host cell. In certain embodiments, the och1 gene is deleted from the host cell. In certain embodiments that may be combined with the preceding embodiments, the host cell further contains a polynucleotide encoding an .alpha.-1,2-mannosidase. In certain embodiments that may be combined with the preceding embodiments, the host cell further contains a polynucleotide encoding a .beta.-1,4-galactosyltransferase. In certain embodiments that may be combined with the preceding embodiments, the host cell further contains a polynucleotide encoding a sialyltransferase. In certain embodiments that may be combined with the preceding embodiments, the host cell is a Trichoderma cell that has a reduced level of activity of a dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase compared to the level of activity in a wild-type Trichoderma cell. In certain embodiments that may be combined with the preceding embodiments, the host cell is a yeast or fungal cell that has a reduced level of activity of a dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase and a reduced level of activity of an alpha-1,6-mannosyltransferase compared to the levels of activity in a wild-type yeast cell and further contains a polynucleotide encoding an .alpha.-1,2-mannosidase.
[0018] Another aspect includes methods of producing a complex N-glycan including the steps of providing a Trichoderma host cell, where the host cell has a reduced level of expression of an alg3 gene compared to the level of expression in a wild-type host cell and contains a first polynucleotide encoding an N-acetylglucosaminyltransferase I catalytic domain and a second polynucleotide encoding an N-acetylglucosaminyltransferase II catalytic domain, and culturing the host cell to produce a complex N-glycan.
[0019] Another aspect includes methods of producing a complex N-glycan including the steps of incubating a fusion protein containing an N-acetylglucosaminyltransferase I catalytic domain and an N-acetylglucosaminyltransferase II catalytic domain, an acceptor glycan, and an N-acetylglucosamine donor together in a buffer, where the fusion protein catalyzes the transfer of N-acetylglucosamine to a terminal Man.alpha.3 residue and N-acetylglucosamine to a terminal Man.alpha.6 residue of an acceptor glycan to produce a complex N-glycan. In certain embodiments, the acceptor glycan is attached to a molecule selected from an amino acid, a peptide, or a polypeptide. In certain embodiments, the molecule is a heterologous polypeptide. In certain embodiments, the acceptor glycan is Man3. In certain embodiments that may be combined with the preceding embodiments, the N-acetylglucosamine donor is a UDP-GlcNAc transporter.
[0020] Another aspect includes filamentous fungal cells containing a mutation of alg3 and Man3GlcNAc2, where the Man3GlcNAc2 includes at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% (mol %) of neutral N-glycans secreted by the cells. The neutral N-glycans may be attached to a molecule selected from the group consisting of an amino acid, a peptide, and a polypeptide. In certain embodiments, the mutation of alg3 is a deletion of alg3. In certain embodiments that may be combined with the preceding embodiments, the cell is a Trichoderma reesei cell. In certain embodiments that may be combined with the preceding embodiments, the filamentous fungal cell further contains a first polynucleotide encoding an N-acetylglucosaminyltransferase I catalytic domain and a second polynucleotide encoding an N-acetylglucosaminyltransferase II catalytic domain. In certain embodiments that may be combined with the preceding embodiments, the filamentous fungal cell further contains a polynucleotide encoding a fusion protein containing an N-acetylglucosaminyltransferase I catalytic domain and an N-acetylglucosaminyltransferase II catalytic domain.
[0021] Another aspect includes methods of producing a Man3GlcNAc2 glycan in a host cell including the steps of providing a host cell with a reduced level of activity of a mannosyltransferase compared to the level of activity in a wild-type host cell and culturing the host cell to produce a Man3GlcNAc2 glycan, where the Man3GlcNAc2 glycan includes at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or100% (mol %) of the neutral N-glycans secreted by the host cell. The neutral N-glycans may be attached to a molecule selected from an amino acid, a peptide, and a polypeptide. In certain embodiments, the Man3GlcNAc2 glycan is attached to a heterologous polypeptide. In certain embodiments that may be combined with the preceding embodiments, the mannosyltransferase is a dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase. In certain embodiments that may be combined with the preceding embodiments, the host cell has a reduced level of expression of an alg3 gene compared to the level of expression in a wild-type host cell. In certain embodiments, the alg3 gene is deleted from the host cell. In certain embodiments that may be combined with the preceding embodiments, the host cell is a Trichoderma cell. In certain embodiments that may be combined with the preceding embodiments, the level of activity of alpha-1,6-mannosyltransferase in the host cell is reduced compared to the level of activity in a wild-type host cell. In certain embodiments that may be combined with the preceding embodiments, the host cell contains an endogenous polynucleotide encoding an .alpha.-1,2-mannosidase.
[0022] Another aspect includes a filamentous fungal cell having a reduced level of expression of an alg3 gene compared to the level of expression in a wild-type filamentous fungal cell, where the filamentous fungal cell contains a recombinant protein of any of the preceding embodiments. In certain embodiments, the alg3 gene contains a mutation. Preferably, the recombinant protein has N-acetylglucosaminyltransferase activity, where the recombinant protein catalyzes the transfer of N-acetylglucosamine to a terminal Man.alpha.3 residue and catalyzes the transfer of N-acetylglucosamine to a terminal Man.alpha.6 residue of an acceptor glycan, and where the recombinant protein is a fusion protein containing an N-acetylglucosaminyltransferase I catalytic domain and an N-acetylglucosaminyltransferase II catalytic domain. In certain embodiments, the mutation of the alg3 gene is a deletion of the alg3 gene. In certain embodiments that may be combined with the preceding embodiments, the fusion protein is encoded by a polynucleotide operably linked to a promoter. In certain embodiments, the promoter is an inducible promoter. In certain embodiments, the inducible promoter is the cbh1 promoter. In certain embodiments that may be combined with the preceding embodiments, the filamentous fungal cell further contains a polynucleotide encoding a UDP-GlcNAc transporter. In certain embodiments that may be combined with the preceding embodiments, the filamentous fungal has a reduced level of activity of an .alpha.-1,6-mannosyltransferase compared to the level of activity in a wild-type filamentous fungal cell. In certain embodiments, the filamentous fungal has a reduced level of expression of an och1 gene compared to the level of expression in a wild-type filamentous fungal cell. In certain embodiments that may be combined with the preceding embodiments, the filamentous fungal cell further contains a polynucleotide encoding an .alpha.-1,2-mannosidase. In certain embodiments that may be combined with the preceding embodiments, the filamentous fungal cell further contains a polynucleotide encoding a .beta.-1,4-galactosyltransferase. In certain embodiments that may be combined with the preceding embodiments, the filamentous fungal cell further contains a polynucleotide encoding a sialyltransferase. In certain embodiments that may be combined with the preceding embodiments, the filamentous fungal cell is selected from Trichoderma sp., Acremonium, Aspergillus, Aureobasidium, Cryptococcus, Chrysosporium, Chrysosporium lucknowense, Filibasidium, Fusarium, Gibberella, Magnaporthe, Mucor, Myceliophthora, Myrothecium, Neocallimastix, Neurospora, Paecilomyces, Penicillium, Piromyces, Schizophyllum, Talaromyces, Thermoascus, Thielavia, and Tolypocladium.
DESCRIPTION OF THE FIGURES
[0023] FIG. 1 shows mass spectrometric neutral N-glycan profiles of average glycosylation on T. reesei strains M44, M81, M84, M109, M110, M131, M132, M133, M134, and M124.
[0024] FIG. 2 shows fragmentation analysis of monophosphorylated Man7Gn2. Only one example structure of monophosphorylated Man7Gn2 is shown.
[0025] FIG. 3 shows mass spectrometric acidic glycan profiles of T. reesei strains M44, M81, M84, M109, M110, M131, M132, M133, M134, and M124.
[0026] FIG. 4 shows neutral (a) and acidic (b) N-glycan profiles of T. reesei strain M44 cultured in a fermentor for 131.4 hours (fed batch).
[0027] FIG. 5 shows mass spectrometric neutral (a) and acidic (b) N-glycan profiles of T. reesei culture medium.
[0028] FIG. 6 shows a membrane blot of T. reesei M44 secreted proteins.
[0029] FIG. 7 shows an example of analyzed protein bands of T. reesei M44 cultivated in a fermentor. The glycosylation of proteins did not differ significantly from average glycosylation in T. reesei. The spectrum was focused to the minor base line signals, and the major signal of the spectrum was not quantitative in comparison to other signals.
[0030] FIG. 8 shows a Southern blot of DNA from the parental strain and from Alg3 knockout strains with an alg3 probe.
[0031] FIG. 9A shows a restriction enzyme map of a section of the pTTv38 construct with sizes of predicted restriction products. FIG. 9B shows a Southern blot of genomic DNA from the parental strain and the Alg3 knockout strains digested with EcoRI+PvuI (E+P) or KpnI+NheI (K+N). The control DNA was pTTv38 plasmid DNA digested with NotI. The blot was probed with an AmdS probe.
[0032] FIG. 10 shows MALDI analysis of neutral N-glycans. Part A shows the parental strain M124. Part B shows the Alg3 knockout 4A. Squares represent N-acetylglucosamine, and circles represent mannose, except for the one labeled glucose.
[0033] FIG. 11 shows fragmentation analysis of Man3Gn2 from the 4A Alg3 knockout strain.
[0034] FIG. 12 shows fragmentation analysis of Hex5Gn2 from Alg3 knockout strain 4A (part A) and parental strain M124 (part B). The signal marked with a box exists only as an isomer from the Alg3 knockout strain.
[0035] FIG. 13 shows neutral N-glycans from Alg3 knockout strain 4A after .alpha.-mannosidase digestion.
[0036] FIG. 14 shows the separation of two major glycans from the Alg3 knockout strain by liquid chromatography.
[0037] FIG. 15 shows proton NMR spectra of Hex3HexNAc2 (part A) and Hex6HexNAc2 (part B) fractions. Spectra were collected at 40.degree. C. using a Varian Unity INOVA 600 MHz spectrometer equipped with a cryoprobe.
[0038] FIG. 16 shows the acidic fraction of parental strain M124 (part A) and Alg3 knockout strain 4A (B). N-glycans with two phosphate units are marked with an asterisk.
[0039] FIG. 17 shows neutral N-glycans from supernatant of T. reesei Alg3 knockout strain 4A that was cultured in a flask for 5 days.
[0040] FIG. 18 shows neutral N-glycans from supernatant of T. reesei Alg3 knockout strain 4A that was cultured in a fermentor for 10 days.
[0041] FIG. 19 shows a MALDI spectrum of GnTI reaction mixture. GnTI has converted 54% of the acceptor to the product with one additional HexNAc.
[0042] FIG. 20 shows Western blot analysis of GnTII expression. Samples were run in 12% SDS-PAGE gel and blotted on nitrocellulose membrane. Histidine-tagged GnTII was detected on the membrane using mouse .alpha.-HIS monoclonal antibodies. Numbers shown on the left are the sizes of molecular weight marker proteins (kDa).
[0043] FIG. 21 shows a MALDI spectrum of GnTII reaction mixture. 83% of the acceptor (m/z 913.340) was converted to product (m/z 1136.433).
[0044] FIG. 22 shows GnTI activity observed for the GnTI/GnTII fusion protein.
[0045] FIG. 23 shows the N-glycans present in GnTI/GnTII T. reesei transformants obtained by targeting to the alg3 locus.
[0046] FIG. 24 shows a MALDI spectrum of the purified reaction mixture from the enzyme activity test of the GnTII/GnTI fusion protein.
[0047] FIG. 25 shows a spectrum of the .beta.1-2,3,4,6-N-acetylglucosaminidase reaction mixture.
[0048] FIG. 26 shows a MALDI spectrum of .beta.1-4GalT reaction mixture.
[0049] FIG. 27 shows diagrams of observed N-glycans from supernatant proteins of T. reesei M127 pTTv110 transformants (gnt II/I in alg3 locus) on days 3 (A), 5 (B) and 7 (C and D). The clone 17A produced the most G0 on day 7. (E) Mass spectrum of neutral N-glycans of supernatant proteins from T. reesei strain M127 GnT II/I transformant clone 17A cultivated for 7 days in shake flasks. Signals marked with asterisks originated from the culture medium.
[0050] FIG. 28 shows neutral N-glycans of rituximab from T. reesei M202 GnT II/I transformant clones (A) 9A-1 and (B) 31A-1, both cultivated with soybean trypsin inhibitor, and (C) mass spectrum of neutral N-glycans of rituximab purified from T. reesei strain M202 GnT II/I transformant clone 9A-1 cultivated for 5 days in shake flasks in the presence of soybean trypsin inhibitor.
[0051] FIG. 29 shows MALDI spectra of spacer modified GnTII/GnTI fusion reaction mixtures. Part (A) shows a reaction mixture of GnTII/GnTI with 3.times.G4S spacer modification. 36% of the acceptor has been converted to product with two additional HexNAcs. Part (B) shows a reaction mixture of GnTII/GnTI with 2.times.G4S spacer modification. 38% of the acceptor has been converted to product with two additional HexNAcs. Calculated m/z values for [M+Na]+-signals of GnTI product, Hex3HexNAc2 (calc. m/z 933.318), was not detected in either spectra because all of the GnTI product was converted directly to Hex3HexNAc3, (calc. m/z 1136.318).
[0052] FIG. 30 shows Western blots of GnTII/I spacer variant cell pellets (A), and supernatants (B). Lanes 1.GnTII positive control, 2 GY3 mock strain, 3.GY7-2 wild type GnTII/I 4.GY32-5 3.times.G4S spacer, 5. GY32-9 3.times.G4S spacer, 6.GY33-7 2.times.G4S spacer, 7.GY33-8 2.times.G4S spacer, 8.GY49-3 CBHI spacer and 9.GY50-10 EGIV spacer.
[0053] FIG. 31 shows GnT activities of wild-type GnTII/I and spacer variants from supernatants and expressed in the presence of protease inhibitors after day 3 (A) expression phases and day 4 (B) expression phases. The x-axis depicts sample identity (wt--wild-type, _1, _2=parallel clones of the spacer variants), and the y-axis depicts percentage of products formed (GnTI and GnTII reaction products added together).
[0054] FIG. 32 shows GnT activities of GnTII/I fusion protein (with wild type spacer) in supernatant, cells and lysate. GnTI and GnTII products have been added together
[0055] FIG. 33 shows GnT activities of GnTII/I wild-type and spacer variants in (A) supernatants, (B) cells, and (C) lysates.
[0056] FIG. 34 shows example spectra of neutral N-glycans of parental strain M124 and GnT1 transformants on day 5. Signal with Gn addition (m/z 1460) is marked with an arrow. (pTTv11 with cbh1 promoter, pTTv13 with gpdA promoter).
[0057] FIG. 35 shows the amounts of Man5 and Gn1Man5 in four positive GNT1 transformants on days 3 and 5. Quantitation was carried out against internal calibrant (Hex2HexNAc4, 2 pmol).
[0058] FIG. 36 shows example spectra of phosphorylated N-glycans of parental M124 strain and GnT1 transformants with internal calibrant (NeuAcHex4HexNAc2, 0.5 pmol.). GnT1 products are marked with an arrow.
[0059] FIG. 37 shows diagrams of neutral N-glycans of different GnTII strains/clones from day 5. Part (A) show the pTTv140 clone. Part (B) shows the pTTv142 clone. Part (C) shows the pTTv143 clone. Part (D) shows the pTTv141 clone.
[0060] FIG. 38 shows an example of neutral N-glycans of different GnTII strains/clones and the parental strain M198 from days 3, 5, and 7. Part (A) shows clone 1-117A. Part (B) shows clone 3-11A. Part (C) shows clone 30A. Part (D) shows parental stain M198.
[0061] FIG. 39 shows the membrane of separated proteins of T. reesei strain M198 and GnTII clone 3-17A. The 50 kDA protein is marked with an arrow.
[0062] FIG. 40 shows column diagrams of total secreted proteins versus individual secreted protein(s) of parental strain M198 (A) and the GnTII clone 3-17A (B).
[0063] FIG. 41 shows a column diagram of fermentor cultured GnTII strain M329 from day 3 to day 7, and shake flask culture of strain M329 from day 5.
[0064] FIG. 42 shows a multiple amino acid sequence alignment of T. reesei ALG3 and ALG3 homologs.
DETAILED DESCRIPTION
[0065] The present invention relates to recombinant proteins having N-acetylglucosaminyltransferase activity where the recombinant protein catalyzes the transfer of N-acetylglucosamine (GlcNAc) to a terminal Man.alpha.3 residue and catalyzes the transfer of N-acetylglucosamine to a terminal Man.alpha.6 residue of an acceptor glycan, and where the recombinant protein contains catalytic domains from at least two different enzymes.
[0066] In some embodiments, the recombinant proteins of the invention include two catalytic domains, where one catalytic domain has N-acetylglucosaminyltransferase I (GnTI) activity (e.g., reacts with a terminal Man.alpha.3 residue), and the other catalytic domain has N-acetylglucosaminyltransferase II (GnTII) activity (e.g., reacts with a terminal Man.alpha.6 residue).
[0067] In some embodiments, the recombinant proteins of the present invention catalyze reactions that occur essentially sequentially. For example, the recombinant proteins of the present invention may catalyze the transfer of GlcNAc to a terminal Man.alpha.3-residue, first, and then catalyze the transfer of GlcNAc to a terminal Man.alpha.6-residue of an acceptor glycan. In one embodiment, the essentially sequential reactions are at least 10 fold, at least 20 fold, at least 30 fold, at least 40 fold, at least 50 fold, at least 60 fold, at least 70 fold, at least 80 fold, at least 90 fold, or at least 100 fold, more effective than the two reactions in the reversed order. In certain embodiments, a sequential reaction means that essentially or absolutely no GlcNAc can be transferred to the terminal Man.alpha.6-residue if GlcNAc has not yet been transferred to the terminal Man.alpha.3-residue. In a specific embodiment, the acceptor glycan contains a GlcNAc.beta.2Man.alpha.3-branch.
[0068] In some embodiments, the recombinant proteins react specifically with both Man.alpha.3 and Man.alpha.6 residues, optionally in branched acceptor glycans but not substantially or absolutely with other Man.alpha.-structures, e.g. Man.alpha.-monosaccharide conjugates, with Man.alpha.benzyl and/or Man.alpha.Ser/Thr-peptide. The non-substantial reactivity is preferably below 10%, below 8%, below 6%, below 4%, below 2%, below 1%, or below 0.1% of the Vmax with 0.1 mM acceptor glycan concentrations of reactions with terminal Man.alpha.3 and Man.alpha.6 residues. In a specific embodiment, the recombinant proteins have substantially similar reactivities with the terminal Man.alpha.3 (preferably as GnTI reaction) and the terminal Man.alpha.6 residue (preferably as GnTII reaction) of the acceptor glycan. Preferably neither catalytic activity has more than a 10-fold, 5-fold, 3-fold or 2-fold difference in reaction effectiveness compared to the other catalytic activity under the same conditions.
[0069] In a specific embodiment, the transfer of GlcNAc to the terminal Man.alpha.3 and Man.alpha.6 cause a conversion of at least 10%, at least 25%, at least 50%, at least 70%, at least 90%, or at least 95% of Man3 glycan to a glycan with two terminal GlcNAcs. The effectiveness of the reaction can be measured by in vitro or in vivo assays as described in the examples disclosed herein. The effectiveness of the GlcNAc transfer reactions can be measured essentially as described in the Examples or as maximal reaction rate Vmax with 0.1 mM acceptor concentrations and saturating donor concentrations. In a specific embodiment, the effectiveness of the reaction is measured with a Man3 acceptor glycan attached to an amino acid, a peptide, or a polypeptide.
[0070] The present disclosure further relates to methods of producing a complex N-glycan, including the steps of providing a host cell, where the host cell contains a nucleic acid encoding a fusion protein containing an N-acetylglucosaminyltransferase I catalytic domain and an N-acetylglucosaminyltransferase II catalytic domain, and culturing the host cell such that the fusion protein is expressed, where the fusion protein catalyzes the transfer of N-acetylglucosamine to a terminal Man.alpha.3 residue and N-acetylglucosamine to a terminal Man.alpha.6 residue of an acceptor glycan to produce a complex N-glycan.
[0071] The present invention also relates to a filamentous fungal cell having a reduced level of expression of an alg3 gene compared to the level of expression in a wild-type filamentous fungal cell, where the filamentous fungal cell contains a recombinant protein of the invention.
[0072] Definitions
[0073] As used herein, "recombinant protein" refers to any protein that has been produced from a recombinant nucleic acid. "Recombinant nucleic acid" as used herein refers to a polymer of nucleic acids where at least one of the following is true: (a) the sequence of nucleic acids is foreign to (i.e., not naturally found in) a given host cell; (b) the sequence may be naturally found in a given host cell, but is present in an unnatural (e.g., greater than expected) amount or expressed at a level that is more or less than the natural level of expression; or (c) the sequence of nucleic acids includes two or more sub-sequences that are not found in the same relationship to each other in nature. For example, regarding instance (c), a recombinant nucleic acid sequence will have two or more sequences from unrelated genes arranged to make a new functional nucleic acid. In another example, a recombinant nucleic acid sequence will contain a promoter sequence and a gene-encoding sequence that are not naturally found adjacent to one another.
[0074] As used herein, "N-acetylglucosaminyltransferase activity" refers to the activity of an enzyme that transfers an N-acetylglucosaminyl residue (GlcNAc) to an acceptor glycan. Typically, enzymes having this activity are N-acetylglucosaminyltransferases (GlcNAc transferases). In certain embodiments, GlcNAc transferases are eukaryotic. In certain embodiments, the GlcNAc transferases are mammalian enzymes forming a .beta.-linkage from the 1-position of a GlcNAc-residue to the terminal mannose residues. In certain embodiments, the GlcNAc transferases are .beta.2-N-acetylglucosaminyltransferases transferring .beta.2-linked GlcNAc-residue(s) to the 2-position terminal mannose residues of glycans, in particular to an N-linked glycan. In certain embodiments, the .beta.2-GlcNAc transferases are enzymes having GnTI activity and GnTII activity. GnTI activity transfers a GlcNAc residue to a Man.alpha.3 branch. The Man.alpha.3 branch may be a Man.alpha.3(R-Man.alpha.6)Man.beta.-branch of on N-linked glycan core structure, such as Man3GlcNAc2 or Man3 or Man5GlcNAc2 or Man5. GnTI enzymes may be mammalian enzymes, plant enzymes, or lower eukaryotic enzymes. GnTII activity transfers a GlcNAc residue to a Man.alpha.6-branch such as a Man.alpha.6(GlcNAc.beta.2Man.alpha.3)Man.beta.-branch of an N-linked glycan core structure. An example of such a Man.alpha.6-branch is GlcNAclMan3GlcNAc2.
[0075] As used herein, "N-acetylglucosamine" refers to an N-acetylglucosamine residue (GlcNAc). GlcNAc may be part of a glycan structure. The amine group is on position 2, has a D-configuration, and has a pyranose structure as a residue. It may be alternatively named 2-acetamido-2-deoxy-D-glucopyranose (D-GlcpNAc). GlcNAc may also be a free reducing monosaccharide (i.e., not part of glycan).
[0076] As used herein, "Man" refers to a mannose residue. A "terminal Man.alpha.3" or a "terminal Man.alpha.6" refers to a mannose that is not substituted to the non-reducing end terminal residue by another monosaccharide residue or residues.
[0077] As used herein, "glycan" refers to an oligosaccharide chain that can be linked to a carrier such as an amino acid, peptide, polypeptide, lipid or a reducing end conjugate. In certain embodiments, the invention relates to N-linked glycans conjugated to a polypeptide N-glycosylation site such as -Asn-Xxx-Ser/Thr- by N-linkage to side-chain amide nitrogen of asparagine residue (Asn), where Xxx is any amino acid residue except Pro. The invention may further relate to glycans as part of dolichol-phospho-oligosaccharide (Dol-P-P-OS) precursor lipid structures, which are precursors of N-linked glycans in the endoplasmic reticulum of eukaryotic cells. The precursor oligosaccharides are linked from their reducing end to two phosphate residues on the dolichol lipid. For example, .alpha.3-mannosyltransferase Alg3 modifies the Dol-P-P-oligosaccharide precursor of N-glycans. Generally, the glycan structures described herein are terminal glycan structures, where the non-reducing residues are not modified by other monosaccharide residue or residues.
[0078] As used herein, "glycoprotein" refers to a peptide or polypeptide attached to a glycan. The glycan may be attached to the peptide or polypeptide in a cotranslational or posttranslational modification.
[0079] As used herein, "glycolipid" refers to a lipid attached to a glycan and includes glyceroglycolipids, glycosphingolipids, and glycosylphosphatidylinositols.
[0080] As used throughout the present disclosure, glycolipid and carbohydrate nomenclature is essentially according to recommendations by the IUPAC-IUB Commission on Biochemical Nomenclature (e.g. Carbohydrate Res. 1998, 312, 167; Carbohydrate Res. 1997, 297, 1; Eur. J. Biochem. 1998, 257, 29). It is assumed that Gal (galactose), Glc (glucose), GlcNAc (N-acetylglucosamine), GalNAc (N-acetylgalactosamine), Man (mannose), and Neu5Ac are of the D-configuration, Fuc of the L-configuration, and all the monosaccharide units in the pyranose form (D-Galp, D-Glcp, D-GlcpNAc, D-GalpNAc, D-Manp, L-Fucp, D-Neup5Ac). The amine group is as defined for natural galactose and glucosamines on the 2-position of GalNAc or GlcNAc. Glycosidic linkages are shown partly in shorter and partly in longer nomenclature, the linkages of the sialic acid SA/Neu5X-residues .alpha.3 and .alpha.6 mean the same as .alpha.2-3 and .alpha.2-6, respectively, and for hexose monosaccharide residues .alpha.1-3, .alpha.1-6, .beta.1-2, .beta.1-3, .beta.1-4, and .beta.1-6 can be shortened as .alpha.3, .alpha.6, .beta.2, .beta.3, .beta.4, and .beta.6, respectively. Lactosamine refers to type II N-acetyllactosamine, Gal.beta.4GlcNAc, and/or type I N-acetyllactosamine. Gal.beta.3GlcNAc and sialic acid (SA) refer to N-acetylneuraminic acid (Neu5Ac), N-glycolylneuraminic acid (Neu5Gc), or any other natural sialic acid including derivatives of Neu5X. Sialic acid is referred to as NeuNX or Neu5X, where preferably X is Ac or Gc. Occasionally Neu5Ac/Gc/X may be referred to as NeuNAc/NeuNGc/NeuNX.
[0081] Recombinant Proteins of the Invention
[0082] The invention herein relates to recombinant proteins having N-acetylglucosaminyltransferase activity, where the recombinant proteins catalyze the transfer of N-acetylglucosamine to a terminal Man.alpha.3 residue and catalyze the transfer of N-acetylglucosamine to a terminal Man.alpha.6 residue of an acceptor glycan. Recombinant proteins of the invention may include, without limitation, full length proteins having N-acetylglucosaminyltransferase activity, fragments of proteins having N-acetylglucosaminyltransferase activity, catalytic domains having N-acetylglucosaminyltransferase activity, and fusion proteins having N-acetylglucosaminyltransferase activity. A single recombinant protein of the invention has the capability to catalyze both transfers of N-acetylglucosamines. The transfer of N-acetylglucosamine to a terminal Man.alpha.3 residue may occur before or after the transfer of N-acetylglucosamine to a terminal Man.alpha.6 residue. Alternatively, the transfers may occur simultaneously.
[0083] The acceptor glycan may be attached to a molecule such as an amino acid, a peptide, or a polypeptide. In certain embodiments, the amino acid is an asparagine residue. The asparagine residue may be in aminoglycosidic linkage from the side-chain amide (a biologic mammalian polypeptide N-glycan linkage structure) and may be part of a peptide chain such as a dipeptide, an oligopeptide, or a polypeptide. The glycan may be a reducing end derivative such as an N-, O-, or C-linked, preferably glycosidic, derivative of the reducing GlcNAc or Man, such as a spacer or terminal organic residue with a certain glycan linked structure selected from the group of an amino acid, alkyl, heteroalkyl, acyl, alkyloxy, aryl, arylalkyl, or heteroarylalkyl. The spacer may be further linked to a polyvalent carrier or a solid phase. In certain embodiments, alkyl-containing structures include methyl, ethyl, propyl, and C4-C26 alkyls, lipids such as glycerolipids, phospholipids, dolichol-phospholipids and ceramides and derivatives. The reducing end may also be derivatized by reductive amination to a secondary amine linkage or a derivative structure. Certain carriers include biopoly- or oligomers such as (poly)peptides, poly(saccharides) such as dextran, cellulose, amylose, or glycosaminoglycans, and other organic polymers or oligomers such as plastics including polyethylene, polypropylene, polyamides (e.g., nylon or polystyrene), polyacrylamide, and polylactic acids, dendrimers such as PAMAM, Starburst or Starfish dendrimers, or polylysine, and polyalkylglycols such as polyethylene glycol (PEG). Solid phases may include microtiter wells, silica particles, glass, metal (including steel, gold, and silver), polymer beads such as polystyrene or resin beads, polylactic acid beads, polysaccharide beads or organic spacers containing magnetic beads.
[0084] In certain embodiments, the acceptor glycan is attached to a heterologous polypeptide. As used herein, a "peptide" and a "polypeptide" are amino acid sequences including a plurality of consecutive polymerized amino acid residues. For purpose of this invention, typically, peptides are those molecules including up to 50 amino acid residues, and polypeptides include more than 50 amino acid residues. The peptide or polypeptide may include modified amino acid residues, naturally occurring amino acid residues not encoded by a codon, and non-naturally occurring amino acid residues. As used herein, "protein" may refer to a peptide or a polypeptide of any size. The term "heterologous polypeptide" refers to a polypeptide that is not naturally found in a given host cell or is not endogenous to a given host cell. In certain embodiments, the heterologous polypeptide is a therapeutic protein. Therapeutic proteins, for example, may include monoclonal antibodies, erythropoietins, interferons, growth hormones, enzymes, or blood-clotting factors. For example, the acceptor glycan may be attached to a therapeutic protein such as rituximab.
[0085] Acceptor Glycans
[0086] In certain embodiments, the structure of the acceptor glycan has the following formula, [R.sub.1].sub.yMan.alpha.3([R.sub.2].sub.zMan.alpha.6)Man{.beta.4GlcNAc(F- uc.alpha.x).sub.n[.beta.4GlcNAc].sub.m}.sub.q, where q, y, z, n and m are 0 or 1; x is linkage position 3 or 6, of optional fucose residue; R1 is GlcNAc, preferably GlcNAc.beta.2; and R2 is a branched structure Man.alpha.3(Man.alpha.6), with the provision that when z is 1, then y is 0, and when z is 0, then y is 0 or 1. ( ) defines a branch in the regular N-glycan core structure, either present or absent. [ ] and { } define a part of the glycan structure either present or absent in a linear sequence. When z is 0 and y is 0 then the structure is a Man3 glycan, and when z is 0 and y is 1, the structure is a GlcNAcMan3 glycan. When y is 0 and z is 1, the glycan is a Man5 glycan. The acceptor glycan may be beta-glycosidically linked to an Asn residue, preferably from the reducing end GlcNAc. In one embodiment, the acceptor glycan is a polypeptide linked N-glycan, where m and q are 1, and the acceptor structure contains a derivative of [R.sub.1].sub.yMan.alpha.3([R.sub.2].sub.2Man.alpha.6)Man.beta.4GlcNAc(Fu- c.alpha.x).sub.n.beta.4GlcNAc. Optional derivatives include substitutions by monosaccharide residues such as GlcNAc or xylose.
[0087] The acceptor glycan may be Man3, GlcNAcMan3, or Man5. In certain embodiments, the acceptor glycan is Man3 or GlcNAcMan3. Man3 is a trimannosyl glycan comprising at least one of Man.alpha.3 or Man.alpha.6 residues and is preferably a branched oligosaccharide, such as Man.alpha.3(Man.alpha.6)Man. Other certain Man3 oligosaccharides are Man.alpha.3(Man.alpha.6)Man.beta., Man.alpha.3(Man.alpha.6)Man.beta.4GlcNAc, and polypeptide-linked Man.alpha.3(Man.alpha.6)Man.beta.4GlcNAc.beta.4GlcNAc. In addition, depending on the host cell, the glycan can contain Fuc, Xyl or GlcNAc in Man.beta. and/or GlcNAc residues, such as Man.alpha.3(Man.alpha.6)Man.beta.4GlcNAc.beta.4(Fuc.alpha.x).sub.nGlcNAc, where x is 3 or 6 and n is 0 or 1, also described by a monosaccharide composition formula indicating the terminal mannose structure and reducing end composition as Man3GlcNAc2 (n is 0) and Man3GlcNAc2Fuc (n is 1). In certain embodiments, especially those with a polypeptide-linked structure, the Man3 structure is a Man.alpha.3(Man.alpha.6)Man.beta.4GlcNAc.beta.4(Fuc.alpha.6).sub.nGlcNAc. In certain embodiments, the polypeptide-linked GlcNAcMan3 structure is GlcNAc.beta.2Man.alpha.3(Man.alpha.6)Man.beta.4GlcNAc.beta.4(Fuc.alpha.6)- .sub.nGlcNAc, also described by a monosaccharide composition formula GlcNAcMan3GlcNAc2 (n is 0) and GlcNAcMan3GlcNAc2Fuc (n is 1). In certain embodiments, the polypeptide-linked Man5 structure is Man.alpha.3{Man.alpha.3(Man.alpha.6)Man.alpha.6}Man.beta.4GlcNAc.beta.4(F- uc.alpha.6).sub.nGlcNAc, where { } and ( ) indicate a branch and n is 0 or 1, also described by a monosaccharide composition formula Man5GlcNAc2 (n is 0) and Man5GlcNAc2Fuc (n is 1).
[0088] Accordingly, the certain Man3 glycans have structures according to the following formula, Man.alpha.3(Man.alpha.6)Man.beta.4GlcNAc(Fuc.alpha.x).sub.n.beta.4GlcNAc, where n is 0 or 1, indicating presence or absence of part of the molecule, where x is 3 or 6, and where ( ) defines a branch in the structure. In embodiments of the invention where the acceptor glycan is Man3, the recombinant protein catalyzes the transfer of N-acetylglucosamine to the terminal Man.alpha.3 and Man.alpha.6 of Man3, thus resulting in GlcNAc2Man3, GlcNAc.beta.2Man.alpha.3(GlcNAc.beta.2Man.alpha.6)Man.beta.4GlcNAc.beta.4- (Fuc.alpha.x).sub.nGlcNAc, where n is 0 or 1, also described by a monosaccharide composition formula GlcNAc2Man3GlcNAc2 (n is 0) and GlcNAc2Man3GlcNAc2Fuc (n is 1).
[0089] In embodiments of the invention where the acceptor glycan is Man5, the recombinant protein catalyzes the transfer of N-acetylglucosamine to the terminal Man.alpha.3 of Man5. After 2 mannoses have been removed from GlcNAcMan5 (for example, by mannosidase II) to form GlcNAcMan3, the recombinant protein catalyzes the transfer of N-acetylglucosamine to the terminal Man.alpha.6, thus resulting in GlcNAc2Man3 (which has the structure GlcNAc.beta.2Man.alpha.3(GlcNAc.beta.2Man.alpha.6)Man.beta.4Glc- NAc.beta.4(Fuc.alpha.x).sub.nGlcNAc, where n is 0 or 1, also referred to as G0 if attached to an antibody).
[0090] Fusion Proteins Containing N-acetylglucosaminyltransferase Catalytic Domains
[0091] In certain embodiments, the recombinant proteins of the invention are fusion proteins containing an N-acetylglucosaminyltransferase I catalytic domain and an N-acetylglucosaminyltransferase II catalytic domain. The term "fusion protein" refers to any protein or polypeptide containing a protein or polypeptide linked to heterologous amino acids.
[0092] N-acetylglucosaminyltransferase I (GlcNAc-TI; GnTI; EC 2.4.1.101) catalyzes the reaction UDP-N-acetyl-D-glucosamine+3-(alpha-D-mannosyl)-beta-D-mannosyl-R<=>- ;UDP+3-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl- -R, where R represents the remainder of the N-linked oligosaccharide in the glycan acceptor. An N-acetylglucosaminyltransferase I catalytic domain is any portion of an N-acetylglucosaminyltransferase I enzyme that is capable of catalyzing this reaction. Amino acid sequences for N-acetylglucosaminyltransferase I enzymes from various organisms are listed in SEQ ID NOs: 1-19. Additional GnTI enzymes are listed in the CAZy database in the glycosyltransferase family 13 (cazy.org/GT13_all). Enzymatically characterized species includes A. thaliana AAR78757.1 (U.S. Pat. No. 6,653,459), C. elegans AAD03023.1 (Chen S. et al J. Biol. Chem 1999; 274(4288-97), D. melanogaster AAF57454.1 (Sarkar & Schachter Biol Chem. 2001 February; 382(2):209-17); C. griseus AAC52872.1 (Puthalakath H. et al J. Biol. Chem 1996 271(44):27818-22); H. sapiens AAA52563.1 (Kumar R. et al Proc Natl Acad Sci USA. 1990 December; 87(24):9948-52); M. auratus AAD04130.1 (Opat As et al Biochem J. 1998 Dec. 15; 336 (Pt 3):593-8), (including an example of deactivating mutant), Rabbit, O. cuniculus AAA31493.1 (Sarkar M et al. Proc Natl Acad Sci USA. 1991 Jan. 1; 88(1):234-8). Additional examples of characterized active enzymes can be found at cazy.org/GT13_characterized. The 3D structure of the catalytic domain of rabbit GnTI was defined by X-ray crystallography in Unligil U M et al. EMBO J. 2000 Oct. 16; 19(20):5269-80. The Protein Data Bank (PDB) structures for GnTI are 1FO8, 1FO9, 1FOA, 2AM3 , 2AM4, 2AM5, and 2APC. In certain embodiments, the N-acetylglucosaminyltransferase I catalytic domain is from the human N-acetylglucosaminyltransferase I enzyme (SEQ ID NO: 1), or variants thereof. In certain embodiments, the N-acetylglucosaminyltransferase I catalytic domain contains a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to amino acid residues 84-445 of SEQ ID NO: 1. In some embodiments, a shorter sequence can be used as a catalytic domain (e.g. amino acid residues 105-445 of the human enzyme or amino acid residues 107-447 of the rabbit enzyme; Sarkar et al. (1998) Glycoconjugate J 15:193-197). Additional sequences that can be used as the GnTI catalytic domain include amino acid residues from about amino acid 30 to 445 of the human enzyme or any C-terminal stem domain starting between amino acid residue 30 to 105 and continuing to about amino acid 445 of the human enzyme, or corresponding homologous sequence of another GnTI or a catalytically active variant or mutant thereof. The catalytic domain may include N-terminal parts of the enzyme such as all or part of the stem domain, the transmembrane domain, or the cytoplasmic domain.
[0093] As used herein, "cytoplasmic" is used to refer to a part of a protein that interacts with the cytoplasm of a cell.
[0094] N-acetylglucosaminyltransferase II (GlcNAc-TII; GnTII; EC 2.4.1.143) catalyzes the reaction UDP-N-acetyl-D-glucosamine+6-(alpha-D-mannosyl)-beta-D-mannosyl-R<=>- ;UDP+6-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl- -R, where R represents the remainder of the N-linked oligosaccharide in the glycan acceptor. An N-acetylglucosaminyltransferase II catalytic domain is any portion of an N-acetylglucosaminyltransferase II enzyme that is capable of catalyzing this reaction. Amino acid sequences for N-acetylglucosaminyltransferase II enzymes from various organisms are listed in SEQ ID NOs: 20-33. In certain embodiments, the N-acetylglucosaminyltransferase II catalytic domain is from the human N-acetylglucosaminyltransferase II enzyme (SEQ ID NO: 20). Additional GnTII species are listed in the CAZy database in the glycosyltransferase family 16 (cazy.org/GT16_all). Enzymatically characterized species include GnTII of C. elegans, D. melanogaster, Homo sapiens, Rattus norvegigus, Sus scrofa (cazy.org/GT16 characterized). In certain embodiments, the N-acetylglucosaminyltransferase II catalytic domain contains a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to amino acid residues from about 30 to about 447 of SEQ ID NO: 21. The catalytic domain may include N-terminal parts of the enzyme such as all or part of the stem domain, the transmembrane domain, or the cytoplasmic domain.
[0095] In certain embodiments, the N-acetylglucosaminyltransferase I catalytic domain is N-terminal to the N-acetylglucosaminyltransferase II catalytic domain. In other embodiments, the N-acetylglucosaminyltransferase II catalytic domain is N-terminal to the N-acetylglucosaminyltransferase I catalytic domain. The term "N-terminal" refers to the positioning of a set of amino acid residues closer to the end of a polypeptide that is terminated by an amino acid with a free amine group (.about.NH.sub.2) compared to a reference set of amino acid residues.
[0096] Spacers
[0097] In certain embodiments of the invention, the recombinant protein contains a spacer in between the N-acetylglucosaminyltransferase I catalytic domain and the N-acetylglucosaminyltransferase II catalytic domain. The term "spacer" refers to any number of consecutive amino acids of any sequence separating the N-acetylglucosaminyltransferase I catalytic domain and the N-acetylglucosaminyltransferase II catalytic domain such that the spacer has no effect on the enzymatic function of the catalytic domains. Typically, the spacer is at least 5, at least 10, at least 15, at least 20, at least 30, at least 40, or at least 50 amino acids in length. In certain embodiments, the spacer contains sequence from a stem domain. "Stem domain" refers to a protein domain, or a fragment thereof, which is located adjacent to the transmembrane domain of a native enzyme, such as a glycosyltransferase or a glycosyl hydrolase, and optionally targets the enzyme to or assists in retention of the enzyme in the ER/Golgi. Stem domains generally start with the first amino acid following the hydrophobic transmembrane domain and end at the catalytic domain. Exemplary stem domains include, but are not limited to, the stem domain of human GnTI, amino acid residues from about 30 to about 83 or from about 30 to about 105 for the human GnTII, or amino acid residues from about 26 to about 106 or from about 26 to about 83 for the T. reesei KRE2. In certain embodiments where the spacer contains sequence from a stem domain, the spacer includes amino acids 30-83 of the human GnTI sequence (SEQ ID NO: 34). In other embodiments, the spacer may include any of the sequences listed in SEQ ID NOs: 35-38.
[0098] Further examples of suitable spacers include, without limitation, the flexible spacer 3.times.G4S (SEQ ID NO: 118), the flexible spacer 2.times.G4S (SEQ ID NO: 120), the spacer for the T. reesei CBHI (SEQ ID NO: 122); and the spacer for the T. reesei EGIV cellulase (SEQ ID NO: 124).
[0099] In certain embodiments, the length of the spacer is about the same as the length of a stem domain of GnT1. In certain embodiments, the length is about 74 amino acid residues, plus or minus about 37 amino acids. For example, the spacer length is about 30 amino acids to about 110 amino acids, or from about 35 amino acids to about 100 amino acids, or as exemplified in the examples described herein, plus or minus 2, 3, 4, or 5 amino acids. In one embodiment, the spacer length corresponds to a truncated stem domain of GnT1, for example, start from amino acid 25 to amino acid 104, or between amino acid 30 to amino acid 101, to the end of the GnT1 stem domain. In certain embodiments, the spacer may include a part of the stem domain of human GnT1, which may start from an amino acid positioned between amino acid 70 to amino acid 87 (according to numbering in SEQ ID NO: 34), or between amino acid 76 and amino acid 104, or beginning from amino acid 30, 35, 40, 45, 50, 60, 70, 73, 74, 75, 76, 80, 83, 84, 85, 86, 87, 100, 101, 102, 103, or 104, to the end of the human GnT1 stem domain. In other embodiments, the spacer may include a heterologous spacer peptide, which may include a fungal spacer peptide and/or a repetitive oligomer spacer peptide.
[0100] Typically, the spacer is an elongated peptide without specific conformation and contains amino acid residues allowing high flexibility (e.g., Gly and Ala), hydroplicity (e.g., Ser and Thr), and optionally Pro to prevent conformation. The spacer may be glycosylated. In certain embodiments the spacer is O-glycosylated including fungal O-mannosylation. In certain embodiments the spacer is an endogenous fungal, filamentous fungal, or Trichoderma spacer peptide, such as a spacer that naturally separates protein domains. The spacer may be derived from a secreted or cellulolytic enzyme of a fungus such as a filamentous fungus (e.g., T. reesei), a fragment thereof, or a multimer of the spacer and/or its fragment or mutated analog or equivalent thereof. The natural fungal spacer may contain dimeric or oligomeric proline and/or glycine and/or serine and/or threonine, and/or multiple amino acid residues selected from Ser, Thr, Gly, Pro or Ala or any combinations thereof. In certain embodiments, the spacer is a repeating oligomer containing a monomer with 1-10 or 1-5 amino acid residues selected from Ser, Thr, Gly, Pro or Ala and optionally a charged amino acid residue selected from negatively charged residues Glu or Asp or positively charged residues Lys or Arg. In certain embodiments the charged residue is negatively charged. In certain embodiments the monomer contains dimeric or oligomeric amino acid residues, and/or multiple single amino acid residues selected from Ser, Thr, Gly, Pro and Ala. In certain embodiments the oligomer contains a monomer of a dimer or oligomer of glycine and a single residue selected from the Ser, Thr, Gly, Pro and Ala. In certain embodiments the single residue is Ser or Thr. In certain embodiments the residue is Ser. In certain embodiments, the sequence of the repeating spacer is {(Yyy).sub.nXxx).sub.m where n is 2 to 10, m is 2 to 10, and Xxx and Yyy are selected from Ser, Thr, Gly, Pro and Ala, with the proviso that Xxx and Yyy are not the same amino acid residue. In certain embodiments the repeating spacer is {(Gly).sub.nXxx}.sub.m where n is 2 to 10, m is 2 to 10, and Xxx is selected from Ser, Thr, Gly, Pro and Ala. In certain embodiments Xxx is Ser or Thr. In certain embodiments Xxx is Ser.
[0101] Targeting Peptides
[0102] In certain embodiments, recombinant proteins of the invention include a targeting peptide linked to the catalytic domains. The term "linked" as used herein means that two polymers of amino acid residues in the case of a polypeptide or two polymers of nucleotides in the case of a polynucleotide are either coupled directly adjacent to each other or are within the same polypeptide or polynucleotide but are separated by intervening amino acid residues or nucleotides. A "targeting peptide", as used herein, refers to any number of consecutive amino acid residues of the recombinant protein that are capable of localizing the recombinant protein to the endoplasmic reticulum (ER) or Golgi apparatus (Golgi) within the host cell. The targeting peptide may be N-terminal or C-terminal to the catalytic domains. In certain embodiments, the targeting peptide is N-terminal to the catalytic domains. In certain embodiments, the targeting peptide provides binding to an ER or Golgi component, such as to a mannosidase II enzyme. In other embodiments, the targeting peptide provides direct binding to the ER or Golgi membrane.
[0103] Components of the targeting peptide may come from any enzyme that normally resides in the ER or Golgi apparatus. Such enzymes include mannosidases, mannosyltransferases, glycosyltransferases, Type 2 Golgi proteins, and MNN2, MNN4, MNN6, MNN9, MNN10, MNS1, KRE2, VAN1, and OCH1 enzymes. Such enzymes may come from a yeast or fungal species such as those of Acremonium, Aspergillus, Aureobasidium, Cryptococcus, Chrysosporium, Chrysosporium lucknowense, Filobasidium, Fusarium, Gibberella, Humicola, Magnaporthe, Mucor, Myceliophthora, Myrothecium, Neocallimastix, Neurospora, Paecilomyces, Penicillium, Piromyces, Schizophyllum, Talaromyces, Thermoascus, Thielavia, Tolypocladium, and Trichoderma. Sequences for such enzymes can be found in the GenBank sequence database.
[0104] In certain embodiments the targeting peptide comes from the same enzyme and organism as one of the catalytic domains of the recombinant protein. For example, if the recombinant protein includes a human GnTII catalytic domain, the targeting peptide of the recombinant protein is from the human GnTII enzyme. In other embodiments, the targeting peptide may come from a different enzyme and/or organism as the catalytic domains of the recombinant protein.
[0105] Examples of various targeting peptides for use in targeting proteins to the ER or Golgi that may be used for targeting recombinant proteins of the invention include: Kre2/Mnt1 N-terminal peptide fused to galactosyltransferase (Schwientek, JBC 1996, 3398), HDEL for localization of mannosidase to ER of yeast cells to produce Man5 (Chiba, JBC 1998, 26298-304; Callewaert, FEBS Lett 2001, 173-178), OCH1 targeting peptide fused to GnTI catalytic domain (Yoshida et al, Glycobiology 1999, 53-8), yeast N-terminal peptide of Mns1 fused to .alpha.2-mannosidase (Martinet et al, Biotech Lett 1998, 1171), N-terminal portion of Kre2 linked to catalytic domain of GnTI or .beta.4GalT (Vervecken, Appl. Environ Microb 2004, 2639-46), various approaches reviewed in Wildt and Gerngross (Nature Rev Biotech 2005, 119), full-length GnTI in Aspergillus nidulans (Kalsner et al, Glycocon. J 1995, 360-370), full-length GnTI in Aspergillus oryzae (Kasajima et al, Biosci Biotech Biochem 2006, 2662-8), portion of yeast Sec12 localization structure fused to C. elegans GnTI in Aspergillus (Kainz et al 2008), N-terminal portion of yeast Mnn9 fused to human GnTI in Aspergillus (Kainz et al 2008), N-terminal portion of Aspergillus Mnn10 fused to human GnTI (Kainz et al, Appl. Environ Microb 2008, 1076-86), and full-length human GnTI in T. reesei (Maras et al, FEBS Lett 1999, 365-70).
[0106] In certain embodiments the targeting peptide is the Kre2/Mnt1(i.e., Kre2) targeting peptide having the amino acid sequence of SEQ ID NO: 115 or SEQ ID NO: 116.
[0107] Further examples of sequences that may be used for targeting peptides include the sequences listed in Table 1 below.
TABLE-US-00001 TABLE 1 Targeting peptides. Homologous to Cytoplasmic Transmembrane Luminal KRE2 MASTNARYVR YLLIAFFTILVFYF SKYEGVDLNKGTFTAPDSTKTTPKPPATGDAKDFPLALTPNDP estExt_fgenesh1_ SEQ ID NO: 39 VSN GFNDLVGIAPGPRMNATFVTIARNSDVVVDIARSIRQVEDRFNRRYNY pm.C_30039 SEQ ID NO: 40 DWVFLNDKPFDNTFKKVTTSLVSGKTHYGEIAPEHWSFPDWIDQDKA KKVREDMAERKIIYGDSVSYRHMCRFESGFFFRQPLMMNYEYYWRV EPSIELYCDIHYDPFRLMVEQGKKYSFVISLYEYPATIATLWESTKKFM KNHPEHIAPDNSMRFLSDDGGETYNNCHFWSNFEIGSLEWLRSKQYI DFFESLDKDGGFFYERWGDAPVHSIAAGLMLNRSEIHFFNDIAYWHV PFTHCPTGEKTRLDLKCHCDPKENFDWKGYSCTSRFFEMNGMDKPE GWENQQD SEQ ID NO: 41 KRE2 alternative1 MAIARPVR ALGGLAAILWCFF QLLRPSSSYNSPGDRYINFERDPNLDPTGEPEGILVRTSDRYAPDAK e_gw1.28.231.1 SEQ ID NO: 42 LY DTDRASATLLALVRNEEVDDMVASMVDLERTVVNSKFNYPWTFFNDK SEQ ID NO: 43 PFSEEFKKKTSAVTNATCNYELIPKEHWDAPSWIDPAIFEESAAVLKK NGVQYANMMSYHQMCRWNSGMFYKHPALKDVRYYVVRVEPKVHFF CDVDYDVFRYMQDNNKTYGFTINLYDDPHTLPTLWPQTAKFLADHPN YLHEHSAIKWVIDDARRPQHNREAQGFSTCHFWSNFEVADMEFWRS KVYEDYFEHLDRAGGFFYERWGDAPVHSIALGLFEDSSKIHWFRDIG YQHIPFFNCPNSPKCKGCVTGRLTDGEPFLHREDCRPNWFKYAGMG SEQ ID NO: 44 OCH1 MLNPRR ALIAAAFILTVFFLI SRSHNSESASTSEPKDAEAEALSAANAQQRAAPPPPPQKPMIDMSG e_gw1.16.371.1 SEQ ID NO: 45 SEQ ID NO: 46 MSTYDKLAYAYEYDIESKFPAYIWQTWRKTPSEGDFEFREQEASWSI EHPGFIHEVITDSVADTLLQLLYGSIPEVLEAYHALPLPVLKADLFRYLIL YARGGIYSDIDTYAIRSALEWIPPQIPKETVGLVIGIEADPDRPDWADW YSRRIQFCQWTIQSKPGHPVLRDIISRITNQTLEMKKSGKLSAFQGNR VVDLTGPAVWTDTIMDYFNDERYFDMENSKGRIDYRNFTGMETSKRV GDVVVLPITSFSPGVGQMGAKDYDDPMAFVKHDFEGTVVKPESERHI GEIVQELGEGQGEAPKEQ SEQ ID NO: 47 OCH1 alternative1 MGMGQCQWSPF LPLYITVVCVFLVIV NFDWILAIPNPASVLRREPKAPPLPGSTFPQKIWQTVVKVDPLNFDERD fgenesh1_pm.C_ RNKVPTQMRRC SEQ ID NO: 49 LVTARTWTTINPGMRYEVVTDANEMAYIEDRYGPNGFDRPDIVEFYK scaffold_13000080 SEQ ID NO: 48 MINLPIIKADLLRYMIMYAEGGIYADIDVETMKPFHRFIPDRYDEKDIDIII GVEIDQPDFKDHPILGKKSMSFCQWTFVARPQQPVMMRLIENIMKWF KTVARDQGVPLGEVQLDFDQVISGTGPSAFTKAMLEEMNRKTKGPKV TVVDAFHNLDESKLVGGVLVLTVEAFCAGQGHSDSGNHNARNALVKH HFHASNWPSRHPRYKHPAYGQVEDCNWVPECVRKWDEDTSNWDK YSENEQKKILQDIENARLERERQQQALAALP SEQ ID NO: 50 MNN9 MARPMGSVRLKK LILGAVLCIFIIIFLV SPSSPASASRLSIVSAQHHLSPPTSPYQSPRSGAVQGPPPVTRYNLN e gw1.5.262.1 ANPST SEQ ID NO: 52 KVTVTSDPVRNQEHILILTPMARFYQEYWDNLLRLNYPHELITLGFILP SEQ ID NO: 51 KTKEGNQATSMLQKQIQKTQNYGPEKDRFKSIIILRQDFDPAVVSQDE SERHKLANQKARREVMAKARNSLLFTTLGPSTSWVLWLDADITETAP TLIQDLASHDKPIIVANCFQKYYDPESKKMAERPYDFNSWQDSETALK MAEQMGPDDILLEGYAEMATYRTLLAYMSTPGGSKDLVVPLDGVGG TALLVKADVHRDGAMFPPFAFYHLIESEGFAKMAKRLGWQPYGLPNY KVYHYNE SEQ ID NO: 53 MNN9 alternative1 MLLPKGGLDWRS FILLVGITGLILLLW RGVSTSASEMQSFYCWGPAKPPMEMSPNEHNRWNGHLQTPVIFNH estExt_GeneWise ARAQIPPTRAL SEQ ID NO: 55 HAPVEVNSSTIEHVDLNPINSTKQAVTKEERILILTPLKDAAPYLSKYFE Plus.C_230146 WNAVTRTR LLAELTYPHRLIDLAFLVSDSTDDTLAVLASELDRIQKRPDQIPFHSATV SEQ ID NO: 54 IEKDFGFKLSQNVEERHSFEAQGPRRKAMGRARNYLLYTALKPEHSW VYWRDVDIVDSPTGILEDFIAHDRDILVPNIWFHRYRDGVDIEGRFDYN SWVESDKGRKLANSLDKDVVLAEGYKQYDTGRTYMAKMGDWRENK DVELELDGIGGVNILVKADVHRSGINFPCYAFENQAETEGFAKMAKRA GYEVYGLPNYVVWHIDTEEKGGNA SEQ ID NO: 56 MNN9 alternative2 MMPRHHSSGFSN VGIAVVVILVLVL QPRSVASLISLGILSGYDDLKLETVRYYDLSNVQGTARGWEREERILL estExt_GeneWise GYPRADTFEI WFG CVPLRDAEQHLPMFFSHLKNFTYPHNLIDLAFLVSDSKDHTLESLTEH Plus.C_400029 SPHRFQPRATLPP SEQ ID NO: 58 LEAIQADPDPKQPYGEISIIEKDFGQKVNQDVESRHGFAAQASRRKLM HRKRKRTAIR AQARNWLLSAALRPYHSWVYWRDVDVETAPFTILEDLMRHNKDVIVP SEQ ID NO: 57 NVVVRPLPDWLGGEQPYDLNSWQESETALALADTLDEDAVIVEGYAE YATWRPHLAYLRDPYGDPDMEMEIDGVGGVSILAKAKVFRAGVHFPA FSFEKHAETEGFGKMAKRMHFSVVGLPHYTIWHLYEPSVDDIKHMEE MERERIAREKEEEERKKKEAQIKEEFGDANSQWEQDKQQMQDLKLQ DRGGDKEAAAAGVNQGAAAKAAGAMEGQKN SEQ ID NO: 59 MNN10 MSLSRSPSPVPG ILLPLIIICTIVAYY GTHEAPGFVHWWRRISMGGGGEKFVIILGANVGGGVMEWKGAREW fgenesh5_pg.C_ GGWSSPGLNINS SEQ ID NO: 61 AIERDSVRNKRKYATRWGYDLEIVDMKTKKRYAHEWRESWEKVDFIR scaffold_5000342 GRSSPSNAAGSS AAMRKYPKAEWFWWLDLNTYVMEPSYSLQRHLFNHLDRHVYRDINV VSWESAKMRKQG FNPLNITHPPTEEYLDAEARSPVGDGNINSVNLMLTQDCSGFNLGSFF ANGYPSFSTQNQ IRRSAWTEQLLDIWWDPVLYEQKHMEWEHKEQDALEQLYRTQPWIR GFFTRHMRRI QHTGFLPQRLINSFPPAACADESGLNNTRIHYNEKDRDFVVNMAGCE SSSLPRFAAGPG WGRDCWGEMYHYREFSYWLNRNPWELFKEEIVAVIWYKLIGQRVKL NTYAEREKYERG SEQ ID NO: 62 GHSPHAGGGRLR AFLARIGRRLKWR SEQ ID NO: 60 MNN10 MHFAYPSRKSSN IGIVLFLVLATLWFF SNPRVPRPDPERVPSGRPPVVLVTVIDPTQYPNAYLKTIKENREQYAA alternative1 PPPFRPRSTRLPG SEQ ID NO: 64 KHGYEAFIVKAYDYDTQGAPQSWSKLMAMRHALTKFPECRFVWYLD estExt_GeneWise LRRSRIKT QDAYIMDMSKSLEEQLLNRQKLESLMIKNYPVVPPDSIIKTFSHLRPDE Plus.C_150339 SEQ ID NO: 63 VDLIVSQDSSGLVAGSVVVRNSQWSKFLLETWMDPLYRSYNFQKAE RHALEHIVQWHPTILSKLALVPQRTLGPYTRTDQGDAYQDGDFVVMF TGCTKSGEQSCETVSASYYQKWSSSL SEQ ID NO: 65 MNS1 MIRDPFGIHSKNA VLGMIAAAVMFVL SSGQTEEAKKKASGSAFSWLGLSQERGGVDWDERRKSVVEAFEVVV fgenesh1_pm.C_ FKATALRAARDIK YVTGFF DAYERYAWGKDEFHPISKNGRNMAPKGLGWIIIDSLDTMMLMNQTTR scaffold_3000175 EAATQAGANALE SEQ ID NO: 67 LQHAREWISTSLTVVDQDQDVNTFETTIRMLGGLLSAHYLSTEFPELAP MSFSLPKHVPDF LTEDDEGAPGEDLYLEKAKDLADRLLSAFESESGIPYASVNIGEYKGP GDPSRALEDRAW SHSDNGASSTAEATTLQLEFKYLAKLTGEKNFWDKVEKVMEVVDDN AALLPMYKDKPYA QPEDGLVPIYIYATTGEFRGQNIRLGSRGDSYYEYLIKQYLQINKQEPI YAPSMRLRPWWR YEEMWDEALAGVRKHLVTYTEPSEFTIIAERPDGLEHPMSPKMDHLV RRK CFMPGTIALAATGGLTEAEARKLSTWNKKKDDDMQLARELMHTCWG SEQ ID NO: 66 MYKYMKTGLAPEIMYFNIPNPPPESSAPHQAPAAFDEDPHAEWRKDF VVHSNDVHNLQRPETVESLFYMWRITGDVKYREWGWDMFKSFVNYT AVEDQGGFTSLLDANSIPPTPKDNMESFWLAETLKYMYLLFSPNDVLP LHKIVLNTEAHPFPRFDMGPLFSTGWKRKPRDGSAKKKATTAATTDAE SEQ ID NO: 68 MNS1 alternative1 MARRRYR LFMICAAVILFLLYR VSQNTWDDSAHYATLRHPPASNPPAAGGESPLKPAAKPEHEHEHEN estExt_fgenesh1_ SEQ ID NO: 69 SEQ ID NO: 70 GYAPESKPKPQSEPKPESKPAPEHAAGGQKSQGKPSYEDDEETGKN pm.C_80182 PPKSAVIPSDTRLPPDNKVHWRPVKEHFPVPSESVISLPTGKPLKVPR VQHEFGVESPEAKSRRVARQERVGKEIERAWSGYKKFAWMHDELSP VSAKHRDPFCGWAATLVDSLDTLWIAGLKEQFDEAARAVEQIDFTTTP RNNIPVFETTIRYLGGLLGAFDVSGGHDGGYPMLLTKAVELAEILMGIF DTPNRMPILYYQWQPEYASQPHRAGSVGIAELGTLSMEFTRLAQLTS QYKYYDAVDRITDALIELQKQGTSIPGLFPENLDASGCNHTATALRSSL SEAAQKQMDEDLSNKPENYRPGKNSKADPQTVEKQPAKKQNEPVEK AKQVPTQQTAKRGKPPFGANGFTANWDCVPQGLVVGGYGFQQY HMGGGQDSAYEYFPKEYLLLGGLESKYQKLYVDAVEAINEWLLYRPM TDGDWDILFPAKVSTAGNPSQDLVATFEVTHLTCFIGGMYGLGGKIFG REKDLETAKRLTDGCVWAYQSTVSGIMPEGSQVLACPTLEKCDFN ETLWWEKLDPAKDWRDKQVADDKDKATVGEALKETANSHDAAGGS KAVHKRAAVPLPKPGADDDVGSELPQSLKDKIGFKNGEQKKPTGSSV GIQRDPDAPVDSVLEAHRLPPQEPEEQQVILPDKPQTHEEFVKQRIAE MGFAPGVVHIQSRQYILRPEAIESVWYMYRITGDPIWMEKGWKMFEA TIRATRTEIANSAIDDVNSEEPGLKDEMESFWLAETLKYYYLLFSEPSVI SLDEWVLNTEAHPFKRPGGSVIGHSI SEQ ID NO: 71 MNS1 alternative2 MLNOLOGRVPRRY IALVAFAFFVAFLLW SGYDFVPRTATVGRFKYVPSSYDWSKAKVYYPVKDMKTLPQGTPVT estExt_GeneWise SEQ ID NO: 72 SEQ ID NO: 73 FPRLQLRNQSEAQDDTTKARKQAVKDAFVKSWEAYKTYAWTKDQLQ Plus.C_120298 PLSLSGKETFSGWSAQLVDALDTLWIMDLKDDFFLAVKEVAVIDWSKT KDNKVINLFEVTIRYLGGLIAAYDLSQEPVLRAKAIELGDTLYATFDTPN RLPSHWLDYSKAKKGTQRADDSMSGAAGGTLCMEFTRLSQITGDPK YYDATERIKQFFYRFQNETTLPGMWPVMMNYREETMVESRYSMGGS ADSLYEYLVKMPALLGGLDPQYPEMAIRALDTARDNLLFRPMTEKGD NILALGNALVDHGNVQRITEMQHLTCFAGGMYAMAGKLFKRDDYVDL GSRISSGCVWAYDSFPSGIMPESADMAACAKLDGPCPYDEVKAPVD PDGRRPHGFIHVKSRHYLLRPEAIESVFYMWRITGDQVWRDTAWRM WENIVREAETEHAFAIVEDVTRTASKLINNYLLQTFWLAETLKYFYLIF DDESAIDLDKWVFNTEAHPFKRPAV SEQ ID NO: 74 MNS1 alternative3 MLVVGRPRLVRNS IILTLAILSIWHLGLL SRTPTSASALVSASVSASSEWSRLERLMNRGAPLTPYPDSNSSFDW estExt_GeneWise SEQ ID NO: 75 SEQ ID NO: 76 SAIPFRYPPHNTTHLPPRHKQPPLPRIQHRFGPESPAAAKERIKRLKA Plus.C_160228 VKQVFLRAWQAYKGYAWKQDALLPISGGGREQFSGWAATLVDALDT LWIMGLREEFDEAVAAVAEIDFGSSTSSRVNIFETNIRYLGGLLAAYDL SGREVLLKKAVELGDLIYAGFNTENGMPVDFLNFYSAKSGEGLVVES SVVSASPGTLSLELAHLSQVTGDDKYYSAVSQVMDVFYQGQNKTRLP GVWPIDVNMRAKDVVSGSRFTLGGCADSLYEYLPKMHQLLGGGEPK YETMSRTFLQAADRHFVFRPMLPGAEEDVLMPGNVNVDEDSGEAVL DPETEHLACFVGGMFGLAGRLFSRPDDVETGVRLTNGCVYAYRAFP TGMMPERLDLAPCRDRSSRCPWDEEHWLEERAKRPEWEPHLPRGF TSAKDPRYLLRPEAIESVFYSYRITGRQEFQTAAWDMFTAVEKGTRT QFANAAVLDVTRAADELPQEDYMESFWLAETLKYFYLMFTTPDIISLD DYVLNTEAHPFKLVG SEQ ID NO: 77 MNS1 alternative4 -- MVMLVAIALAWLGCSLL RPVDAMRADYLAQLRQETVDMFYHGYSNYMEHAFPEDELRPISCTPL e_gw1.13.279.1 SEQ ID NO: 78 TRDRDNPGRISLNDALGNYSLTLIDSLSTLAILAGGPQNGPYTGPQAL SDFQDGVAEFVRHYGDGRSGPSGAGIRARGFDLDSKVQVFETVIRG VGGLLSAHLFAIGELPITGYVPRPEGVAGDDPLELAPIPWPNGFRYDG QLLRLALDLSERLLPAFYTPTGIPYPRVNLRSGIPFYVNSPLHQNLGEA VEEQSGRPEITETCSAGAGSLVLEFTVLSRLTGDARFEQAAKRAFWE VWHRRSEIGLIGNGIDAERGLWIGPHAGIGAGMDSFFEYALKSHILLS GLGMPNASTSRRQSTTSWLDPNSLHPPLPPEMHTSDAFLQAWHQAH ASVKRYLYTDRSHFPYYSNNHRATGQPYAMWIDSLGAFYPGLLALAG EVEEAIEANLVYTALWTRYSALPERWSVREGNVEAGIGWWPGRPEFI ESTYHIYRATRDPWYLHVGEMVLRDIRRRCYAECGWAGLQDVQTGE KQDRMESFFLGETAKYMYLLFDPDHPLNKLDAAYVFTTEGHPLIIPKS KRGSGSHNRQDRARKAKKSRDVAVYTYYDESFTNSCPAPRPPSEHH LIGSATAARPDLFSVSRFTDLYRTPNVHGPLEKVEMRDKKKGRVVRY RATSNHTIFPWTLPPAMLPENGTCAAPPERIISLIEFPANDITSGITSRF GNHLSWQTHLGPTVNILEGLRLQLEQVSDPATGEDKVVRITHIG NTQLGRHETVFFHAEHVRHLKDEVFSCRRRRDAVEIELLVDKPSDTN NNNTLASSDDDVVVDAKAEEQDGMLADDDQDTLNAETLSSNSLFQSL LRAVSSVFEPVYTAIPESDPSAGTAKVYSFDAYTSTGPGAYPMPSI SDTPIPGNPFYNFRNPASNFPWSTVFLAGQACEGPLPASAPREHQVI VMLRGGCSFSRKLDNIPSFSPHDRALQLVVVLDEPPPPPPPPPANDR RDVTRPLLDTEQTTPKGMKRLHGIPMVLVRAARGDYELFGHAIGVG MRRKYRVESQGLVVENAVVL SEQ ID NO: 79 VAN1 MMPRHHSSGFSN VGIAVVVILVLVLWFG QPRSVASLISLGILSGYDDLKLETVRYYDLSNVQGTARGWEREERILL estExt_GeneWise GYPRADTFEISPH SEQ ID NO: 81 CVPLRDAEQHLPMFFSHLKNFTYPHNLIDLAFLVSDSKDHTLESLTEH Plus.C_400029 RFQPRATLPPHRK LEAIQADPDPKQPYGEISIIEKDFGQKVNQDVESRHGFAAQASRRKLM RKRTAIR AQARNWLLSAALRPYHSWVYWRDVDVETAPFTILEDLMRHNKDVIVP SEQ ID NO: 80 NVWRPLPDWLGGEQPYDLNSWQESETALALADTLDEDAVIVEGYAE YATWRPHLAYLRDPYGDPDMEMEIDGVGGVSILAKAKVFRAGVHFPA FSFEKHAETEGFGKMAKRMHFSVVGLPHYTIWHLYEPSVDDIKHMEE MERERIAREKEEEERKKKEAQIKEEFGDANSQWEQDKQQMQDLKLQ DRGGDKEAAAAGVNQGAAAKAAGAMEGQKN SEQ ID NO: 82 VAN1 alternative1 MLLPKGGLDWRS FILLVGITGLILLLW RGVSTSASEMQSFYCWGPAKPPMEMSPNEHNRWNGHLQTPVIFNH estExt_GeneWise ARAQIPPTR SEQ ID NO: 84 HAPVEVNSSTIEHVDLNPINSTKQAVTKEERILILTPLKDAAPYLSKYF Plus.C_230146 ALWNAVTRTR ELLAELTYPHRLIDLAFLVSDSTDDTLAVLASELDRIQKRPDQIPFHSAT SEQ ID NO: 83 VIEKDFGFKLSQNVEERHSFEAQGPRRKAMGRARNYLLYTALKPEHS WVYWRDVDIVDSPTGILEDFIAHDRDILVPNIWFHRYRDGVDIEGRFD YNSWVESDKGRKLANSLDKDVVLAEGYKQYDTGRTYMAKMGDWRE NKDVELELDGIGGVNILVKADVHRSGINFPCYAFENQAETEGFAKMAK RAGYEVYGLPNYVVWHIDTEEKGGNA SEQ ID NO: 85 VAN1 alternative2 MARPMGSVRLKK LILGAVLCIFIIIFLV SPSSPASASRLSIVSAQHHLSPPTSPYQSPRSGAVQGPPPVTRYNLN
e_gw1.5.262.1 ANPST SEQ ID NO: 87 KVTVTSDPVRNQEHILILTPMARFYQEYWDNLLRLNYPHELITLGFILP SEQ ID NO: 86 KTKEGNQATSMLQKQIQKTQNYGPEKDRFKSIIILRQDFDPAVVSQDE SERHKLANQKARREVMAKARNSLLFTTLGPSTSWVLWLDADITETAP TLIQDLASHDKPIIVANCFQKYYDPESKKMAERPYDFNSWQDSETALK MAEQMGPDDILLEGYAEMATYRTLLAYMSTPGGSKDLVVPLDGVGG TALLVKADVHRDGAMFPPFAFYHLIESEGFAKMAKRLGWQPYGLPNY KVYHYNE SEQ ID NO: 88 Other01 MHFAYPSRKSSN IGIVLFLVLATLWFF SNPRVPRPDPERVPSGRPPVVLVTVIDPTQYPNAYLKTIKENREQYAA estExt_GeneWise PPPFRPRSTRLPG SEQ ID NO: 90 KHGYEAFIVKAYDYDTQGAPQSWSKLMAMRHALTKFPECRFVWYLD Plus.C_150339 LRRSRIKT QDAYIMDMSKSLEEQLLNRQKLESLMIKNYPVVPPDSIIKTFSHLRPDE SEQ ID NO: 89 VDLIVSQDSSGLVAGSVVVRNSQWSKFLLETWMDPLYRSYNFQKAE RHALEHIVQWHPTILSKLALVPQRTLGPYTRTDQGDAYQDGDFVVMF TGCTKSGEQSCETVSASYYQKWSSSL SEQ ID NO: 91 Other02 MSLSRSPSPVPG ILLPLIIICTIVAYYG THEAPGFVHWWRRISMGGGGEKFVIILGANVGGGVMEWKGAREWAI fgenesh5_pg.C_ GGWSSPGLNINS SEQ ID NO: 93 ERDSVRNKRKYATRWGYDLEIVDMKTKKRYAHEWRESWEKVDFIRA scaffold_5000342 GRSSPSNAAGSS AMRKYPKAEWFWWLDLNTYVMEPSYSLQRHLFNHLDRHVYRDINVF VSWESAKMRKQG NPLNITHPPTEEYLDAEARSPVGDGNINSVNLMLTQDCSGFNLGSFFI ANGYPSFSTQNQ RRSAWTEQLLDIWWDPVLYEQKHMEWEHKEQDALEQLYRTQPWIR GFFTRHMRRISSS CHTGFLPQRLINSFPPAACADESGLNNTRIHYNEKDRDFVVNMAGCE LPRFAAGPGNTYA WGRDCWGEMYHYREFSYWLNRNPWELFKEEIVAVIWYKLTGQRVKL EREKYERGGHSP SEQ ID NO: 94 HAGGGRLRAFLA RIGRRLKWR SEQ ID NO: 92 Putative transmembrane domains are underlined. In KRE2, the stem domain enabling Golgi localization is underlined and double-underlined. Other1 and Other02 are putative mannosylation-related proteins.
[0108] Uncharacterized sequences may be tested for use as targeting peptides by expressing proteins in the glycosylation pathway in a host cell, where one of the proteins contains the uncharacterized sequence as the sole targeting peptide, and measuring the glycans produced in view of the cytoplasmic localization of glycan biosynthesis (e.g. as in Schwientek JBC 1996 3398), or by expressing a fluorescent reporter protein fused with the targeting peptide, and analyzing the localization of the protein in the Golgi by immunofluorescence or by fractionating the cytoplasmic membranes of the Golgi and measuring the location of the protein.
[0109] The targeting peptide may include a stem domain. In certain embodiments, the stem domain is from an N-acetylglucosaminyltransferase I enzyme or an N-acetylglucosaminyltransferase II enzyme. In especially certain embodiments, the stem domain is from a human N-acetylglucosaminyltransferase I enzyme or a human N-acetylglucosaminyltransferase II enzyme. The sequence corresponding to the stem domain from human N-acetylglucosaminyltransferase I enzyme is SEQ ID NO: 34. The sequence corresponding to the stem domain from human N-acetylglucosaminyltransferase II enzyme is residues 30-85 of SEQ ID NO: 20.
[0110] The targeting peptide may include a transmembrane domain. A "transmembrane domain" refers to any sequence of amino acid residues that is thermodynamically stable in a membrane as a three-dimensional structure. In embodiments where the targeting peptide also includes a stem domain, the transmembrane domain is N-terminal to the stem domain. In certain embodiments, the transmembrane domain is from an N-acetylglucosaminyltransferase I enzyme or an N-acetylglucosaminyltransferase II enzyme. In especially certain embodiments, the transmembrane domain is from a human N-acetylglucosaminyltransferase I enzyme or a human N-acetylglucosaminyltransferase II enzyme. The sequence corresponding to the transmembrane domain from human N-acetylglucosaminyltransferase I enzyme is residues 7-29 of SEQ ID NO: 1. The sequence corresponding to the transmembrane domain from human N-acetylglucosaminyltransferase II enzyme is residues 10-29 of SEQ ID NO: 20.
[0111] The targeting peptide may include a cytoplasmic domain. The term "cytoplasmic domain" refers to an amino acid sequence that is thermodynamically stable in a cytoplasmic environment as a three-dimensional structure. In embodiments where the targeting peptide also includes a stem domain, the cytoplasmic domain is N-terminal to the stem domain. In embodiments where the targeting peptide also includes a transmembrane domain, the cytoplasmic domain is N-terminal to the transmembrane domain. In certain embodiments, the cytoplasmic domain is from an N-acetylglucosaminyltransferase I enzyme or an N-acetylglucosaminyltransferase II enzyme. In especially certain embodiments, the cytoplasmic domain is from a human N-acetylglucosaminyltransferase I enzyme or a human N-acetylglucosaminyltransferase II enzyme. The sequence corresponding to the cytoplasmic domain from human N-acetylglucosaminyltransferase I enzyme is residues 1-6 of SEQ ID NO: 1. The sequence corresponding to the cytoplasmic domain from human N-acetylglucosaminyltransferase II enzyme is residues 1-9 of SEQ ID NO: 20.
[0112] In certain embodiments, the recombinant protein contains a human GnTII catalytic domain N-terminal to a human GnTI catalytic domain with a spacer sequence containing human GnTI stem domain sequence in between the catalytic domains. In this embodiment, the recombinant protein also includes a targeting peptide N-terminal to the GnTII catalytic domain with cytoplasmic, transmembrane, and stem domains from human GnTII. The sequence of the recombinant protein in this embodiment is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 95, and the sequence of a possible cDNA encoding the recombinant protein of this embodiment is SEQ ID NO: 96.
[0113] In other embodiments, the recombinant protein contains a human GnTII catalytic domain N-terminal to a human GnTI catalytic domain with a spacer sequence. The spacer sequence may include, without limitation, a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NOs: 118, 120, 122, or 124. In this embodiment, the recombinant protein also includes a targeting peptide N-terminal to the GnTII catalytic domain with cytoplasmic, transmembrane, and stem domains from human GnTII. Accordingly, in certain embodiments, the sequence of the recombinant protein is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a sequence selected from SEQ ID NOs: 119, 121, 123, and 125. In certain embodiments, the sequence of a possible cDNA encoding the recombinant protein of SEQ ID NO: 119 is SEQ ID NO: 141. In other embodiments, the sequence of a possible cDNA encoding the recombinant protein of SEQ ID NO: 121 is SEQ ID NO: 139. In still other embodiments, the sequence of a possible cDNA encoding the recombinant protein of SEQ ID NO: 123 is SEQ ID NO: 143. In further embodiments, the sequence of a possible cDNA encoding the recombinant protein of SEQ ID NO: 125 is SEQ ID NO: 145.
[0114] Production of Recombinant Proteins of the Invention
[0115] Another aspect of the invention includes isolated polynucleotides encoding the recombinant proteins of the invention. As used herein, the terms "polynucleotide," "nucleic acid sequence," "sequence of nucleic acids," and variations thereof shall be generic to polydeoxyribonucleotides (containing 2-deoxy-D-ribose), to polyribonucleotides (containing D-ribose), to any other type of polynucleotide that is an N-glycoside of a purine or pyrimidine base, and to other polymers containing non-nucleotidic backbones, provided that the polymers contain nucleobases in a configuration that allows for base pairing and base stacking, as found in DNA and RNA. Thus, these terms include known types of nucleic acid sequence modifications, for example, substitution of one or more of the naturally-occurring nucleotides with an analog; inter-nucleotide modifications, such as, for example, those with uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoramidates, carbamates, etc.), with negatively charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), and with positively charged linkages (e.g., aminoalkylphosphoramidates, aminoalkylphosphotriesters); those containing pendant moieties, such as, for example, proteins (including nucleases, toxins, antibodies, signal peptides, poly-L-lysine, etc.); those with intercalators (e.g., acridine, psoralen, etc.); and those containing chelators (e.g., metals, radioactive metals, boron, oxidative metals, etc.). As used herein, the symbols for nucleotides and polynucleotides are those recommended by the IUPAC-IUB Commission of Biochemical Nomenclature (Biochem. 9:4022, 1970).
[0116] Sequences of the isolated polynucleotides are prepared by any suitable method known to those of ordinary skill in the art, including, for example, direct chemical synthesis or cloning. For direct chemical synthesis, formation of a polymer of nucleic acids typically involves sequential addition of 3'-blocked and 5'-blocked nucleotide monomers to the terminal 5'-hydroxyl group of a growing nucleotide chain, where each addition is effected by nucleophilic attack of the terminal 5'-hydroxyl group of the growing chain on the 3'-position of the added monomer, which is typically a phosphorus derivative, such as a phosphotriester, phosphoramidite, or the like. Such methodology is known to those of ordinary skill in the art and is described in the pertinent texts and literature [e.g., in Matteucci et al., (1980) Tetrahedron Lett 21:719-722; U.S. Pat. Nos. 4,500,707; 5,436,327; and 5,700,637]. In addition, the desired sequences may be isolated from natural sources by splitting DNA using appropriate restriction enzymes, separating the fragments using gel electrophoresis, and thereafter, recovering the desired nucleic acid sequence from the gel via techniques known to those of ordinary skill in the art, such as utilization of polymerase chain reactions (PCR; e.g., U.S. Pat. No. 4,683,195).
[0117] Each polynucleotide of the invention can be incorporated into an expression vector. "Expression vector" or "vector" refers to a compound and/or composition that transduces, transforms, or infects a host cell, thereby causing the cell to express nucleic acids and/or proteins other than those native to the cell, or in a manner not native to the cell. An "expression vector" contains a sequence of nucleic acids (ordinarily RNA or DNA) to be expressed by the host cell. Optionally, the expression vector also comprises materials to aid in achieving entry of the nucleic acid into the host cell, such as a virus, liposome, protein coating, or the like. The expression vectors contemplated for use in the present invention include those into which a nucleic acid sequence can be inserted, along with any certain or required operational elements. Further, the expression vector must be one that can be transferred into a host cell and replicated therein. Certain expression vectors are plasmids, particularly those with restriction sites that have been well documented and that contain the operational elements certain or required for transcription of the nucleic acid sequence. Such plasmids, as well as other expression vectors, are well known to those of ordinary skill in the art.
[0118] Incorporation of the individual polynucleotides may be accomplished through known methods that include, for example, the use of restriction enzymes (such as BamHI, EcoRI, HhaI, XhoI, XmaI, and so forth) to cleave specific sites in the expression vector, e.g., plasmid. The restriction enzyme produces single-stranded ends that may be annealed to a polynucleotide having, or synthesized to have, a terminus with a sequence complementary to the ends of the cleaved expression vector. Annealing is performed using an appropriate enzyme, e.g., DNA ligase. As will be appreciated by those of ordinary skill in the art, both the expression vector and the desired polynucleotide are often cleaved with the same restriction enzyme, thereby assuring that the ends of the expression vector and the ends of the polynucleotide are complementary to each other. In addition, DNA linkers may be used to facilitate linking of nucleic acids sequences into an expression vector.
[0119] A series of individual polynucleotides can also be combined by utilizing methods that are known to those having ordinary skill in the art (e.g., U.S. Pat. No. 4,683,195).
[0120] For example, each of the desired polynucleotides can be initially generated in a separate PCR. Thereafter, specific primers are designed such that the ends of the PCR products contain complementary sequences. When the PCR products are mixed, denatured, and reannealed, the strands having the matching sequences at their 3' ends overlap and can act as primers for each other. Extension of this overlap by DNA polymerase produces a molecule in which the original sequences are "spliced" together. In this way, a series of individual polynucleotides may be "spliced" together and subsequently transduced into a host cell simultaneously. Thus, expression of each of the plurality of polynucleotides is affected.
[0121] Individual polynucleotides, or "spliced" polynucleotides, are then incorporated into an expression vector. The invention is not limited with respect to the process by which the polynucleotide is incorporated into the expression vector. Those of ordinary skill in the art are familiar with the necessary steps for incorporating a polynucleotide into an expression vector. A typical expression vector contains the desired polynucleotide preceded by one or more regulatory regions, along with a ribosome binding site, e.g., a nucleotide sequence that is 3-9 nucleotides in length and located 3-11 nucleotides upstream of the initiation codon in E. coli. See Shine and Dalgarno (1975) Nature 254(5495):34-38 and Steitz (1979) Biological Regulation and Development (ed. Goldberger, R. F.), 1:349-399 (Plenum, New York).
[0122] The term "operably linked" as used herein refers to a configuration in which a control sequence is placed at an appropriate position relative to the coding sequence of a DNA sequence or polynucleotide such that the control sequence directs the expression of a polypeptide.
[0123] Regulatory regions include, for example, those regions that contain a promoter and an operator. A promoter is operably linked to the desired polynucleotide or portion of a polynucleotide encoding a polypeptide, thereby initiating transcription of the polynucleotide, or portion of the polynucleotide encoding a polypeptide, via an RNA polymerase enzyme. An operator is a sequence of nucleic acids adjacent to the promoter, which contains a protein-binding domain where a repressor protein can bind. In the absence of a repressor protein, transcription initiates through the promoter. When present, the repressor protein specific to the protein-binding domain of the operator binds to the operator, thereby inhibiting transcription. In this way, control of transcription is accomplished, based upon the particular regulatory regions used and the presence or absence of the corresponding repressor protein. Examples include lactose promoters (Lad repressor protein changes conformation when contacted with lactose, thereby preventing the Lad repressor protein from binding to the operator) and tryptophan promoters (when complexed with tryptophan, TrpR repressor protein has a conformation that binds the operator; in the absence of tryptophan, the TrpR repressor protein has a conformation that does not bind to the operator). Another example is the tac promoter (see de Boer et al., (1983) Proc Natl Acad Sci USA 80(1):21-25). As will be appreciated by those of ordinary skill in the art, these and other regulatory regions may be used in the present invention, and the invention is not limited in this respect.
[0124] Examples of certain promoters for linkage to the isolated polynucleotides encoding the recombinant proteins of the invention include promoters from the following genes: gpdA, cbh1, Aspergillus oryzae TAKA amylase, Rhizomucor miehei aspartic proteinase, Aspergillus niger neutral alpha-amylase, Aspergillus niger acid stable alpha-amylase, Aspergillus niger glucoamylase (glaA), Aspergillus awamori glaA, Rhizomucor miehei lipase, Aspergillus oryzae alkaline protease, Aspergillus oryzae triose phosphate isomerase, Aspergillus nidulans acetamidase, Aspergillus oryzae acetamidase, Fusarium oxysporum trypsin-like protease, fungal endo .alpha.-L-arabinase (abnA), fungal .alpha.-L-arabinofuranosidase A (abfA), fungal .alpha.-L-arabinofuranosidase B (abfB), fungal xylanase (xlnA), fungal phytase, fungal ATP-synthetase, fungal subunit 9 (oliC), fungal triose phosphate isomerase (tpi), fungal alcohol dehydrogenase (adhA), fungal .alpha.-amylase (amy), fungal amyloglucosidase (glaA), fungal acetamidase (amdS), fungal glyceraldehyde-3-phosphate dehydrogenase (gpd), yeast alcohol dehydrogenase, yeast lactase, yeast 3-phosphoglycerate kinase, yeast triosephosphate isomerase, bacterial .alpha.-amylase, bacterial Spo2, and SSO. In certain embodiments, isolated polynucleotides encoding the recombinant proteins of the invention are operably linked to a constitutive promoter. In other embodiments, isolated polynucleotides encoding the recombinant proteins of the invention are operably linked to an inducible promoter. In certain preferred embodiments, the inducible promoter is from a cbh1 gene.
[0125] Although any suitable expression vector may be used to incorporate the desired sequences, readily available expression vectors include, without limitation: plasmids, such as pSClOl, pBR322, pBBRlMCS-3, pUR, pEX, pMRlOO, pCR4, pBAD24, pUC 19; bacteriophages, such as Ml 3 phage and .lamda. phage. Of course, such expression vectors may only be suitable for particular host cells. One of ordinary skill in the art, however, can readily determine through routine experimentation whether any particular expression vector is suited for any given host cell. For example, the expression vector can be introduced into the host cell, which is then monitored for viability and expression of the sequences contained in the vector. In addition, reference may be made to the relevant texts and literature, which describe expression vectors and their suitability to any particular host cell.
[0126] Another aspect of the invention includes host cells containing expression vectors containing isolated polynucleotides that encode the recombinant proteins of the invention. "Host cell" as used herein refers to a living biological cell that can be transformed via insertion of recombinant DNA or RNA. Such recombinant DNA or RNA can be in an expression vector. Thus, a host cell as described herein may be a prokaryotic organism (e.g., an organism of the kingdom eubacteria) or a eukaryotic cell. As will be appreciated by one of ordinary skill in the art, a prokaryotic cell lacks a membrane-bound nucleus, while a eukaryotic cell has a membrane-bound nucleus. In certain embodiments, host cells used for production of the recombinant proteins of the invention are fungal cells such as yeast or filamentous fungi. In other embodiments, the host cells are mammalian cells. Such cells may be human or non-human.
[0127] Another aspect of the invention includes methods of producing the recombinant proteins of the invention. The method includes the steps of introducing an isolated polynucleotide that encodes the recombinant protein into a host cell, and culturing the host cell such that the recombinant protein is expressed. The method may also include a step of purifying the recombinant protein from the host cell.
[0128] Methods of producing the recombinant proteins of the invention may include the introduction or transfer of expression vectors containing the recombinant polynucleotides of the invention into the host cell. Such methods for transferring expression vectors into host cells are well known to those of ordinary skill in the art. For example, one method for transforming E. coli with an expression vector involves a calcium chloride treatment where the expression vector is introduced via a calcium precipitate. Other salts, e.g., calcium phosphate, may also be used following a similar procedure. In addition, electroporation (i.e., the application of current to increase the permeability of cells to nucleic acid sequences) may be used to transfect the host cell. Also, microinjection of the nucleic acid sequences provides the ability to transfect host cells. Other means, such as lipid complexes, liposomes, and dendrimers, may also be employed. Those of ordinary skill in the art can transfect a host cell with a desired sequence using these or other methods.
[0129] The vector may be an autonomously replicating vector, i.e., a vector which exists as an extrachromosomal entity, the replication of which is independent of chromosomal replication, e.g., a plasmid, an extrachromosomal element, a minichromosome, or an artificial chromosome. The vector may contain any means for assuring self-replication. Alternatively, the vector may be one which, when introduced into the host, is integrated into the genome and replicated together with the chromosome(s) into which it has been integrated. Furthermore, a single vector or plasmid or two or more vectors or plasmids which together contain the total DNA to be introduced into the genome of the host, or a transposon may be used.
[0130] The vectors may contain one or more selectable markers which permit easy selection of transformed hosts. A selectable marker is a gene, the product of which provides, for example, biocide or viral resistance, resistance to heavy metals, prototrophy to auxotrophs, and the like. Selection of bacterial cells may be based upon antimicrobial resistance that has been conferred by genes such as the amp, gpt, neo, and hyg genes.
[0131] Suitable markers for yeast hosts are, for example, ADE2, HIS3, LEU2, LYS2, MET3, TRP1, and URA3. Selectable markers for use in a filamentous fungal host include, but are not limited to, amdS (acetamidase), argB (ornithine carbamoyltransferase), bar (phosphinothricin acetyltransferase), hph (hygromycin phosphotransferase), niaD (nitrate reductase), pyrG (orotidine 5'-phosphate decarboxylase), sC (sulfate adenyltransferase), and trpC (anthranilate synthase), as well as equivalents thereof. Certain for use in Aspergillus are the amdS and pyrG genes of Aspergillus nidulans or Aspergillus oryzae and the bar gene of Streptomyces hygroscopicus. Certain for use in Trichoderma are bar, pyr4, and amdS.
[0132] The vectors may contain an element(s) that permits integration of the vector into the host's genome or autonomous replication of the vector in the cell independent of the genome.
[0133] For integration into the host genome, the vector may rely on the gene's sequence or any other element of the vector for integration of the vector into the genome by homologous or nonhomologous recombination. Alternatively, the vector may contain additional nucleotide sequences for directing integration by homologous recombination into the genome of the host. The additional nucleotide sequences enable the vector to be integrated into the host genome at a precise location(s) in the chromosome(s). To increase the likelihood of integration at a precise location, the integrational elements may contain a sufficient number of nucleic acids, such as 100 to 10,000 base pairs, preferably 400 to 10,000 base pairs, and most preferably 800 to 10,000 base pairs, which are highly homologous with the corresponding target sequence to enhance the probability of homologous recombination. The integrational elements may be any sequence that is homologous with the target sequence in the genome of the host. Furthermore, the integrational elements may be non-encoding or encoding nucleotide sequences. On the other hand, the vector may be integrated into the genome of the host by non-homologous recombination.
[0134] For autonomous replication, the vector may further comprise an origin of replication enabling the vector to replicate autonomously in the host in question. The origin of replication may be any plasmid replicator mediating autonomous replication which functions in a cell. The term "origin of replication" or "plasmid replicator" is defined herein as a sequence that enables a plasmid or vector to replicate in vivo. Examples of origins of replication for use in a yeast host are the 2 micron origin of replication, ARS1, ARS4, the combination of ARS1 and CEN3, and the combination of ARS4 and CEN6. Examples of origins of replication useful in a filamentous fungal cell are AMA1 and ANS1 (Gems et al., 1991; Cullen et al., 1987; WO 00/24883). Isolation of the AMA1 gene and construction of plasmids or vectors comprising the gene can be accomplished according to the methods disclosed in WO 00/24883.
[0135] For other hosts, transformation procedures may be found, for example, in Jeremiah D. Read, et al., Applied and Environmental Microbiology, August 2007, p. 5088-5096, for Kluyveromyces, in Osvaldo Delgado, et al., FEMS Microbiology Letters 132, 1995, 23-26, for Zymomonas, in U.S. Pat. No. 7,501,275 for Pichia stipitis, and in WO 2008/040387 for Clostridium.
[0136] More than one copy of a gene may be inserted into the host to increase production of the gene product. An increase in the copy number of the gene can be obtained by integrating at least one additional copy of the gene into the host genome or by including an amplifiable selectable marker gene with the nucleotide sequence where cells containing amplified copies of the selectable marker gene, and thereby additional copies of the gene, can be selected for by cultivating the cells in the presence of the appropriate selectable agent.
[0137] The procedures used to ligate the elements described above to construct the recombinant expression vectors of the present invention are well-known to one skilled in the art (see, e.g., Sambrook et al., 1989, supra).
[0138] The host cell is transformed with at least one expression vector. When only a single expression vector is used (without the addition of an intermediate), the vector will contain all of the nucleic acid sequences necessary.
[0139] Once the host cell has been transformed with the expression vector, the host cell is allowed to grow. Methods of the invention may include culturing the host cell such that recombinant nucleic acids in the cell are expressed. For microbial hosts, this process entails culturing the cells in a suitable medium. Typically, cells are grown at 35.degree. C. in appropriate media. Certain growth media in the present invention include, for example, common commercially-prepared media such as Luria-Bertani (LB) broth, Sabouraud Dextrose (SD) broth or Yeast medium (YM) broth. Other defined or synthetic growth media may also be used and the appropriate medium for growth of the particular host cell will be known by someone skilled in the art of microbiology or fermentation science. Temperature ranges and other conditions suitable for growth are known in the art (see, e.g., Bailey and Ollis 1986).
[0140] Methods for purifying recombinant proteins of the invention from the host cell are well known in the art (see E. L. V. Harris and S. Angel, Eds. (1989) Protein Purification Methods: A Practical Approach, IRL Press, Oxford, England). Such methods include, without limitation, preparative disc-gel electrophoresis, isoelectric focusing, high-performance liquid chromatography (HPLC), reversed-phase HPLC, gel filtration, ion exchange and partition chromatography, and countercurrent distribution, and combinations thereof. In certain embodiments, the recombinant proteins carry additional sequence tags to facilitate purification. Such markers include epitope tags and protein tags. Non-limiting examples of epitope tags include c-myc, hemagglutinin (HA), polyhistidine (6.times.-HIS), GLU-GLU, and DYKDDDDK (FLAG) (SEQ ID NO: 117) epitope tags. Epitope tags can be added to peptides by a number of established methods. DNA sequences of epitope tags can be inserted into recombinant protein coding sequences as oligonucleotides or through primers used in PCR amplification. As an alternative, peptide-coding sequences can be cloned into specific vectors that create fusions with epitope tags; for example, pRSET vectors (Invitrogen Corp., San Diego, Calif.) Non-limiting examples of protein tags include glutathione-S-transferase (GST), green fluorescent protein (GFP), and maltose binding protein (MBP). Protein tags are attached to peptides or polypeptides by several well-known methods. In one approach, the coding sequence of a polypeptide or peptide can be cloned into a vector that creates a fusion between the polypeptide or peptide and a protein tag of interest. Suitable vectors include, without limitation, the exemplary plasmids, pGEX (Amersham Pharmacia Biotech, Inc., Piscataway, N.J.), pEGFP (CLONTECH Laboratories, Inc., Palo Alto, Calif.), and pMAL.TM. (New England BioLabs, Inc., Beverly, Mass.). Following expression, the epitope or protein-tagged polypeptide or peptide can be purified from a crude lysate of the host cell by chromatography on an appropriate solid-phase matrix. In some cases, it may be preferable to remove the epitope or protein tag (i.e., via protease cleavage) following purification.
[0141] Methods of Producing Complex Glycans
[0142] Another aspect of the invention includes methods of producing a complex N-glycan, including the steps of providing a host cell, where the host cell contains a polynucleotide encoding a fusion protein comprising an N-acetylglucosaminyltransferase I catalytic domain and an N-acetylglucosaminyltransferase II catalytic domain and culturing the host cell such that the fusion protein is expressed, where the fusion protein catalyzes the transfer of N-acetylglucosamine to a terminal Man.alpha.3 residue and N-acetylglucosamine to a terminal Man.alpha.6 residue of an acceptor glycan to produce a complex N-glycan. In certain embodiments, this aspect includes methods of producing human-like N-glycans in a Trichoderma cell.
[0143] As used herein, the term "complex N-glycan" refers to an N-glycan comprising a terminal GlcNAc.sub.2Man.sub.3 structure.
[0144] The complex N-glycan includes any glycan having the formula [GlcNAc.beta.2].sub.7Man.alpha.3([GlcNAc.beta.2].sub.wMan.alpha.6)Man{.be- ta.4GlcNAc.beta.(Fuc.alpha.x).sub.n[4GlcNAc].sub.m}.sub.p, where n, m, and p are 0 or 1, indicating presence or absence of part of the molecule, with the provision that when m is 0, then n is 0 (fucose is a branch linked to the GlcNAc), where x is 3 or 6, where ( ) defines a branch in the structure, where [ ] defines a part of the glycan structure either present or absent in a linear sequence, and where z and w are 0 or 1. Preferably w and z are 1. In certain embodiments, the complex N-glycan includes GlcNAc.beta.2Man.alpha.3(GlcNAc.beta.2Man.alpha.6)Man.beta.4GlcN- Ac.beta.4GlcNAc, GlcNAc.beta.2Man.alpha.3(Man.alpha.6)Man.beta.4GlcNAc.beta.4GlcNAc, GlcNAc.beta.2Man.alpha.3(GlcNAc.beta.2Man.alpha.6)Man.beta.4GlcNAc.beta.4- (Fuc.alpha.6)GlcNAc, GlcNAc.beta.2Man.alpha.3(Man.alpha.6)Man.beta.4GlcNAc.beta.4(Fuc.alpha.6)- GlcNAc, and Man.alpha.3(Man.alpha.6)Man.beta.4GlcNAc.beta.4GlcNAc. In certain embodiments, the complex N-glycans are fungal non-fucosylated GlcNAcMan3, GlcNAc2Man3, and or Man3
[0145] In certain embodiments, the method of producing a complex N-glycan will generate a mixture of different glycans. The complex N-glycan may constitute at least 1%, at least 3%, at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 50%, or at least 75% or more of such a glycan mixture.
[0146] The acceptor glycan, and thus the complex N-glycan, may be attached to a molecule such as an amino acid, a peptide, or a polypeptide. In certain embodiments, the amino acid derivative is an asparagine residue. The asparagine residue may be in aminoglycosidic linkage from the side-chain amide (a biologic mammalian polypeptide N-glycan linkage structure) and may be part of a peptide chain such as a dipeptide, an oligopeptide, or a polypeptide. The glycan may be a reducing end derivative such as an N-, O-, or C-linked, preferably glycosidic, derivative of the reducing GlcNAc or Man, such as a spacer or terminal organic residue with a certain glycan linked structure selected from the group of an amino acid, alkyl, heteroalkyl, acyl, alkyloxy, aryl, arylalkyl, and heteroarylalkyl. The spacer may be further linked to a polyvalent carrier or a solid phase. In certain embodiments, alkyl-containing structures include methyl, ethyl, propyl, and C4-C26 alkyls, lipids such as glycerolipids, phospholipids, dolichol-phospholipids and ceramides and derivatives. The reducing end may also be derivatized by reductive amination to a secondary amine linkage or a derivative structure. Certain carriers include biopoly- or oligomers such as (poly)peptides, poly(saccharides) such as dextran, cellulose, amylose, or glycosaminoglycans, and other organic polymers or oligomers such as plastics including polyethylene, polypropylene, polyamides (e.g., nylon or polystyrene), polyacrylamide, and polylactic acids, dendrimers such as PAMAM, Starburst or Starfish dendrimers, or polylysine, and polyalkylglycols such as polyethylene glycol (PEG). Solid phases may include microtiter wells, silica particles, glass, metal (including steel, gold and silver), polymer beads such as polystyrene or resin beads, polylactic acid beads, polysaccharide beads or organic spacers containing magnetic beads.
[0147] In certain embodiments, the acceptor glycan is attached to a heterologous polypeptide. In certain embodiments, the heterologous polypeptide is a therapeutic protein. Therapeutic proteins may include monoclonal antibodies, erythropoietins, interferons, growth hormones, enzymes, or blood-clotting factors and may be useful in the treatment of humans or animals. For example, the acceptor glycan may be attached to a therapeutic protein such as rituximab.
[0148] The acceptor glycan may be any of the acceptor glycans described in the section entitled, "Recombinant Proteins of the Invention."
[0149] In certain embodiments, the acceptor glycan may be Man5. In such embodiments, a Man5 expressing T. reesei strain is transformed with a GnTII/GnTI fusion enzyme using random integration or by targeted integration to a known site known not to affect Man5 glycosylation. Strains that produce GlcNAcMan5 are selected. The selected strains are further transformed with a catalytic domain of a mannosidase II-type mannosidase capable of cleaving Man5 structures to generate GlcNAcMan3. In certain embodiments mannosidase II-type enzymes belong to glycoside hydrolase family 38 (cazy.org/GH38_all.html). Characterized enzymes include enzymes listed in cazy.org/GH38_characterized.html. Especially useful enzymes are Golgi-type enzymes that cleaving glycoproteins, such as those of subfamily .alpha.-mannosidase II (Man2A1;ManA2). Examples of such enzymes include human enzyme AAC50302, D. melanogaster enzyme (Van den Elsen J. M. et al (2001) EMBO J. 20: 3008-3017), those with the 3D structure according to PDB-reference 1HTY, and others referenced with the catalytic domain in PDB. For cytoplasmic expression, the catalytic domain of the mannosidase is typically fused with an N-terminal targeting peptide or expressed with endogenous animal or plant Golgi targeting structures of animal or plant mannosidase II enzymes. After transformation with the catalytic domain of a mannosidase II-type mannosidase, a strain effectively producing GlcNAc2Man3 is selected.
[0150] Host Cells
[0151] The methods of producing a complex N-glycan include a first step of providing a host cell. Any prokaryotic or eukaryotic host cell may be used in the present invention so long as it remains viable after being transformed with a sequence of nucleic acids. Preferably, the host cell is not adversely affected by the transduction of the necessary nucleic acid sequences, the subsequent expression of recombinant proteins, or the resulting intermediates. Suitable eukaryotic cells include, but are not limited to, fungal, plant, insect or mammalian cells.
[0152] In certain embodiments, the host is a fungal strain. "Fungi" as used herein includes the phyla Ascomycota, Basidiomycota, Chytridiomycota, and Zygomycota (as defined by Hawksworth et al., In, Ainsworth and Bisby's Dictionary of The Fungi, 8th edition, 1995, CAB International, University Press, Cambridge, UK) as well as the Oomycota (as cited in Hawksworth et al., 1995, supra, page 171) and all mitosporic fungi (Hawksworth et al., 1995, supra).
[0153] In particular embodiments, the fungal host is a yeast strain. "Yeast" as used herein includes ascosporogenous yeast (Endomycetales), basidiosporogenous yeast, and yeast belonging to the Fungi Imperfecti (Blastomycetes). Since the classification of yeast may change in the future, for the purposes of this invention, yeast shall be defined as described in Biology and Activities of Yeast (Skinner, F. A., Passmore, S. M., and Davenport, R. R., eds, Soc. App. Bacteriol. Symposium Series No. 9, 1980).
[0154] In certain embodiments, the yeast host is a Candida, Hansenula, Kluyveromyces, Pichia, Saccharomyces, Schizosaccharomyces, or Yarrowia strain.
[0155] In certain embodiments, the yeast host is Saccharomyces cerevisiae, Kluyveromyces lactis, Pichia pastoris, Candida albicans, Hansenula polymorpha, Schizosaccharomyces, or Yarrowia.
[0156] In another particular embodiment, the fungal host cell is a filamentous fungal strain. "Filamentous fungi" include all filamentous forms of the subdivision Eumycota and Oomycota (as defined by Hawksworth et al., 1995, supra). The filamentous fungi are generally characterized by a mycelial wall composed of chitin, cellulose, glucan, chitosan, mannan, and other complex polysaccharides. Vegetative growth is by hyphal elongation and carbon catabolism is obligately aerobic. In contrast, vegetative growth by yeasts such as Saccharomyces cerevisiae is by budding of a unicellular thallus and carbon catabolism may be fermentative.
[0157] The filamentous fungal host cell may be, for example, an Acremonium, Aspergillus, Fusarium, Humicola, Mucor, Myceliophthora, Neurospora, Penicillium, Scytalidium, Thielavia, Tolypocladium, or Trichoderma strain.
[0158] In certain embodiments, the filamentous fungal host cell is a Trichoderma sp., Acremonium, Aspergillus, Aureobasidium, Cryptococcus, Chrysosporium, Chrysosporium lucknowense, Filibasidium, Fusarium, Gibberella, Magnaporthe, Mucor, Myceliophthora, Myrothecium, Neocallimastix, Neurospora, Paecilomyces, Penicillium, Piromyces, Schizophyllum, Talaromyces, Thermoascus, Thielavia, or Tolypocladium strain.
[0159] In certain embodiments, the host cell is a mammalian cell. Such cells may be human or non-human.
[0160] In other certain embodiments, the host cell is prokaryotic, and in certain embodiments, the prokaryotes are E. coli, Bacillus subtilis, Zymomonas mobilis, Clostridium sp., Clostridium phytofermentans, Clostridium thermocellum, Clostridium beijerinckii, Clostridium acetobutylicum (Moorella thermoacetica), Thermoanaerobacterium saccharolyticum, or Klebsiella oxytoca. In other embodiments, the prokaryotic host cells are Carboxydocella sp., Corynebacterium glutamicum, Enterobacteriaceae, Erwinia chrysanthemi, Lactobacillus sp., Pediococcus acidilactici, Rhodopseudomonas capsulata, Streptococcus lactis, Vibrio furnissii, Vibrio furnissii Ml, Caldicellulosiruptor saccharolyticus, or Xanthomonas campestris. In other embodiments, the host cells are cyanobacteria. Additional examples of bacterial host cells include, without limitation, those species assigned to the Escherichia, Enterobacter, Azotobacter, Erwinia, Bacillus, Pseudomonas, Klebsiella, Proteus, Salmonella, Serratia, Shigella, Rhizobia, Vitreoscilla, Synechococcus, Synechocystis, and Paracoccus taxonomical classes.
[0161] In methods of the invention for producing a complex N-glycan, the methods include a step of culturing the host cell such that the fusion protein is expressed. For microbial hosts, this process entails culturing the cells in a suitable medium. Typically, cells are grown at 35.degree. C. in appropriate media. Certain growth media in the present invention include, for example, common commercially-prepared media such as Luria-Bertani (LB) broth, Sabouraud Dextrose (SD) broth or Yeast medium (YM) broth. Other defined or synthetic growth media may also be used and the appropriate medium for growth of the particular host cell will be known by someone skilled in the art of microbiology or fermentation science. Temperature ranges and other conditions suitable for growth are known in the art (see, e.g., Bailey and Ollis 1986). In certain embodiments the pH of cell culture is between 3.5 and 7.5, between 4.0 and 7.0, between 4.5 and 6.5, between 5 and 5.5, or at 5.5.
[0162] The host cells used in the methods of producing a complex N-glycan contain a polynucleotide encoding any of the recombinant proteins of the invention as described in the section entitled "Recombinant Proteins of the Invention." In certain embodiments, the host cell contains a polynucleotide encoding a fusion protein comprising an N-acetylglucosaminyltransferase I catalytic domain and an N-acetylglucosaminyltransferase II catalytic domain, where the fusion protein catalyzes the transfer of N-acetylglucosamine to a terminal Man.alpha.3 residue and N-acetylglucosamine to a terminal Man.alpha.6 residue of an acceptor glycan to produce a complex N-glycan.
[0163] In certain embodiments, the host cell contains a polynucleotide encoding a UDP-GlcNAc transporter. The polynucleotide encoding the UDP-GlcNAc transporter may be endogenous (i.e., naturally present) in the host cell, or it may be heterologous to the host cell.
[0164] In certain embodiments, the host cell contains a polynucleotide encoding a .alpha.-1,2-mannosidase. The polynucleotide encoding the .alpha.-1,2-mannosidase may be endogenous in the host cell, or it may be heterologous to the host cell. These polynucleotides are especially useful for a host cell expressing high-mannose glycans transferred from the Golgi to the ER without effective exo-.alpha.-2-mannosidase cleavage. The .alpha.-1,2-mannosidase may be a mannosidase I type enzyme belonging to the glycoside hydrolase family 47 (cazy.org/GH47_all.html). In certain embodiments the .alpha.-1,2-mannosidase is an enzyme listed at cazy.org/GH47 characterized.html. In particular, the .alpha.-1,2-mannosidase may be an ER-type enzyme that cleaves glycoproteins such as enzymes in the subfamily of ER .alpha.-mannosidase I EC 3.2.1.113 enzymes. Examples of such enzymes include human .alpha.-2-mannosidase 1B (AAC26169), a combination of mammalian ER mannosidases, or a filamentous fungal enzyme such as .alpha.-1,2-mannosidase (MDS1) (T. reesei AAF34579; Maras M et al J Biotech. 77, 2000, 255). For cytoplasmic expression the catalytic domain of the mannosidase is typically fused with a targeting peptide, such as HDEL, KDEL, or part of an ER or early Golgi protein, or expressed with an endogenous ER targeting structures of an animal or plant mannosidase I enzyme.
[0165] In certain embodiments, the host cell contains a polynucleotide encoding a galactosyltransferase. Galactosyltransferases transfer .beta.-linked galactosyl residues to terminal N-acetylglucosaminyl residue. In certain embodiments the galactosyltransferase is a .beta.-4-galactosyltransferase. Generally, .beta.-4-galactosyltransferases belong to the CAZy glycosyltransferase family 7 (cazy.org/GT7 all.html) and include .beta.-N-acetylglucosaminyl-glycopeptide .beta.-1,4-galactosyltransferase (EC 2.4.1.38), which is also known as N-acetylactosamine synthase (EC 2.4.1.90). Useful subfamilies include .beta.4-GalT1, .beta.4-GalT-II, -III, -IV, -V, and -VI, such as mammalian or human .beta.4-GalTI or .beta.4GalT-II, -III, -IV, -V, and -VI or any combinations thereof .beta.4-GalT1, .beta.4-GalTII, or .beta.4-GalTIII are especially useful for galactosylation of terminal GlcNAc.beta.2-structures on N-glycans such as GlcNAcMan3, GlcNAc2Man3, or GlcNAcMan5 (Guo S. et al. Glycobiology 2001, 11:813-20). The three-dimensional structure of the catalytic region is known (e.g. (2006) J. Mol. Biol. 357: 1619-1633), and the structure has been represented in the PDB database with code 2FYD. The CAZy database includes examples of certain enzymes. Characterized enzymes are also listed in the CAZy database at cazy.org/GT7_characterized.html. Examples of useful .beta.4GalT enzymes include .beta.4GalT1, e.g. bovine Bos taurus enzyme AAA30534.1 (Shaper N. L. et al Proc. Natl. Acad. Sci. U.S.A. 83 (6), 1573-1577 (1986)), human enzyme (Guo S. et al. Glycobiology 2001, 11:813-20), and Mus musculus enzyme AAA37297 (Shaper, N. L. et al. 1998 J. Biol. Chem. 263 (21), 10420-10428); .beta.4GalTII enzymes such as human .beta.4GalTII BAA75819.1, Chinese hamster Cricetulus griseus AAM77195, Mus musculus enzyme BAA34385, and Japanese Medaka fish Oryzias latipes BAH36754; and .beta.4GalTIII enzymes such as human .beta.4GalTIII BAA75820.1, Chinese hamster Cricetulus griseus AAM77196 and Mus musculus enzyme AAF22221.
[0166] The galactosyltransferase may be expressed in the cytoplasm of the host cell. A heterologous targeting peptide, such as a Kre2 peptide described in Schwientek J. Biol. Chem 1996 3398, may be used. Promoters that may be used for expression of the galactosyltransferase include constitutive promoters such as gpd, promoters of endogenous glycosylation enzymes and glycosyltransferases such as mannosyltransferases that synthesize N-glycans in the Golgi or ER, and inducible promoters of high-yield endogenous proteins such as the cbh1 promoter.
[0167] In certain embodiments of the invention where the host cell contains a polynucleotide encoding a galactosyltransferase, the host cell also contains a polynucleotide encoding a UDP-Gal and/or UDP-Gal transporter. In certain embodiments of the invention where the host cell contains a polynucleotide encoding a galactosyltransferase, lactose may be used as the carbon source instead of glucose when culturing the host cell. The culture medium may be between pH 4.5 and 7.0 or between 5.0 and 6.5. In certain embodiments of the invention where the host cell contains a polynucleotide encoding a galactosyltransferase and a polynucleotide encoding a UDP-Gal and/or UDP-Gal transporter, a divalent cation such as Mn2+, Ca2+ or Mg2+ may be added to the cell culture medium.
[0168] In certain embodiments, the host cell contains a polynucleotide encoding a sialyltransferase. A sialyltransferase transfers .alpha.3- or .alpha.6-linked sialic acid, such as Neu5Ac, to the terminal Gal of galactosylated complex glycans. Examples of suitable sialyltransferases can be found in the glycosylation protein family 29 (cazy.org/GT29.html). Useful .alpha.3- or .alpha.6-sialyltransferases include .beta.-galactoside .alpha.-2,6-sialyltransferase (EC 2.4.99.1) with a certain subfamily ST6Gal-I, and N-acetylactosaminide .alpha.-2,3-sialyltransferase (EC 2.4.99.6) with possible cross-reactivity with .beta.-galactoside .alpha.-2,3-sialyltransferase (EC 2.4.99.4). Useful subtypes of .alpha.3-sialyltransferases include ST3Gal-III and ST3Gal-IV. Certain enzymatically characterized species of these are listed as characterized in the CAZy database of glycosylation enzymes (cazy.org/GT29_characterized.html). The polynucleotide encoding the .alpha.3- or .alpha.6-linked sialyltransferase may be endogenous to the host cell, or it may be heterologous to the host cell. Sialylation in the host cell may require expression of enzymes synthesizing the donor CMP-sialic acid such as CMP-Neu5Ac, especially in fungal, plant, nematode/parasite, or insect cells.
[0169] The host cell may have increased or reduced levels of activity of various endogenous enzymes. A reduced level of activity may be provided by inhibiting the activity of the endogenous enzyme with an inhibitor, an antibody, or the like. In certain embodiments, the host cell is genetically modified in ways to increase or reduce activity of various endogenous enzymes. "Genetically modified" refers to any recombinant DNA or RNA method used to create a prokaryotic or eukaryotic host cell that expresses a polypeptide at elevated levels, at lowered levels, or in a mutated form. In other words, the host cell has been transfected, transformed, or transduced with a recombinant polynucleotide molecule, and thereby been altered so as to cause the cell to alter expression of a desired protein.
[0170] Genetic modifications which result in a decrease in gene expression, in the function of the gene, or in the function of the gene product (i.e., the protein encoded by the gene) can be referred to as inactivation (complete or partial), deletion, interruption, blockage, silencing, or down-regulation, or attenuation of expression of a gene. For example, a genetic modification in a gene which results in a decrease in the function of the protein encoded by such gene, can be the result of a complete deletion of the gene (i.e., the gene does not exist, and therefore the protein does not exist), a mutation in the gene which results in incomplete or no translation of the protein (e.g., the protein is not expressed), or a mutation in the gene which decreases or abolishes the natural function of the protein (e.g., a protein is expressed which has decreased or no enzymatic activity or action). More specifically, reference to decreasing the action of proteins discussed herein generally refers to any genetic modification in the host cell in question, which results in decreased expression and/or functionality (biological activity) of the proteins and includes decreased activity of the proteins (e.g., decreased catalysis), increased inhibition or degradation of the proteins as well as a reduction or elimination of expression of the proteins. For example, the action or activity of a protein of the present invention can be decreased by blocking or reducing the production of the protein, reducing protein action, or inhibiting the action of the protein. Combinations of some of these modifications are also possible. Blocking or reducing the production of a protein can include placing the gene encoding the protein under the control of a promoter that requires the presence of an inducing compound in the growth medium. By establishing conditions such that the inducer becomes depleted from the medium, the expression of the gene encoding the protein (and therefore, of protein synthesis) could be turned off. Blocking or reducing the action of a protein could also include using an excision technology approach similar to that described in U.S. Pat. No. 4,743,546. To use this approach, the gene encoding the protein of interest is cloned between specific genetic sequences that allow specific, controlled excision of the gene from the genome. Excision could be prompted by, for example, a shift in the cultivation temperature of the culture, as in U.S. Pat. No. 4,743,546, or by some other physical or nutritional signal.
[0171] In general, according to the present invention, an increase or a decrease in a given characteristic of a mutant or modified protein (e.g., enzyme activity) is made with reference to the same characteristic of a wild-type (i.e., normal, not modified) protein that is derived from the same organism (from the same source or parent sequence), which is measured or established under the same or equivalent conditions. Similarly, an increase or decrease in a characteristic of a genetically modified host cell (e.g., expression and/or biological activity of a protein, or production of a product) is made with reference to the same characteristic of a wild-type host cell of the same species, and preferably the same strain, under the same or equivalent conditions. Such conditions include the assay or culture conditions (e.g., medium components, temperature, pH, etc.) under which the activity of the protein (e.g., expression or biological activity) or other characteristic of the host cell is measured, as well as the type of assay used, the host cell that is evaluated, etc. As discussed above, equivalent conditions are conditions (e.g., culture conditions) which are similar, but not necessarily identical (e.g., some conservative changes in conditions can be tolerated), and which do not substantially change the effect on cell growth or enzyme expression or biological activity as compared to a comparison made under the same conditions.
[0172] Preferably, a genetically modified host cell that has a genetic modification that increases or decreases the activity of a given protein (e.g., an enzyme) has an increase or decrease, respectively, in the activity or action (e.g., expression, production and/or biological activity) of the protein, as compared to the activity of the wild-type protein in a wild-type host cell, of at least about 5%, and more preferably at least about 10%, and more preferably at least about 15%, and more preferably at least about 20%, and more preferably at least about 25%, and more preferably at least about 30%, and more preferably at least about 35%, and more preferably at least about 40%, and more preferably at least about 45%, and more preferably at least about 50%, and more preferably at least about 55%, and more preferably at least about 60%, and more preferably at least about 65%, and more preferably at least about 70%, and more preferably at least about 75%, and more preferably at least about 80%, and more preferably at least about 85%, and more preferably at least about 90%, and more preferably at least about 95%, or any percentage, in whole integers between 5% and 100% (e.g., 6%, 7%, 8%, etc.). The same differences are certain when comparing an isolated modified nucleic acid molecule or protein directly to the isolated wild-type nucleic acid molecule or protein (e.g., if the comparison is done in vitro as compared to in vivo).
[0173] In another aspect of the invention, a genetically modified host cell that has a genetic modification that increases or decreases the activity of a given protein (e.g., an enzyme) has an increase or decrease, respectively, in the activity or action (e.g., expression, production and/or biological activity) of the protein, as compared to the activity of the wild-type protein in a wild-type host cell, of at least about 2-fold, and more preferably at least about 5-fold, and more preferably at least about 10-fold, and more preferably about 20-fold, and more preferably at least about 30-fold, and more preferably at least about 40-fold, and more preferably at least about 50-fold, and more preferably at least about 75-fold, and more preferably at least about 100-fold, and more preferably at least about 125-fold, and more preferably at least about 150-fold, or any whole integer increment starting from at least about 2-fold (e.g., 3-fold, 4-fold, 5-fold, 6-fold, etc.).
[0174] In certain embodiments, the host cell has a reduced level of activity of a dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase compared to the level of activity in a wild-type host cell. Dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase (EC 2.4.1.130) transfers an alpha-D-mannosyl residue from dolichyl-phosphate D-mannose into a membrane lipid-linked oligosaccharide. Typically, the dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase enzyme is encoded by an alg3 gene. In certain embodiments, the host cell has a reduced level of expression of an alg3 gene compared to the level of expression in a wild-type host cell. In certain embodiments, the alg3 gene is deleted from the host cell.
[0175] In certain embodiments, the host cell has a reduced level of activity of a alpha-1,6-mannosyltransferase compared to the level of activity in a wild-type host cell. Alpha-1,6-mannosyltransferase (EC 2.4.1.232) transfers an alpha-D-mannosyl residue from GDP-mannose into a protein-linked oligosaccharide, forming an elongation initiating alpha-(1.fwdarw.6)-D-mannosyl-D-mannose linkage in the Golgi apparathus. Typically, the alpha-L6-mannosyltransferase enzyme is encoded by an och1 gene. In certain embodiments, the host cell has a reduced level of expression of an och1 gene compared to the level of expression in a wild-type host cell. In certain embodiments, the och1 gene is deleted from the host cell.
[0176] In certain embodiments, the host cell has a reduced level of protease activity. In certain embodiments, genes encoding various proteases are deleted from the host cell. These genes include, for example, genes encoding proteases such as pep1 (pepA in Aspergillus) and cellulolytic enzymes, such as cellobiohydrolase1 (cbh1).
[0177] In certain embodiments, the host cell may have a reduced level of activity of proteins involved in non-homologous end joining (NHEJ) in order to enhance the efficiency of homologous recombination. In certain embodiments, genes encoding these proteins are deleted from the host cell. The genes and their homologues include, but are not limited to, Ku70, Ku80, Lig4, Rad50, Xrs2, Sir4, Lif1, or Nei1 as described in, for example, Ninomiya et al. 2004, Ishibashi et al. 2006, Villalba et al. 2008, and Mizutani et al. 2008.
[0178] In certain embodiments of methods of producing a complex N-glycan, the host cell is a Trichoderma cell that has a reduced level of activity of a dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase compared to the level of activity in a wild-type Trichoderma cell.
[0179] In other certain embodiments of methods of producing a complex N-glycan, the host cell is a yeast cell that has a reduced level of activity of a dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase and a reduced level of activity of an alpha-1,6-mannosyltransferase compared to the levels of activity in a wild-type yeast cell and further comprises a polynucleotide encoding a .alpha.-1,2-mannosidase.
[0180] In Vitro Methods of Producing Complex N-Glycans
[0181] In another aspect, the invention provides a method of producing a complex N-glycan, including a step of incubating a fusion protein comprising an N-acetylglucosaminyltransferase I catalytic domain and an N-acetylglucosaminyltransferase II catalytic domain, an acceptor glycan, and an N-acetylglucosamine donor together in a buffer, where the fusion protein catalyzes the transfer of N-acetylglucosamine to a terminal Man.alpha.3 residue and N-acetylglucosamine to a terminal Man.alpha.6 residue of an acceptor glycan to produce a complex N-glycan. In certain embodiments the acceptor glycan is attached to an amino acid, a peptide, or a polypeptide. In certain embodiments the acceptor glycan is attached to a heterologous polypeptide. In certain embodiments, the acceptor glycan is Man.sub.3. In certain embodiments the N-acetylglucosamine donor is a UDP-GlcNAc transporter. Typically the buffer contains a divalent cation such as Mn.sup.2+, Ca.sup.2+, or Mg.sup.2+ at concentrations of 1 .mu.M to 100 mM, 100 .mu.M to 50 mM, or 0.1 mM to 25 mM. The N-acetylglucosamine donor is typically used in molar excess, such as 1.1-100 fold excess with regard to the reactive acceptor sites on the acceptor glycan. The concentration of the acceptor glycan is typically between 1 .mu.M to 100 mM, 100 .mu.M to 50 mM, or 1 to 25 mM. Where the acceptor glycan is attached to a polypeptide, the concentration ranges are typically at the lower end because of higher molecular weights. The concentrations of the components of the reaction may be adjusted based on their solubilities in the buffer. The amount of enzyme activity (units) may be adjusted to allow an effective reaction within a reasonable reaction time. A reasonable reaction time is typically from a few minutes to several days. In certain embodiments the reaction time will be from about 0.5 hours to one day or from 1 to 6 hours.
[0182] Useful buffers include buffers suitable for the fusion protein such as TRIS, HEPES, MOPS in pH ranges of about 5 to 8.5, 5.5. to 8.0, or 6.0 and 7.5. Typically concentrations of IRIS, HEPES, or MOPS buffers will be between 5 to 150 mM, between 10-100 mM, or 10-60 mM adjusted to maintain the pH. The reaction may be optimized by adding salt such as NaCl at 10-200 mM and/or an enzyme stabilizing but not glycosylatable protein (e.g., a pure non-glycosylated or non-acceptor glycan containing albumin. In a certain embodiment the in vitro reaction is adjusted to be performed in cell culture medium. Phosphate buffers may be used to reduce reaction speed.
[0183] Cells and Methods for Production of Man.sub.3GlcNAc.sub.2 Glycans
[0184] In another aspect, the present invention provides filamentous fungal cells containing a mutation of alg3 and Man3GlcNAc2, where the Man3GlcNAc2 includes at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% (mol %) of neutral N-glycans secreted by the cells. The neutral N-glycans may be attached to an amino acid, a peptide, or a polypeptide. The alg3 gene may be mutated by any means known in the art, such as point mutations or deletion of the entire alg3 gene. Preferably, the function of the alg3 protein is reduced or eliminated by the mutation of alg3. The filamentous fungal cell may be an Acremonium, Aspergillus, Aureobasidium, Cryptococcus, Chrysosporium, Chrysosporium lucknowense, Filibasidium, Fusarium, Gibberella, Humicola, Magnaporthe, Mucor, Myceliophthora, Myrothecium, Neocallimastix, Neurospora, Paecilomyces, Penicillium, Piromyces, Schizophyllum, Scytalidium, Talaromyces, Thermoascus, Thielavia, Tolypocladium, or Trichoderma cell. In certain embodiments, the filamentous fungal cell is a T. reesei cell. In certain embodiments, the filamentous fungal cell further contains one or more polynucleotides encoding any of the recombinant proteins of the invention. For example, the filamentous fungal cell may further contain a first polynucleotide encoding an N-acetylglucosaminyltransferase I catalytic domain and a second polynucleotide encoding an N-acetylglucosaminyltransferase II catalytic domain. Alternatively, the filamentous fungal cell may further contain a polynucleotide encoding a fusion protein including an N-acetylglucosaminyltransferase I catalytic domain and an N-acetylglucosaminyltransferase II catalytic domain.
[0185] In yet another aspect, the present invention provides methods of producing a Man.sub.3GlcNAc.sub.2 glycan in a host cell, including the steps of providing a host cell with a reduced level of activity of a mannosyltransferase compared to the level of activity in a wild-type host cell, and culturing the host cell to produce a Man.sub.3GlcNAc, glycan, where the Man.sub.3GlcNAc.sub.2 glycan makes up at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% (mol %) of the neutral N-glycans secreted by the host cell.
[0186] The Man.sub.3GlcNAc.sub.2 glycan may be attached to a molecule such as an amino acid, a peptide, or a polypeptide. In certain embodiments, the amino acid is an asparagine residue. The asparagine residue may be in aminoglycosidic linkage from the side-chain amide (a biologic mammalian protein N-glycan linkage structure) and may be part of a peptide chain such as a dipeptide, an oligopeptide, or a polypeptide. The glycan may be a reducing end derivative such as an N-, O-, or C-linked, preferably glycosidic, derivative of the reducing GlcNAc or Man, such as a spacer or terminal organic residue with a certain glycan-linked structure selected from the group of an amino acid, alkyl, heteroalkyl, acyl, alkyloxy, aryl, arylalkyl, and heteroarylalkyl. The spacer may be further linked to a polyvalent carrier or a solid phase. In certain embodiments, alkyl-containing structures include methyl, ethyl, propyl, and C4-C26 alkyls, lipids such as glycerolipids, phospholipids, dolichol-phospholipids and ceramides and derivatives. The reducing end may also be derivatized by reductive amination to a secondary amine linkage or a derivative structure. Certain carriers include biopoly- or oligomers such as (poly)peptides, poly(saccharides) such as dextran, cellulose, amylose, or glycosaminoglycans, and other organic polymers or oligomers such as plastics including polyethylene, polypropylene, polyamides (e.g., nylon or polystyrene), polyacrylamide, and polylactic acids, dendrimers such as PAMAM, Starburst or Starfish dendrimers, or polylysine, and polyalkylglycols such as polyethylene glycol (PEG). Solid phases may include microtiter wells, silica particles, glass, metal including steel, gold and silver, polymer beads such as polystyrene or resin beads, polylactic acid beads, polysaccharide beads or organic spacers containing magnetic beads.
[0187] In certain embodiments, the Man.sub.3GlcNAc.sub.2 glycan is attached to a heterologous polypeptide. In certain embodiments, the heterologous polypeptide is a therapeutic protein. Therapeutic proteins may include monoclonal antibodies, erythropoietins, interferons, growth hormones, enzymes, or blood-clotting factors and may be useful in the treatment of humans or animals. For example, the Man.sub.3GlcNAc.sub.2 glycan may be attached to a therapeutic protein such as rituximab. Typically, the Man.sub.3GlcNAc.sub.2glycan will be further modified to become a complex glycan. Such modification may take place in vivo in the host cell or by in vitro methods.
[0188] In certain embodiments, the mannosyltransferase is a dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase. Typically, the dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase enzyme is encoded by an alg3 gene. In certain embodiments, the host cell has a reduced level of expression of an alg3 gene compared to the level of expression in a wild-type host cell. In certain embodiments, the alg3 gene is deleted from the host cell. SEQ ID NOs: 97 and 98 provide the nucleic acid and amino acid sequences of the alg3 gene in T. reesei, respectively.
[0189] In certain embodiments, the level of activity of alpha-1,6-mannosyltransferase in the host cell is not reduced compared to the level of activity in a wild-type host cell. Typically, the alpha-1,6-mannosyltransferase enzyme is encoded by an och1 gene. In certain embodiments, the host cell contains an endogenous polynucleotide encoding an .alpha.-1,2-mannosidase.
[0190] In certain embodiments, the host cell is a Trichoderma cell, and in certain embodiments, the host cell is a Trichoderma reesei cell.
[0191] Filamentous Fungal Cells of the Invention
[0192] In a further aspect, the present invention provides filamentous fungal cells having a reduced level of expression of an alg3 gene of the invention, compared to the level of expression of the alg3 gene in a wild-type filamentous fungal cell, where the filamentous fungal cell also contains any of the recombinant proteins of the invention as described in the section entitled "Recombinant Proteins of the Invention.". For example, in certain embodiments the filamentous fungal cell further contains a polynucleotide encoding a fusion protein including an N-acetylglucosaminyltransferase I catalytic domain and an N-acetylglucosaminyltransferase II catalytic domain. The expression of the fusion protein may be controlled by a promoter that is operably linked to the polynucleotide. The promoter may be a constitutive promoter or an inducible promoter. In certain preferred embodiments, the promoter is an inducible promoter, such as the cbh1 inducible promoter.
[0193] In another aspect, the present invention provides filamentous fungal cells having a reduced level of expression of an alg3 gene of the invention, compared to the level of expression of the alg3 gene in a wild-type filamentous fungal cell, where the filamentous fungal cell also contains a first polynucleotide encoding a recombinant N-acetylglucosaminyltransferase I catalytic domain and a second polynucleotide encoding a recombinant N-acetylglucosaminyltransferase II catalytic domain. In such embodiments, the expression of the recombinant N-acetylglucosaminyltransferase I catalytic domain is controlled by a promoter that is operably linked to the first polynucleotide and the expression of the recombinant N-acetylglucosaminyltransferase II catalytic domain is controlled by a promoter that is operably linked to the second polynucleotide. The promoter may be a constitutive promoter or an inducible promoter. In certain preferred embodiments, the promoter is an inducible promoter, such as the cbh1 inducible promoter.
[0194] In other embodiments, a single polynucleotide may encode both the recombinant N-acetylglucosaminyltransferase I catalytic domain and the recombinant N-acetylglucosaminyltransferase II catalytic domain such that they are expressed as separate polypeptides. In such embodiments, the polynucleotide may contain an internal ribosome entry site that allows for the separate translation of each catalytic domain from the polynucleotide. In such embodiments, the expression of the recombinant N-acetylglucosaminyltransferase I catalytic domain is controlled by a promoter that is operably linked to the portion of the polynucleotide that encodes the N-acetylglucosaminyltransferase I catalytic domain and the expression of the recombinant N-acetylglucosaminyltransferase II catalytic domain is controlled by a promoter that is operably linked to the portion of the polynucleotide that encodes the N-acetylglucosaminyltransferase II catalytic domain. The promoter may be a constitutive promoter or an inducible promoter. In certain preferred embodiments, the promoter is an inducible promoter, such as the cbh1 inducible promoter.
[0195] As disclosed herein, N-acetylglucosaminyltransferase I (GlcNAc-TI; GnTI; EC 2.4.1.101) catalyzes the reaction UDP-N-acetyl-D-glucosamine+3-(alpha-D-mannosyl)-beta-D-mannosyl-R<=>- ;UDP+3-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl- -R, where R represents the remainder of the N-linked oligosaccharide in the glycan acceptor. An N-acetylglucosaminyltransferase I catalytic domain is any portion of an N-acetylglucosaminyltransferase I enzyme that is capable of catalyzing this reaction. Amino acid sequences for N-acetylglucosaminyltransferase I enzymes from various organisms are listed in SEQ ID NOs: 1-19. Additional GnTI enzymes are listed in the CAZy database in the glycosyltransferase family 13 (cazy.org/GT13_all). Enzymatically characterized species includes A. thaliana AAR78757.1 (U.S. Pat. No. 6,653,459), C. elegans AAD03023.1 (Chen S. et al J. Biol. Chem 1999; 274(1):288-97), D. melanogaster AAF57454.1 (Sarkar & Schachter Biol Chem. 2001 February; 382(2):209-17); C. griseus AAC52872.1 (Puthalakath H. et al J. Biol. Chem 1996 271(44):27818-22); H. sapiens AAA52563.1 (Kumar R. et al Proc Natl Acad Sci USA. 1990 December; 87(24):9948-52); M. auratus AAD04130.1 (Opat As et al Biochem J. 1998 Dec. 15; 336 (Pt 3):593-8), (including an example of deactivating mutant), Rabbit, O. cuniculus AAA31493.1 (Sarkar M et al. Proc Natl Acad Sci USA. 1991 Jan. 1; 88(1):234-8). Additional examples of characterized active enzymes can be found at cazy.org/GT13_characterized. The 3D structure of the catalytic domain of rabbit GnTI was defined by X-ray crystallography in Unligil U M et al. EMBO J. 2000 Oct. 16; 19(20):5269-80. The Protein Data Bank (PDB) structures for GnTI are 1FO8, 1FO9, 1FOA, 2AM3, 2AM4, 2AM5, and 2APC. In certain embodiments, the N-acetylglucosaminyltransferase I catalytic domain is from the human N-acetylglucosaminyltransferase I enzyme (SEQ ID NO: 1), or variants thereof. In certain embodiments, the N-acetylglucosaminyltransferase I catalytic domain contains a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to amino acid residues 84-445 of SEQ ID NO: 1. In some embodiments, a shorter sequence can be used as a catalytic domain (e.g. amino acid residues 105-445 of the human enzyme or amino acid residues 107-447 of the rabbit enzyme; Sarkar et al. (1998) Glycoconjugate J 15:193-197). Additional sequences that can be used as the GnTI catalytic domain include amino acid residues from about amino acid 30 to 445 of the human enzyme or any C-terminal stem domain starting between amino acid residue 30 to 105 and continuing to about amino acid 445 of the human enzyme, or corresponding homologous sequence of another GnTI or a catalytically active variant or mutant thereof. The catalytic domain may include N-terminal parts of the enzyme such as all or part of the stem domain, the transmembrane domain, or the cytoplasmic domain.
[0196] As disclosed herein, N-acetylglucosaminyltransferase II (GlcNAc-TII; GnTII; EC 2.4.1.143) catalyzes the reaction UDP-N-acetyl-D-glucosamine+6-(alpha-D-mannosyl)-beta-D-mannosyl-R<=>- ;UDP+6-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl- -R, where R represents the remainder of the N-linked oligosaccharide in the glycan acceptor. An N-acetylglucosaminyltransferase II catalytic domain is any portion of an N-acetylglucosaminyltransferase II enzyme that is capable of catalyzing this reaction. Amino acid sequences for N-acetylglucosaminyltransferase II enzymes from various organisms are listed in SEQ ID NOs: 20-33. In certain embodiments, the N-acetylglucosaminyltransferase II catalytic domain is from the human N-acetylglucosaminyltransferase II enzyme (SEQ ID NO: 20), or variants thereof. Additional GnTII species are listed in the CAZy database in the glycosyltransferase family 16 (cazy.org/GT16_all). Enzymatically characterized species include GnTII of C. elegans, D. melanogaster, Homo sapiens, Rattus norvegigus, Sus scrofa (cazy.org/GT16_characterized). In certain embodiments, the N-acetylglucosaminyltransferase II catalytic domain contains a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to amino acid residues from about 30 to about 447 of SEQ ID NO: 21. The catalytic domain may include N-terminal parts of the enzyme such as all or part of the stem domain, the transmembrane domain, or the cytoplasmic domain.
[0197] In embodiments where the filamentous fungal cell contains a fusion protein of the invention, the fusion protein may further contain a spacer in between the N-acetylglucosaminyltransferase I catalytic domain and the N-acetylglucosaminyltransferase II catalytic domain. Any of the spacers of the invention as described in the section entitled "Spacers" may be used. In certain preferred embodiments, the spacer is an EGIV spacer, a 2.times.G4S spacer, a 3.times.G4S spacer, or a CBHI spacer. In other embodiments, the spacer contains a sequence from a stem domain.
[0198] For ER/Golgi expression the N-acetylglucosaminyltransferase I and/or N-acetylglucosaminyltransferase II catalytic domain is typically fused with a targeting peptide or a part of an ER or early Golgi protein, or expressed with an endogenous ER targeting structures of an animal or plant N-acetylglucosaminyltransferase enzyme. In certain preferred embodiments, the N-acetylglucosaminyltransferase I and/or N-acetylglucosaminyltransferase II catalytic domain contains any of the targeting peptides of the invention as described in the section entitled "Targeting peptides." Preferably, the targeting peptide is linked to the N-terminal end of the catalytic domain. In some embodiments, the targeting peptide contains any of the stem domains of the invention as described in the section entitled "Targeting peptides." In certain preferred embodiments, the targeting peptide is a Kre2 targeting peptide. In other embodiments, the targeting peptide further contains a transmembrane domain linked to the N-terminal end of the stem domain or a cytoplasmic domain linked to the N-terminal end of the stem domain. In embodiments where the targeting peptide further contains a transmembrane domain, the targeting peptide may further contain a cytoplasmic domain linked to the N-terminal end of the transmembrane domain.
[0199] The level of expression of an alg3 gene of the invention may be reduced by any suitable method known in the art, including, without limitation, mutating the alg3 gene. The alg3 may be mutated by, for example, point mutations or deletion of the entire alg3 gene. Preferably, the function of the alg3 protein is reduced or eliminated by the mutation of alg3. The alg3 gene encodes a dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl alpha-1,3-mannosyltransferase. As disclosed herein, a dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase of the invention transfers an alpha-D-mannosyl residue from dolichyl-phosphate D-mannose into a membrane lipid-linked oligosaccharide.
[0200] In certain embodiments, the filamentous fungal cell may contain a polynucleotide encoding a UDP-GlcNAc transporter. The polynucleotide encoding the UDP-GlcNAc transporter may be endogenous (i.e., naturally present) in the filamentous fungal cell, or it may be heterologous to the filamentous fungal cell.
[0201] In other embodiments, the filamentous fungal cell may also contain a polynucleotide encoding a .alpha.-1,2-mannosidase of the invention as described in the section entitled "Host Cells." The polynucleotide encoding the .alpha.-1,2-mannosidase may be endogenous in the filamentous fungal cell, or it may be heterologous to the filamentous fungal cell. These polynucleotides are especially useful for a filamentous fungal cell expressing high-mannose glycans transferred from the Golgi to the ER without effective exo-.alpha.-2-mannosidase cleavage. For cytoplasmic expression the catalytic domain of the mannosidase is typically fused with a targeting peptide, such as HDEL, KDEL, or part of an ER or early Golgi protein, or expressed with an endogenous ER targeting structures of an animal or plant mannosidase I enzyme.
[0202] In further embodiments, the filamentous fungal cell may also contain a polynucleotide encoding a galactosyltransferase of the invention as described in the section entitled "Host Cells." Galactosyltransferases transfer .beta.-linked galactosyl residues to terminal N-acetylglucosaminyl residue. In certain embodiments the galactosyltransferase is a .beta.-4-galactosyltransferase. The galactosyltransferase may be expressed in the cytoplasm of the filamentous fungal. A heterologous targeting peptide, such as a Kre2 peptide described in Schwientek J. Biol. Chem 1996 3398, may be used. Promoters that may be used for expression of the galactosyltransferase include constitutive promoters such as gpd, promoters of endogenous glycosylation enzymes and glycosyltransferases such as mannosyltransferases that synthesize N-glycans in the Golgi or ER, and inducible promoters of high-yield endogenous proteins such as the cbh1 promoter. In embodiments of the invention where the host cell contains a polynucleotide encoding a galactosyltransferase, the host cell also contains a polynucleotide encoding a UDP-Gal and/or UDP-Gal transporter. In certain embodiments of the invention where the filamentous fungal cell contains a polynucleotide encoding a galactosyltransferase, lactose may be used as the carbon source instead of glucose when culturing the filamentous fungal cell. The culture medium may be between pH 4.5 and 7.0 or between 5.0 and 6.5. In certain embodiments of the invention where the filamentous fungal cell contains a polynucleotide encoding a galactosyltransferase and a polynucleotide encoding a UDP-Gal and/or UDP-Gal transporter, a divalent cation such as Mn2+, Ca2+ or Mg2+ may be added to the cell culture medium.
[0203] In other embodiments, the filamentous fungal cell may also contain a polynucleotide encoding a sialyltransferase of the invention as described in the section entitled "Host Cells.". A sialyltransferase transfers .alpha.3- or .alpha.6-linked sialic acid, such as Neu5Ac, to the terminal Gal of galactosylated complex glycans. The polynucleotide encoding the .alpha.3- or .alpha.6-linked sialyltransferase may be endogenous to the filamentous fungal cell, or it may be heterologous to the filamentous fungal cell. Sialylation in the filamentous fungal cell may require expression of enzymes synthesizing the donor CMP-sialic acid such as CMP-Neu5Ac, especially in fungal, plant, nematode/parasite, or insect cells.
[0204] Additionally, the filamentous fungal cell may have increased or reduced levels of activity of various additional endogenous enzymes. A reduced level of activity may be provided by inhibiting the activity of the endogenous enzyme with an inhibitor, an antibody, or the like. In certain embodiments, the filamentous fungal cell is genetically modified in ways to increase or reduce activity of one or more endogenous enzymes. Methods of genetically modifying a filamentous fungal cell to increase or reduce activity of one or more endogenous enzymes are well known in the art and include, without limitation, those described in the section entitled "Host Cells." In certain embodiments, the filamentous fungal cell has a reduced level of activity of a alpha-1,6-mannosyltransferase compared to the level of activity in a wild-type filamentous fungal cell. Alpha-1,6-mannosyltransferase (EC 2.4.1.232) in the Golgi apparatus transfers an elongation initiating alpha-D-mannosyl residue from GDP-mannose into a protein-linked N-glycan oligosaccharide, forming an alpha-(1.fwdarw.6)-D-mannosyl-D-mannose linkage. Typically, the alpha-1,6-mannosyltransferase enzyme is encoded by an och1 gene. In certain embodiments, the filamentous fungal cell has a reduced level of expression of an och1 gene compared to the level of expression in a wild-type filamentous fungal cell. In certain embodiments, the och1 gene is deleted from the filamentous fungal cell.
[0205] The filamentous fungal cell may be, for example, an Acremonium, Aspergillus, Aureobasidium, Cryptococcus, Chrysosporium, Chrysosporium lucknowense, Filibasidium, Fusarium, Gibberella, Humicola, Magnaporthe, Mucor, Myceliophthora, Myrothecium, Neocallimastix, Neurospora, Paecilomyces, Penicillium, Piromyces, Schizophyllum, Scytalidium, Talaromyces, Thermoascus, Thielavia, Tolypocladium, or Trichoderma cell. In certain embodiments, the filamentous fungal cell is a T. reesei cell.
[0206] Pharmaceutical Compositions Containing Complex N-Glycans Produced by the Methods of the Invention
[0207] In another aspect, the present invention provides a composition, e.g., a pharmaceutical composition, containing one or more complex N-glycans attached to a heterologous molecule produced by the methods of the invention, formulated together with a pharmaceutically acceptable carrier. Pharmaceutical compositions of the invention also can be administered in combination therapy, i.e., combined with other agents. For example, the combination therapy can include an complex N-glycans attached to a heterologous molecule according to the present invention combined with at least one other therapeutic agent.
[0208] As used herein, "pharmaceutically acceptable carrier" includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. Preferably, the carrier is suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g., by injection or infusion). Depending on the route of administration, the active compound, i.e., the complex N-glycan attached to a heterologous molecule according to the invention, may be coated in a material to protect the compound from the action of acids and other natural conditions that may inactivate the compound.
[0209] The pharmaceutical compositions of the invention may include one or more pharmaceutically acceptable salts. A "pharmaceutically acceptable salt" refers to a salt that retains the desired biological activity of the parent compound and does not impart any undesired toxicological effects (see e.g., Berge, S. M., et al. (1977) J. Pharm. Sci. 66:1-19). Examples of such salts include acid addition salts and base addition salts. Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like, as well as from nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like. Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium and the like, as well as from nontoxic organic amines, such as N,N'-dibenzylethylenediamine, N-methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like.
[0210] A pharmaceutical composition of the invention also may include a pharmaceutically acceptable antioxidant. Examples of pharmaceutically acceptable antioxidants include: (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
[0211] Examples of suitable aqueous and nonaqueous carriers that may be employed in the pharmaceutical compositions of the invention include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate. Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
[0212] These compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures, and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin.
[0213] Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. The use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions of the invention is contemplated. Supplementary active compounds can also be incorporated into the compositions.
[0214] Therapeutic compositions typically must be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition. Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
[0215] Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the certain methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
[0216] The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will vary depending upon the subject being treated, and the particular mode of administration. The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of the composition which produces a therapeutic effect. Generally, out of one hundred percent, this amount will range from about 0.01 percent to about ninety-nine percent of active ingredient, preferably from about 0.1 percent to about 70 percent, most preferably from about 1 percent to about 30 percent of active ingredient in combination with a pharmaceutically acceptable carrier.
[0217] Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
[0218] For administration of the complex N-glycan attached to a heterologous molecule, in particular where the heterologous molecule is an antibody, the dosage ranges from about 0.0001 to 100 mg/kg, and more usually 0.01 to 5 mg/kg, of the host body weight. For example, dosages can be 0.3 mg/kg body weight, 1 mg/kg body weight, 3 mg/kg body weight, 5 mg/kg body weight or 10 mg/kg body weight or within the range of 1-10 mg/kg. An exemplary treatment regime entails administration once per week, once every two weeks, once every three weeks, once every four weeks, once a month, once every 3 months or once every three to 6 months. Certain dosage regimens for a complex N-glycan attached to a heterologous antibody include 1 mg/kg body weight or 3 mg/kg body weight via intravenous administration, with the antibody being given using one of the following dosing schedules: (i) every four weeks for six dosages, then every three months; (ii) every three weeks; (iii) 3 mg/kg body weight once followed by 1 mg/kg body weight every three weeks.
[0219] Alternatively a complex N-glycan attached to a heterologous molecule according to the invention can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half-life of the administered substance in the patient. In general, human antibodies show the longest half life, followed by humanized antibodies, chimeric antibodies, and nonhuman antibodies. The dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, a relatively low dosage is administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives. In therapeutic applications, a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, the patient can be administered a prophylactic regime.
[0220] Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient. The selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
[0221] A "therapeutically effective dosage" of immunoglobulin of the invention preferably results in a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction. For example, for the treatment of tumors, a "therapeutically effective dosage" preferably inhibits cell growth or tumor growth by at least about 20%, more preferably by at least about 40%, even more preferably by at least about 60%, and still more preferably by at least about 80% relative to untreated subjects. The ability of a compound to inhibit tumor growth can be evaluated in an animal model system predictive of efficacy in human tumors. Alternatively, this property of a composition can be evaluated by examining the ability of the compound to inhibit, such inhibition in vitro by assays known to the skilled practitioner. A therapeutically effective amount of a therapeutic compound can decrease tumor size, or otherwise ameliorate symptoms in a subject. One of ordinary skill in the art would be able to determine such amounts based on such factors as the subject's size, the severity of the subject's symptoms, and the particular composition or route of administration selected.
[0222] A composition of the present invention can be administered via one or more routes of administration using one or more of a variety of methods known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results. Certain routes of administration for binding moieties of the invention include intravenous, intramuscular, intradermal, intraperitoneal, subcutaneous, spinal or other parenteral routes of administration, for example by injection or infusion. The phrase "parenteral administration" as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion.
[0223] Alternatively, a complex N-glycan attached to a heterologous molecule according to the invention can be administered via a nonparenteral route, such as a topical, epidermal or mucosal route of administration, for example, intranasally, orally, vaginally, rectally, sublingually or topically.
[0224] The active compounds can be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
[0225] Therapeutic compositions can be administered with medical devices known in the art. For example, in a certain embodiment, a therapeutic composition of the invention can be administered with a needleless hypodermic injection device, such as the devices disclosed in U.S. Pat. Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556. Examples of well-known implants and modules useful in the present invention include: U.S. Patent No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Pat. No. 4,486,194, which discloses a therapeutic device for administering medicants through the skin; U.S. Pat. No. 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; U.S. Pat. No. 4,447,224, which discloses a variable flow implantable infusion apparatus for continuous drug delivery; U.S. Pat. No. 4,439,196, which discloses an osmotic drug delivery system having multi-chamber compartments; and U.S. Pat. No. 4,475,196, which discloses an osmotic drug delivery system.
[0226] In certain embodiments, the use of the complex N-glycan attached to a heterologous molecule according to the invention is for the treatment of any disease that may be treated with therapeutic antibodies.
[0227] It is to be understood that, while the invention has been described in conjunction with the certain specific embodiments thereof, the foregoing description is intended to illustrate and not limit the scope of the invention. Other aspects, advantages, and modifications within the scope of the invention will be apparent to those skilled in the art to which the invention pertains.
[0228] The invention having been described, the following examples are offered to illustrate the subject invention by way of illustration, not by way of limitation.
EXAMPLES
Example 1
Host Strain Selection for Glycoengineering
[0229] The aim of this example was to identify optimal T. reesei strains for glycoengineering. An optimal strain produces high amounts of Man5 N-glycans and low amounts of acidic glycans.
[0230] Samples
[0231] Different T. reesei strains including M44 (VTT-D-00775; Selinheimo et al., FEBS J. 2006, 273(18): 4322-35), M81, M84, M109, M110, M131, M132, M133, M134 and M124 (a mus53-deleted strain of M44) were analyzed. Each of the ten strains was grown in shake flask cultures. Samples were taken at three different time points: 3 days, 5 days, and 7 days. Both supernatants (secreted proteins) and cell pellets were collected and stored frozen at -20.degree. C. until glycan analysis was conducted.
[0232] N-glycans were isolated from secreted proteins from the indicated time points followed by matrix-assisted laser desorption/ionization-time-of-flight (MALDI-TOF) glycan profiling. Cell pellets from the 5 days time point were subjected to N-glycan profiling. A total of 80 samples (30 each of neutral- and acidic supernatant fractions, and 10 each of neutral- and acidic pellet fractions) were subjected to analysis.
[0233] Strain M44 was also subjected to batch and fed-batch fermentor cultivation in order to assess the difference on glycan profile between shake flask and fermentor culture. For glycan analysis, samples from three different time points were analyzed for a total of 12 samples (6 neutral and 6 acidic fractions). As a control, culture medium was analyzed.
[0234] Mass Spectrometry Methods
[0235] MALDI-TOF mass spectrometry was performed with a Bruker Ultraflex TOF/TOF instrument (Bruker Daltonics, Germany). Neutral N-glycans were detected in positive ion reflector mode as [M+Na].sup.- ions, and acidic N-glycans were detected in negative ion linear mode as [M-H].sup.- ions. The relative molar abundance of neutral N-glycan components was assigned based on their relative signal intensities in the spectra. The resulting glycan signals in the presented glycan profiles were normalized to 100% to allow comparison between samples.
[0236] Protein-Specific Glycosylation Methods
[0237] Proteins from a fermentor-cultured sample were separated with SDS-PAGE and blotted to a PVDF membrane. The protein bands of interest were excised, and N-glycans were liberated by enzymatic release with PNGase F.
[0238] Neutral N-glycan Profile of T. Reesei Strains
[0239] The desired Man5 structure can be observed as a [M+Na].sup.+ signal at m/z value of 1257.4 in the mass spectra presented in FIG. 1. The neutral glycome of the analyzed T. reesei strains were found to have either Man5 or Man8 as the main neutral glycan species (H5N2 and H8N2 in Table 2).
TABLE-US-00002 TABLE 2 The percentage of different neutral N-glycan signals of analyzed T. reesei strains. Strain M44 M81 M84 M109 M110 M131 M132 M133 M134 M124 Composition m/z % % % % % % % % % % H3N2 933 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 H4N2 1095 1.2 0.0 0.0 1.8 0.9 0.0 2.3 0.0 2.3 4.1 H5N2 1257 81.0 70.8 4.0 78.9 5.8 78.8 84.1 10.7 73.2 77.9 H6N2 1419 5.8 5.3 0.0 5.3 0.9 4.8 4.6 0.9 6.0 7.3 H7N2 1581 4.8 7.3 1.5 4.7 3.0 4.8 3.9 3.8 5.8 4.8 H8N2 1743 3.7 8.6 81.5 5.1 68.2 5.9 2.6 68.1 6.3 3.3 H9N2 1905 2.9 8.0 9.0 3.4 16.0 4.6 2.0 12.8 5.7 2.3 H10N2 2067 0.5 0.0 2.5 0.8 3.7 1.1 0.4 2.5 0.7 0.4 H11N2 2229 0.0 0.0 1.5 0.0 1.4 0.0 0.0 1.2 0.0 0.0 H12N2 2391 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
[0240] Some acidic N-glycans were observed in neutral N-glycan fractions. This may have been due to specific properties of the phosphorylated glycans, e.g. presence of phosphodiester structures, or other properties of the phosphoglycans which could lead to leakage of acidic species to neutral fraction under the experimental conditions used in this study. To check the corresponding structure, the signal of interest was subjected to MS/MS analysis. Mass spectrometric fragmentation of glycans was performed using Bruker Ultraflex TOF/TOF in MS/MS analysis mode (FIG. 2). Because the glycans were not permethylated, definitive structural assignment based on the MS/MS data could not be obtained.
[0241] Acidic N-glycan Profiles of T. Reesei Strains
[0242] For glycoengineering purposes it was useful to have strains with a minimum amount of acidic N-glycans. Therefore, acidic N-glycan profiles were analyzed from the strains used for screening. The acidic N-glycan spectra of analyzed strains are shown in FIG. 3 and below in Table 3.
TABLE-US-00003 TABLE 3 The percentage of different acidic N-glycan signals of analyzed T. reesei strains. M44 M81 M84 M109 M110 M131 M1132 M133 M134 M124 m/z % % 9/0 % % % % % % % Hex3HexNAc2SP 989 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Hex4HexNAc2SP 1151 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Hex5flexNAc2SP 1313 4.0 5.2 0.0 3.7 0.0 2.8 7.4 0.0 5.2 2.8 Hex5HexNAc2SP2 1393 0.0 0.0 0.0 0.7 0.0 0.0 0.0 0.0 0.9 0.0 Hex6HexNAc2SP 1475 23.7 27.3 2.2 18.1 2.1 22.4 21.0 3.9 24.9 26.3 Hex6HexNAc2SP2 1555 0.0 2.8 0.0 2.4 0.0 3.2 1.1 0.0 3.6 1.7 Hex7HexNAc2SP 1637 30.3 18.8 1.1 16.2 2.0 14.9 24.7 0.0 17.2 23.3 Hex7HexNAc2SP2 1717 0.0 7.7 0.0 8.6 0.0 10.7 2.5 0.0 10.4 7.0 Hex8HexNAc2SP 1799 18.4 11.8 17.9 12.8 9.7 9.1 19.7 14.5 8.8 11.2 Hex8HexNAc2SP2 1879 5.1 8.8 0.0 11.0 0.0 14.8 4.0 0.0 12.4 10.0 Hex9HexNAc2SP 1961 7.3 6.4 49.1 9.5 37.9 5.9 6.1 53.9 4.1 3.5 Hex9HexNAc2SP2 2041 4.2 5.0 0.0 5.7 0.0 7.3 5.1 0.0 5.9 7.2 Hex10HexNAc2SP 2123 2.8 2.9 19.7 4.5 28.1 2.6 2.3 19.3 2.1 1.6 Hex10HexNAc2SP2 2203 2.8 2.1 0.0 2.2 0.0 2.7 3.6 0.0 1.9 3.3 Hex11HexNAc2SP 2285 1.5 1.3 3.7 2.1 9.5 1.2 0.9 5.0 1.0 0.8 Hex11HexNAc2SP2 2365 0.0 0.0 0.0 0.9 0.0 1.3 1.5 0.0 0.8 1.3 Hex12HexNAc2SP 2447 0.0 0.0 1.3 1.0 1.6 1.0 0.0 0.0 0.5 0.0 Hex12HexNAc2SP2 2527 0.0 0.0 0.0 0.4 0.0 0.0 0.0 0.0 0.3 0.0 Hex13HexNAc2SP 2609 0.0 0.0 1.2 0.4 1.1 0.0 0.0 0.0 0.0 0.0 Hex14HexNAc2SP 2771 0.0 0.0 0.6 0.0 0.9 0.0 0.0 0.0 0.0 0.0
[0243] N-glycan Profile from Fermentor Cultured Strain M44
[0244] Strain M44 was cultivated in a fermentor in order to find out if different culture conditions can cause changes in its glycan profile. N-glycan analysis was performed for samples cultured in a fermentor (Batch; 41:10, 88:45 and 112:50 hours, and Fed batch; 45:50, 131:40 and 217:20 hours) and compared to that of shake flask culture. Neutral and acidic N-glycans of secreted proteins of T. reesei strain M44 cultured in fermentor are shown in FIG. 4. Comparison between the N-glycan percentages from flask and fermentor cultures is presented below in Table 4.
TABLE-US-00004 TABLE 4 The percentage of N-glycan signals of T. reesei strain M44 cultured in flask and in fermentor. Composition m/z flask % fermentor % H3N2 933 0.0 0.0 H4N2 1095 1.2 0.0 H5N2 1257 81.0 91.3 H6N2 1419 5.8 4.5 H7N2 1581 4.8 4.2 H8N2 1743 3.7 0.0 H9N2 1905 2.9 0.0 H10N2 2067 0.5 0.0 H11N2 2229 0.0 0.0 H12N2 2391 0.0 0.0
[0245] N-glycan Analysis of Shake Flask Culture Medium
[0246] As a control experiment, culture medium (without contact with fungus) of T. reesei was analyzed. FIG. 5a shows neutral N-glycan analysis in which no N-glycans were observed. Only minor signals of hexose oligomers, most likely derived from the plant material used in the medium, were visible above the baseline. In FIG. 5b (acidic glycans), no signals corresponding to N-glycans were observed.
[0247] N-glycosylation of Secreted Proteins
[0248] To check whether there is variation in glycosylation between individual secreted proteins, the samples from fermentation culture supernatants were separated with SDS-PAGE and blotted to PVDF membrane. The N-glycans of selected bands were then detached with on-membrane enzymatic release. Results are shown in FIGS. 6 and 7.
[0249] Conclusions: Neutral Glycans
[0250] The purpose of this study was to identify T. reesei strains for glycoengineering with the highest amount of Man5 N-glycans and the lowest amount of acidic glycans. Strains which have Man5 as a main peak in mass spectrometry analysis can have higher endogenous .alpha.-1,2-mannosidase activity. Based on the background information on T. reesei N-glycosylation, the likely structure for Man5 is Man.alpha.3[Man.alpha.3(Man.alpha.6)Man.alpha.6]Man.beta.4GlcNAc.beta.4Gl- cNAc (Salovuori et al. 1987; Stals et al. Glycobiology 14, 2004, page 725).
[0251] Some strains contained H8N2 as a major neutral glycoform. Based on the literature, this glycoform is most likely to be a Glc.alpha.3Man.alpha.2Man.alpha.2Man5 structure (Stals et al. Glycobiology 14, 2004, page 725). It is possible that glucosidase deficiency in these strains prevents the trimming of the glycans to the smaller glycoforms.
[0252] In some strains, acidic N-glycans were observed in neutral spectra. This situation may have been due to a higher proportion of acidic N-glycans or to leakage of specific structures into the neutral fraction during the separation of neutral glycans from acidic glycans.
[0253] The glycan profile of strains was a bit more favorable for glycoengineering when cultivated in a fermentor compared to in shake flasks. The glycosylation of individual proteins from fermentor-cultured samples didn't differ significantly from average glycosylation. All analyzed proteins contained Man5 as a main glycoform. This observation suggested that all secreted proteins go through similar glycan processing. Thus it appeared that the majority of secreted proteins were glycosylated similarly by the T. reesei host cells, which is not always the case with mammalian cells.
[0254] Acidic Glycans
[0255] The phosphorylation of N-glycan is not generally desired for glycoengineering because the terminal phosphate residue is not present in regular therapeutic proteins, including antibodies. Some exceptions to this rule are a few specialized proteins used for lysosomal glycosylation storage disorders. Phosphorylation of N-glycans may be protein-specific in fungi. In animals, mannose phosphorylation is a conserved lysosomal targeting signal.
[0256] To date there have been no reports of sulfation of T. reesei N-glycans. Therefore, the acidic structures referred to in this report were likely to be phosphorylated glycans.
[0257] Phosphorylation is more common when T. reesei is cultivated in low pH values, as is the case in flask cultures, which may be related to low pH stress and mycelia breakage (Stals et al., 2004, Glycobiology 14:713-724). In this study a clear difference was observed between flask and fermentor cultured samples. Acidic N-glycans, all phosphorylated, were observed in shake flask culture samples. The amount of acidic N-glycans in fermentor samples may have been below the detection limit, or, because of higher pH there may have been no significant phosphorylation of glycans. The proportion of acidic N-glycans to the total amount of N-glycans could not be verified with the method used in this study due to the different ionization efficiencies between neutral and acidic glycan species.
[0258] In order to determine phosphorylation levels, N-glycans were released by N-glycanase from 10 .mu.g of T. reesei secreted protein cultured in batch and fed batch fermentor. Protein concentration was measured using a Bradford-based method with BSA as a standard. One pmol of standard molecule NeuAcHex4HexNAc2 was added to acidic N-glycans samples prior to MALDI-TOF analysis. Amounts of major glycoforms (Hex7HexNAc2P for fermentor and Hex6-8HexNAc2P for flask culture) were 0.9 pmol/10 .mu.g of secreted protein of batch culture, 0.6 pmol/10 .mu.g of secreted protein of fed batch culture, and 160 pmol/10 .mu.g of secreted protein of flask culture when the pH of the culture was allowed to drop. The amount of neutral N-glycans was measured using 10 pmol of standard glycan Hex2HexNAc4 added to neutral N-glycan samples, prior to MALDI-TOF analysis. The amount of major glycoform Hex5HexNAc2 was 87 pmol/10 .mu.g of secreted protein in batch and fed-batch cultures and 145 pmol/10 .mu.g of secreted protein in flask culture. Thus, the proportion of acidic N-glycans to total amount of N-glycans was 1% in batch culture, 0.7% in fed-batch culture and 52% in flask culture. Quantitation was based only on signal intensity comparison using MALDI-TOF data.
[0259] N-glycans were also larger in acidic fraction. This may have been due to phospho-mannosylation reactions in which phosphorus with one hexose unit is attached to a glycan backbone. Some diphosphorylated structures were seen in acidic spectra. This explanation is in agreement with the previously published data on phosphorylated glycans found in T. reesei (Stals et al. 2004, Glycobiology 14:725-737). When cultured in a fermentor, the proportion of acidic N-glycans was very low, below the detection limit.
[0260] The N-glycan spectra of T. reesei culture media did not reveal contamination of the T. reesei N-glycome with glycans derived from plant material containing medium.
[0261] In conclusion, N-glycan analysis of different T. reesei strains revealed that the major glycoform in strains M44, M109, M131, M132 and M124 is Man5 or Man.alpha.3[Man.alpha.3(Man.alpha.6)Man.alpha.6]Man.beta.4GlcNAc.beta.4Gl- cNAc. The possible presence of glucose, including H8N2 as a minor component in Man5-producing strains was considered. Two strains (M109 and M131) contained a larger amount of H8N2 than H7N2. The enrichment of H8N2 could have indicated partial glucosidase deficiency.
[0262] Strain M44 contained almost no phosphorylated glycans. Leaking acidic glycans observed in neutral glycan fraction as signals at m/z 1521 and m/z 1683 were observed in samples from strains M131, M109, M132 and M124, which indicated higher phosphorylation levels and the presence of potential phosphodiester structures.
[0263] The aim of this study was to find a strain with maximal production of Man5Gn2 structure and low-level production of acidic (phosphorylated) N-glycans. The best strains had over 80% of Man5 under pH-controlled shake flask culture conditions. The best strains also had reduced production of di-phosphorylated glycans and/or larger phosphorylated structures (see Table 3).
Example 2
Generation of an Alg3-Deficient Trichoderma Strain
[0264] Vector Construction and Strain Generation
[0265] The gene encoding the ALG3 mannosyltransferase was identified in the Trichoderma reesei genome sequence. A disruption construct was designed to insert the acetamidase selection marker between 1000 bp 5' and 3' flanking region fragments of the alg3 gene. The flanking region fragments were amplified by PCR, and the construct was made by homologous recombination cloning in Saccharomyces cerevisiae. The disruption cassette was released from its backbone vector by digestion and transformed into the T. reesei strain M124. Transformants were selected on acetamidase medium and screened by PCR with a forward primer outside the 5' flanking region fragment of the construct and the reverse primer inside the AmdS selection marker.
[0266] Screening of Transformants
[0267] Fifty-eight out of 62 screened transformants gave a PCR product of the size expected for integration of the construct to the alg3 locus. Nine PCR-positive transformants were purified to uninuclear clones through single spore cultures, and spore suspensions were made from them. These nine clones were analyzed for the correct integration of the disruption cassette by Southern hybridization. EcoRI-digested genomic DNA from the parental strain and from nine clones was hybridized with an alg3 probe under standard hybridization conditions. The probe hybridized with DNA from the parental strain, but not with DNA from any of the clones, indicating successful deletion of alg3 (FIG. 8).
[0268] Further analysis was made by Southern hybridization with an AmdS probe. The AmdS gene was included in the deletion cassette and was predicted to be detectable in DNA from the transformants, but not in DNA from the parental strain. Genomic DNA of parental strain M124 and nine transformants was digested with EcoRI+PvuI (E+P) and KpnI+NheI (K+N). NotI digested plasmid carrying the alg3-AmdS deletion cassette was used as a positive control. The probe recognized the expected .about.2.7 kb fragment (AmdS) from the positive control but did not hybridize with the parental strain. All transformants gave the expected signals (1.6+2.8 kb for E+P and 1.7+3.4 kb for K+N, shown with arrows in FIG. 9B) indicating correct integration of the deletion cassette. Clones 11A and 15A also showed hybridization of some additional fragments suggesting unspecific integration of the deletion cassette to the genome (FIG. 9B).
[0269] N-glycan Analytics
[0270] Shake-flask cultures of five different Alg3 knockout strains (4A, 5A, 6A, 10A and 16A) and parental strain M124 were analyzed for N-glycans. Samples were collected from time points of 3, 5, 7, and 9 days. All cultures were grown as duplicates.
[0271] The protein concentration of secreted proteins from a randomly selected knockout strain (4A) from all time points was measured using a Bradford-based assay against a BSA standard curve. The highest protein concentration was detected on day 5. Therefore, day 5 samples were used for N-glycan analysis for all five knockout strains. All samples, including the duplicate cultures, were analyzed as triplicates. Ten .mu.g was used for N-glycan analysis. Both neutral and acidic N-glycans were analyzed by MALDI-TOF.
[0272] The major glycoform in parental strain M124 was Man5Gn2. In all Alg3 knockout strains the major glycoform was Man3 (FIG. 10). No Man3 was found in the parental strain M124. In different Alg3 knockout strains the amount of Man3 ranged between 49.7%-55.2% in the shake-flask cultures allowing pH drop. Hex6Gn2 was increased in the parental strain. Signal intensities as percentages of observed neutral N-glycan signals are presented in Table 5 below.
TABLE-US-00005 TABLE 5 Neutral N-glycan content of Alg3 knockout strains. Strain Parental M124 4A 5A 6A 10A 16A Composition m\z Average STDEV Average STDEV Average STDEV Average STDEV Average STDEV Average STDEV Hex3HexNAc2 933.31 0.0 0.0 53.6 0.2 55.2 4.2 49.7 0.5 53.3 0.9 53.4 0.9 Hex4HexNAc2 1095.37 1.6 0.1 2.7 0.0 2.9 0.7 3.4 0.1 3.2 0.4 3.4 0.4 Hex5HexNAc2 1257.42 70.2 3.3 8.5 0.2 7.3 1.1 10.4 0.5 8.6 0.9 9.7 0.9 Hex6HexNAc2 1419.48 7.9 1.1 35.0 0.3 84.4 1.9 36.1 0.6 34.9 0.5 33.2 0.7 Hex7HexNAc2 1581.53 7.8 0.6 0.3 0.4 0.3 0.4 0.3 0.4 0.0 0.0 0.3 0.4 Hex8HexNAc2 1743.58 5.9 0.7 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Hex9HexNAc2 1905.63 6.0 0.9 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Hex10HexNAc2 2067.69 0.7 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0
[0273] The presence of different isomers of each glycoform cannot be observed by MALDI MS analysis, so further tandem mass spectrometry studies were performed. First, the Man3 and Hex5Gn2 structures were investigated. For Man3 it was asked whether the Man3 structure is branched or linear. For this analysis, a sample containing both these structures was permethylated and analyzed with mass spectrometric fragmentation using the Bruker Ultraflex III TOF/TOF instrument according to the manufacturer's instructions (FIGS. 11 and 12).
[0274] Next, it was determined whether the hexose unit on the non-reducing end of the Hex6Gn2 structure is a mannose or a glucose. Alpha-mannosidase digestion was performed on all knockout strains and the parental strain (FIG. 13). Jack bean mannosidase, which cleaves .alpha.-mannoses and leaves the .beta.-mannose from backbone untouched, was used. The resulting structure was expected to be Man1Gn2.
[0275] Due to low molecular weight range effects in MALDI, the relative intensity of the Man1GlcNAc2 glycan may have been somewhat reduced, which explained a small increase in the relative amount of Hex6. After .alpha.-mannosidase digestion, Man3 and Man4 glycoforms disappeared. No Man2 structure was observed. However, Hex6 (m/z 1419) was not digested (Table 6) indicating that there was a glucose unit on the non-reducing end of the structure. Some non-digestible Hex5 was also present, likely produced by a weak reaction removing the sterically hindered Man6-branch of Hex6.
TABLE-US-00006 TABLE 6 Neutral N-glycans of Alg3 knockout strain 4A before (native) and after .alpha.- mannosidase digestion. 4A Native a-Man'ase Composition m/z Average % Hex1HexNAc2 609.21 0.0 53.2 Hex2HexNAc2 771.26 0.0 0.0 Hex3HexNAc2 933.31 47.5 0.0 Hex4HexNAc2 1095.37 3.8 0.0 Hex5HexNAc2 1257.42 11.7 5.0 Hex6HexNAc2 1419.48 36.8 41.0 Hex7HexNAc2 1581.53 0.2 0.8 Hex8HexNAc2 1743.58 0.0 0.0 Hex9HexNAc2 1905.63 0.0 0.0 Hex10HexNAc2 2067.69 0.0 0.0
[0276] For the final analysis of different structures found in the Alg3 knockout strains, a large-scale PNGase F digestion was performed to Alg3 knockout strain 4A. Two major glycans were purified with HPLC (FIG. 14) and analyzed by NMR (FIG. 15).
[0277] Based on the data presented in FIG. 15A, the Hex3HexNAc2 species was unambiguously identified as Man.alpha.1-3(Man.alpha.1-6)Man.beta.1-4GlcNAc.beta.1-4GlcNAc. The Man.alpha.3 and Man.alpha.6 H-1 units resonated at 5.105 and 4.914 ppm, respectively. The Man.beta.4 H-2 unit was observed at 4.245 ppm. This signal was very characteristic, due to the neighboring Man.alpha.3-OH substitution. The N-acetyl group --CH3 signals of the core GlcNAc units were observed at 2.038 and 2.075. These values agreed well with those reported for this pentasaccharide in the Sugabase-database (www.boc.chem.uu.nl/sugabase/sugabase.html). Moreover, the proton-NMR spectrum was measured for a commercially produced Man.alpha.1-3(Man.alpha.1-6)Man.beta.1-4GlcNAc.beta.1-4GlcNAc (Glycoseparations, Inc.) in identical experimental conditions, and nearly identical chemical shifts were obtained.
[0278] The NMR spectrum of the Hex6HexNAc2 component is shown in FIG. 15B. The data implied that this component represents the octasaccharide Glcal-3Man.alpha.1-2Man.alpha.1-2Man.alpha.1-3(Man.alpha.1-6)Man.beta.1-4- GlcNAc.beta.1-4GlcNAc. The presence of a glucose unit was evident from the 5.255 signal showing a typical .alpha.Glc 2.4 Hz coupling. All Man signals typically show<1 Hz coupling due to the equatorial H-2 configuration. Small differences were observed compared to the Sugabase data (Table 7), which may be ascribed to the different temperature used in the present NMR measurement (40.degree. C. vs. 26.degree. C.).
TABLE-US-00007 TABLE 7 Published NMR data of Glc.alpha.1-3Man.alpha.1-2Man.alpha.1-2Man.alpha.1-3(Man.alpha.1-6)Man.be- ta.1-4GlcNAc.beta.1-4GlcNAc. Data was obtained from Sugabase (found at boc.chem.uu.nl/sugabase/sugabase). ##STR00001## Residue Linkage Proton PPM J Hz D-GlcNAc H-1a 5.189 H-1b 4.694 H-2a 3.867 H-2b 3.692 NAc 2.038 b-D-GlcpNAc 4 H-1 4.606 H-2 3.792 NAc 2.077 b-D-Manp 4, 4 H-1 4.773 H 2 4.237 a-D-Manp 6, 4, 4 H-1 4.913 H-2 3.964 a-D-Manp 3, 4, 4 H-1 5.346 H-2 4.080 a-D-Manp 2, 3, 4, 4 H-1 5.304 H-2 4.103 a-D-Manp 2, 2, 3, 4, 4 H-1 5.038 H-2 4.224 a-D-Glcp 3, 2, 2, 3, 4, 4 H-1 5.247 H-2 3.544
[0279] Finally, the N-glycan profiles of randomly selected knockout strain 4A were analyzed at different time points (days 3, 5, 7 and 9). The shake flask culture pH was 4.8 at the starting time point and 2.6 at the ending time point. Triplicate samples from every time point of duplicate cultures were analyzed. It was observed that in both duplicates, the relative amount of Man3Gn2 signal decreased as a function of growth time because of the reduction of pH. However, the amount of Hex6Gn2 signal increased as a function of growth time (Table 8).
TABLE-US-00008 TABLE 8 The percentages of signal intensities from observed neutral glycan signals of Alg3 4A knockout strain. Duplicate cultures (3A and 4A) from four different time points (days 3, 5, 7 and 9) were analyzed. Alg3 knock out strain 4A (flask 3A) Day 3, 3A Day 5, 3A Day 7, 3A Day 9, 3A Composition m/z average stdev average stdev average stdev average stdev Hex3HexNAc 730.24 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Hex2HexNAc2 771.26 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Hex3HexNAc2 933.31 61.7 3.7 61.3 0.8 61.1 1.9 52.7 7.7 Hex4HexNAc2 1095.37 2.6 0.2 2.5 0.1 2.1 0.4 3.7 1.0 Hex5HexNAc2 1257.42 4.3 0.6 6.5 0.4 5.7 0.6 6.4 1.0 Hex6HexNAc2 1419.48 31.4 3.5 29.8 0.4 31.1 1.6 37.2 5.7 Alg3 knock out strain 4A (flask 4A) Day 3, 3A Day 5, 3A Day 7, 3A Day 9, 3A Composition m/z average stdev average stdev average stdev average stdev Hex3HexNAc 730.24 0.0 0.0 0.0 0.0 0.0 0.0 0.7 1.2 Hex2HexNAc2 771.26 0.0 0.0 0.0 0.0 0.0 0.0 0.3 0.5 Hex3HexNAc2 933.31 61.7 3.2 58.6 1.1 55.6 1.9 54.8 5.9 Hex4HexNAc2 1095.37 3.4 1.0 2.6 0.2 3.1 0.2 2.6 0.5 Hex5HexNAc2 1257.42 5.2 1.5 6.7 0.4 7.1 0.4 7.6 3.7 Hex6HexNAc2 1419.48 29.7 0.9 32.1 0.8 34.3 1.5 34.0 3.6
[0280] A difference between these two analyses (Tables 4 and 7) concerning the percentage of Man3 in clone 4A (Day 5) were noted. This difference may have been due to differences in the analyses procedures. Some lability of the heterogenous culture medium protein preparations was observed after freeze-thaw cycle(s), likely due to glycan and/or protein degradation, resulting in reduced amounts of larger glycans. Generation of the data in Table 5 included additional freeze thaw-cycles.
[0281] Acidic N-glycan fractions were also analyzed by MALDI (FIG. 16). The abundance of different acidic compounds in parental strain M124 differed from all Alg3 knockout strains, among which the acidic fraction seemed to be very similar.
[0282] Three major glycans in the parental strain were H6N2P1, H7N2P1 and H8N2P1. In the Alg3 knockout the size shifted into smaller glycans: H5N2P1, H6N2P1 and H4N2P1. Additionally, diphosphorylated glycans were more abundant in the parental strain. This may have been due to a lack of a suitable substrate for the particular enzyme that attaches phosphorylated mannose to a glycan. The phosphorylated mannose can be further elongated by other mannose residues. Phosphorylation was not substantially present in glycans of the parent M124 strain produced under fermentation conditions.
[0283] Comparison of Fermentor and Shake Flask Grown Samples
[0284] One Alg3 knockout strain (transformant 4A) was grown in batch fermentation on lactose and spent grain extract medium. The medium was 60 g/l lactose with 20 g/l spent grain extract with a volume of 7 liters (fermentor run bio01616) after inoculation. Other medium components were KH.sub.2PO.sub.4 and (NH.sub.4).sub.2SO.sub.4. Culture pH was controlled between 5.5 and 5.8. Biomass and culture supernatant samples were taken during the course of the run and stored at -20.degree. C. Mycelial samples were also collected for possible RNA analysis and were frozen immediately in liquid nitrogen and transferred to -70.degree. C. Samples collected from the whole course of these fermentations were analyzed for N-glycan composition. N-glycan analysis was carried out for fermentor run bio01616) and for the 5 days time point sample from the shake flask culture of transformant 4A (FIGS. 17 and 18). The main signal in the shake flask culture was Man3 (59%). In the fermentor culture, the main signal was Man3 (85%), and the proportion of Hex6 was decreased to 8%.
[0285] Conclusions
[0286] The Alg3 knockout was successful in producing 50% or more of the expected Man3 glycoform. The desired branched structure of Man.alpha.3(Man.alpha.6)Man.beta.- was verified by fragmentation mass spectrometry and NMR spectroscopy.
[0287] The other products of the Alg3 knockout included Man4 (mannose-containing minor product), Hex5 (a degradation product of Hex6 as indicated in FIG. 13) and Hex6, which was the second largest component. The Hex6 component was characterized to contain terminal Glc by mannosidase resistance and specific NMR signals including Glc.alpha.3Man-terminal. It was considered that the glycan structure could be further optimized by methods for reducing the amount of the terminal Glc, which was likely causing suboptimal efficacy of glucosidase II with the glycan devoid of mannoses on the Man.alpha.6-arm of the molecule. Further optimization of fermentation conditions may reduce the amount of terminal Glc.
[0288] This data indicated better glycosylation results in the T. reesei Alg3 knockout compared to earlier data for Alg3 knockouts in Aspergillus (Kainz et al., Appl Environ Microb. 2008 1076-86) and P. pastoris (Davidson et al., Glycobiology 2004, 399-407). In the works of Kainz et al. and Davidson et al., similar or higher Hex6 corresponding product levels were reported. Those studies also reported additional problems with .alpha.2-Mannose, OCH1 products and larger size, and cell type-specific glycans produced by P. pastoris. In conclusion, N-glycan analysis of T. reesei Alg3 knockouts revealed that the major glycoform in the knockout strains is Man3Gn2, a desired starting point for efficient generation of mammalian-type N-glycans.
Example 3
Purification and Activity of Individual GnTI and GnTII Enzymes
[0289] Human GnTI and GnTII (N-acetylglucosaminyltransferase I and N-acetylglucosaminyltransferase II) were expressed as soluble, secreted proteins in Pichia pastoris in order to study their acceptor specificity and activity.
[0290] Generation of GnTI Construct for Production in P. Pastoris
[0291] Human GnTI (P26572) sequence was obtained as a full-length sequence and subcloned into Trichoderma reesei overexpression vectors. Protein coding sequences (CDS) encoding the soluble part of human GnTI were cloned to the pBLARG-SX expression vector in order to produce a secreted form of the protein in Pichia pastoris for enzymatic studies. During the cloning procedure, a His tag encoding sequence was added to 5'end of the frame to obtain a tag at the N-terminus of the truncated protein. The sequence was verified by sequencing analysis. Resulting vector pTTg5 was linearized and transformed by electroporation to P. pastoris GY190 cells to yield strain GY4. Arg.sup.+ transformants were picked and screened by PCR. GY4 clones containing the integrated plasmid were tested for protein expression.
[0292] Expression and Purification of Soluble GnTI
[0293] P. pastoris strain GY4 expressing soluble GnTI was first grown overnight with shaking at +30.degree. C. in BMGY medium (1% yeast extract, 2% peptone, 100 mM potassium phosphate pH 6.0, 1.34% yeast nitrogen base, 4.times.10-5% biotin, 1% glycerol) to OD.sub.600 2-6. The cells were then harvested by centrifugation and resuspended to OD.sub.600 of 1 in BMMY medium (like BMGY, but with 0.5% methanol instead of 1% glycerol). The culture was placed in a baffled flask and returned to a shaking incubator at +16.degree. C. 100% methanol was added to a final concentration of 0.5% every 24 h to maintain induction. 1 ml samples of the expression culture were taken 0, 24, 48, and 72 hours after induction, and both the cell pellets and the supernatants were stored for analysis. After 3 days of induction, the cells from the whole culture were harvested by centrifugation, and the supernatant was collected for further purification of GnTI.
[0294] Preparation of Crude GnTI Sample for Activity Assay
[0295] Pichia pastoris cell culture, which contained soluble His-tagged GnTI was processed for activity assay by concentration and buffer exchange. In brief, 40 ml of P. pastoris supernatant from shake flask culture was harvested at day 3 after induction with MeOH by pelleting the cells in 50 ml Falcon tube (Eppendorf 5810R, 3220 rcf, 5 min at +4.degree. C.) and collecting the supernatant. The supernatant was then concentrated to <2.5 ml by sequential centrifugations (Eppendorf 5810R or comparable, 3220 rcf, 10 min at +4.degree. C.) with Millipore Amicon Ultracel 30K concentrator. The volume of the concentrate was adjusted to 2.5 ml with 100 mM NIES, pH 6.1. Concentrate was subjected to buffer exchange with a PD-10 gel filtration column (GE Healthcare 17-0851-01). The column was first equilibrated with 100 mM MES, pH 6.1 and then the sample (2.5 ml) was added, flow-through was discarded and elution with 2.25 ml of MES buffer was collected. Finally, 500 .mu.l of the eluate was concentrated to 100 .mu.l with Millipore Biomax 30K concentrator (Eppendorf 5417, 12 000 rcf, 5 min +4.degree. C.) and used directly in activity assays.
[0296] Activity Assay of GnTI Enzyme
[0297] Man.alpha.1-6(Man.alpha.1-3)Man.beta.1-4GlcNAc (Man.sub.3Gn) was used as an acceptor for GnTI in the GnTI activity assay. The GnTI reaction was carried out by incubating the reaction mixture, which contained 0.1 mM acceptor Man.sub.3GlcNAc, 20 mM UDP-GlcNAc, 50 mM GlcNAc, 100 mM MnCl.sub.2, 0.5% BSA and 8 .mu.l GnTI in 100 mM MES, pH 6.1, in a total volume of 10 .mu.l at room temperature overnight. The reaction was stopped by incubating the reaction at 100.degree. C. for 5 min.
[0298] In parallel to the GnTI activity assay, the possible HexNAc'ase activity in the crude enzyme preparation was controlled. GlcNAc.beta.1-2Man.alpha.1-6(GlcNAc.beta.1-2Man.alpha.1-3)Man.beta.1-4Glc- NAc.beta.1-4GlcNAc-Asn (=Gn.sub.2Man.sub.3Gn.sub.2-Asn) was used as a substrate for HexNAc'ase. The reaction was carried out in a similar way as for GnTI, except 100 pmol of Gn.sub.2Man.sub.3Gn.sub.2-Asn was added instead of Man.sub.3Gn and UDP-GlcNAc. No HexNAc'ase activity was detected.
[0299] The reaction mixture was purified for MALDI analysis by sequential Hypersep C.sub.18 (100 mg, Thermo Scientific, cat no: 60300-428) and Hypercarb (10 mg/96 well plate/l PKG, cat no 60302-606) chromatography on HyperSep 96-well Vacuum Manifold, Thermo Scientific. Hypersep C.sub.18 was prepared with 300 .mu.l EtOH and 300 .mu.l MQ water, the collection plate was then put under, and samples were loaded and eluted with 150 .mu.l MQ water. Hypercarb was prepared with 300 .mu.l MeOH and 300 .mu.l MQ water. Eluates from Hypersep C.sub.18 were loaded, salts were removed with 150 .mu.l 0.5 M NH.sub.4Ac, and wells were washed with 2.times.300 .mu.l MQ water. GnTI reaction products were eluted with 150 .mu.l 25% ACN, and HexNAc'ase reaction products were eluted with 25% ACN and 0.05% TFA. Samples were dried in a Speedvac.
[0300] Matrix-assisted laser desorption-ionization time-of-light (MALDI-TOF) mass spectrometry (MS) was performed with a Bruker Ultraflex TOF/TOF instrument (Bruker Daltonics, Germany). Acceptor saccharide and product were detected in positive ion reflector mode as [M+Na]+ ions. Calculated m/z values for [M+Na]+-signals of Hex.sub.3HexNAc.sub.1 and Hex.sub.3 HexNAc.sub.2 were 733.238 and 933.318, respectively. The percent ratio of the acceptor and the product was calculated from the signals corresponding to Hex.sub.3HexNAc.sub.1 and Hex.sub.3 HexNAc.sub.2 (FIG. 19).
[0301] Generation of GnTII Construct for Production in P. pastoris
[0302] The nucleotide sequence encoding human GnTII was PCR-amplified with primers GP3 and GP13, which contained KpnI and EcoRI restriction sites, respectively. The EcoRI/KpnI-digested PCR fragment was ligated to a similarly digested pBLARG-SX cloning vector. After verifying the sequence, the final construct was transformed to P. pastoris strain GS190 to yield strain GY22. Positive yeast transformants were screened by PCR. Two clones (only one of which is shown in FIG. 20) were studied for expression of GnTII under the control of the methanol-inducible AOX1 promoter at +16.degree. C. and at +30.degree. C.
[0303] Expression of Soluble GnTII
[0304] According to Western blot analysis (FIG. 20), P. pastoris strain GY22 produced soluble recombinant GnTII enzyme. GnTII has a calculated molecular mass of 49049.0 Da and two predicted N-glycosylation sites. The recombinant GnTII was secreted into the culture medium at +16.degree. C. (lane 9). When grown at +30.degree. C., the recombinant GnTII was arrested inside the cells (lane 4).
[0305] Activity Assays of Soluble GnTII
[0306] P. pastoris cell culture containing soluble His-tagged GnTII was processed for an activity assay as described for GnTI above. Cell culture was centrifuged, supernatant was harvested and concentrated, buffer exchange to 100 mM MES, pH 6.1 was conducted, and the resulting sample was further concentrated prior to activity testing.
[0307] The activity assay was carried out similarly as for GnTI. GnMan3Gn was used as a GnTII acceptor.
[0308] The GnTII reaction was carried out in the presence of 0.1 mM acceptor GnMan3Gn, 20 mM UDP-GlcNAc, 50 mM GlcNAc, 100 mM MnCl2, 0.5% BSA, and GnTII in 100 mM MES, pH 6.1. Purification of the reaction mixture for MALDI-TOF MS analysis was performed by sequential Hypersep C18 and Hypercarb chromatography on a 96-well plate on vacuum manifold as described for GnTI above.
[0309] MALDI-TOF MS was performed with a Bruker Ultraflex TOF/TOF instrument (Bruker Daltonics, Germany). Acceptor saccharide and product were detected in positive ion reflector mode as [M+Na]+ ions. Ratio of the product and acceptor at the end of the reaction was calculated from their signal intensities (calculated m/z values for [M+Na]+ signals of GnMan3Gn acceptor and product with one GlcNAc addition are 933.318 and 1136.397, respectively).
[0310] Cultivation of P. pastoris producing GnTII was repeated, and GnTII concentrate (60.times.) from supernatant was prepared and its activity measured according to the methods described above. MALDI spectrum of time point samples at 2.5 h, 5 h, and overnight showed that 80%, 83%, and 82% of the acceptor was converted to product, respectively. The close-to-maximum reaction was reached in 2.5 hours.
[0311] In addition, a crude GnTII sample was prepared, and the activity assay was carried out as described above for the crude GnTI sample. The reaction mixture was incubated overnight, purified, and subjected to MALDI analysis. MALDI spectra revealed GnTII activity (FIG. 21). HexNAc'ase activity was not detected in the crude GnTII sample.
[0312] The methods used to synthesize a GnTII acceptor for use in the above-described GnTII activity assays were as follows. A GnTI sample was prepared from a P. pastoris cultivation medium as described above. This GnTI sample showed high GnTI activity and, therefore, it could be used in conversion of about 40 nmol of Man3Gn to GnMan3Gn. The reaction was carried out in the presence of 0.5 mM Man3Gn, 20 mM UDP-GlcNAc, 50 mM GlcNAc, 100 mM MnCl2, 0.5% BSA, and GnTI sample. The reaction mixture was incubated three days at room temperature. A sample of .about.1% was subjected to purification by Hypercarb chromatography and MALDI analysis. The GnTI reaction converted almost all of Man3Gn acceptor to GnMan3Gn product according to MALDI spectrum. Only 2.8% of the acceptor was not converted.
Example 4
GnTI/GnTII Fusion Protein
[0313] Generation of GnTI/GnTII Expression Construct
[0314] A recombinant GnTI/II fusion protein was constructed by amplifying a 1313 by GnTII fragment with a 65-mer fusion primer at the 5'-end, which contained an in-frame fusion site (a short sequence from GnTI containing a naturally occurring AleI restriction site with the stop-codon removed and overlapped with GnTII sequence) and 3'-end primers homologous to GntII containing either SpeI or NdeI restriction sites. This fusion site allowed the cloning of a fusion fragment directly to a T. reesei overexpression vector with wild type GnTI under the control of the cbh1 promoter (cloning with AleI/NdeI) or with wild type GnTI under the control of the gpd promoter (cloning with AleI/SpeI). High-fidelity Phusion polymerase (Finnzymes) and standard amplification and cloning procedures were used. The sequence was verified by sequencing directly from expression vectors. The resulting vector was used to express the fusion as a transmembrane protein in T. reesei.
[0315] To gain more information on the functionality of the fusion proteins, fusion GnTI/II proteins were also expressed as soluble proteins in P. pastoris. CDS of the GnTI/II fusion encoding the soluble part of the protein was cloned to the pBLARG-SX expression vector in order to produce protein for enzymatic studies. During the cloning procedure, His tag encoding sequence was added to the 5'-end of the frame to obtain a tag at the N-terminus of the truncated protein. The sequence was verified by sequencing analysis. The resulting vector was linearized and transformed by electroporation to P. pastoris strain GS190 to yield strain GY6. Arg.sup.+ transformants were picked and screened by PCR. P. pastoris clones containing the integrated plasmid were tested for protein expression.
[0316] Purification of Soluble GnTI/II Produced in P. Pastoris
[0317] Expression in P. pastoris and purification procedures were carried out as described above with recombinant GnTI protein.
[0318] Enzyme Activity Tests of GnTI/II Fusion Protein
[0319] Activity assays were carried out as described above for GnTI assays using Man3Gn oligosaccharide as an acceptor and UDP-GlcNAc donor. The products of the reaction were analyzed by MALDI-TOF mass spectrometry. Only GnTI activity was observed for the GnTI/GnTII fusion protein (FIG. 22).
[0320] Transformation of T. reesei with GnTI/GnTII Construct by Random Integration
[0321] A chimeric human GnTI/GnTII plasmid with a gpdA promoter was co-transformed into the T. reesei M124 strain with random integration. Selection was obtained by co-transformation of a plasmid containing an acetamidase marker gene. Twenty PCR positive transformants were purified to uninuclear clones and grown in shake flask cultures for glycan analysis. All transformants and the parental strain M124 were cultivated in Trichoderma minimal medium (TrMM), pH 4.8, supplemented with 4% lactose and 2% spent grain extract. Supernatant and mycelia samples were collected on days 3, 5, and 7, and were stored frozen until analysis. In addition, as a control, T. reesei was transformed with a GnTI construct by random integration.
[0322] Glycan Analysis of T. Reesei GnTI/GnTII Strains Obtained by Random Integration
[0323] Samples from 20 different clones at three different time points (days 3, 5 and 7) from T. reesei strain M124 GnTI/GnTII transformants were analyzed. Samples from two parental M124 strains were analyzed for controls. N-glycanase reactions without SDS denaturation were performed in 96-well plates in triplicate for 5 .mu.g of supernatant protein. The protein concentration of the supernatants was measured by Bradford-based assay (Bio-Rad Quick Start Bradford Protein Assay) using BSA as a standard. Both neutral and acidic N-glycans were analyzed by MALDI-TOF MS. No Go product was detected using the GnTI/GnTII construct in any of the clones at any time point as well as in clones of GnTI transformants with gpdA promoter.
[0324] Transformation of T. Reesei with GnTI/GnTII Construct by Targeted Integration
[0325] A chimeric GnTI/GnTII sequence was subcloned into a pTTv38 backbone, a vector that contains an acetamidase marker gene and 5'- and 3'-flanking sequence sites for alg3 locus integration. The vector was transformed into T. reesei M124 strain as a digested fragment. From this transformation, 18 PCR positive transformants, yielding PCR fragments indicating correct integration to the alg3 locus, were detected. These transformants were cultured in shake flasks after a single spore purification step and were analyzed as described below.
[0326] Glycan Analysis of T. Reesei GnTI/GnTII Strains Obtained by Targeting to alg3 Locus
[0327] Supernatant samples of 10 different clones at three different time points (days 3, 5 and 7) of .DELTA.alg3 T. reesei GnTI/GnTII transformants were obtained. Clones had been cultivated in shake flasks with two different media compositions. TrMM, pH 5.5, with 2% spent grain extract, 4% lactose, and K-phthalate buffering was used for all clones and, in parallel, TrMM, pH 5.5, with 2% spent grain extract, 4% lactose, 1% casamino acids, and K-phthalate buffering was used for five of the clones. Cultivation was continued for 7 days: 5 days at +28.degree. C. and days 6 and 7 at +24.degree. C.
[0328] N-glycan analyses were made in triplicate in 96-well plates for 5 .mu.g of supernatant protein. Samples were analyzed from days 3, 5, and 7. The protein concentration of the supernatants was measured by Bradford-based assay (Bio-Rad Quick Start Bradford Protein Assay) using BSA as a standard. Both neutral and acidic N-glycans were analyzed by MALDI-TOF MS.
[0329] Detectable amounts of glycoform G0 were found in every clone. Clone 201A contained the most with 1.2% of Gn2Man3 (FIG. 23 and Table 9). In addition, the amount of Hex6 was lowest in this particular clone. The second medium with 1% casamino acids did not give any extra production of G0/GlcNAc.beta.2Man.beta.3(GlcNAc.beta.2Man.alpha.6)Man.beta.4GlcNAc.beta- .4GlcNAc.beta.. The results of the days 3 and 7 samples were essentially the same as for the day 5 sample.
TABLE-US-00009 TABLE 9 The signal intensity percentages of observed N-glycans from secreted proteins of T. reesei GnTI/II transformants (GnTI/II integrated into the alg3 locus). Clones with letter A in their name were cultivated in medium A) and clones with B in medium B), which had an extra 1% casamino acids compared to medium A). clone 201A, days clone 202A, days clone 208A, days clone 210A, days clone 201A, day 5 clone 202A, day 5 clone 208A, day 5 Composition m/z Average SD RSD MIN MAX Average SD RSD MIN MAX Average SD RSD MIN MAX Man2 771.3 0.6 0.5 86.8 0.0 1.0 0.4 0.7 173.2 0.0 1.1 0.6 0.6 92.3 0.0 1.1 Man3 933.3 47.9 14.5 30.2 39.0 64.6 41.3 0.2 0.4 41.1 41.5 38.2 1.1 2.8 37.0 38.9 Man4 1095.4 7.9 2.9 36.5 5.9 11.3 6.4 0.6 8.7 6.0 7.0 5.3 0.2 4.0 5.0 5.5 GnMan3 1136.4 1.4 0.7 46.9 1.0 2.2 1.1 0.3 23.5 0.8 1.3 1.0 0.2 17.0 0.9 1.2 Man5 1257.4 10.5 2.5 23.5 8.7 13.3 8.6 0.8 9.7 7.7 9.4 8.2 0.3 4.0 7.8 8.5 Gn2Man3 1339.5 12 0.8 69.1 0.6 2.2 0.6 0.1 21.0 0.5 0.8 0.6 0.1 21.5 0.5 0.7 Hex6 1419.5 27.3 23.7 86.7 0.0 42.0 40.5 0.6 1.5 39.9 41.1 44.7 0.7 1.6 43.9 45.2 Hex7 1581.5 2.9 3.0 103.3 1.1 6.4 1.0 0.1 11.0 1.0 1.2 1.1 0.1 11.7 1.0 1.2 Hex8 1743.6 0.1 0.2 173.2 0.0 0.4 0.2 0.3 173.2 0.0 0.5 0.3 0.2 87.0 0.0 0.4 clone 210A, day 5 clone 212A, day 5 clone 213A, day 5 Composition m/z Average SD RSD MIN MAX Average SD RSD MIN MAX Average SD RSD MIN MAX Man2 771.3 0.1 0.2 173.2 0.0 0.4 0.4 0.4 86.8 0.0 0.7 0.6 0.6 94.4 0.0 1.1 Man3 933.3 38.2 1.1 3.0 37.5 39.5 45.6 1.3 2.8 44.2 46.8 40.0 2.8 7.0 37.3 42.9 Man4 1095.4 6.0 0.4 6.6 5.5 6.2 5.6 0.3 5.1 5.4 5.9 6.5 0.6 8.8 6.0 7.1 GnMan3 1136.4 1.1 0.1 8.9 1.0 1.2 0.9 0.2 22.4 0.7 1.1 0.9 0.1 8.5 0.8 1.0 Man5 1257.4 8.9 0.3 3.7 8.6 9.3 7.2 0.5 7.0 6.8 7.7 9.5 0.4 3.8 9.1 9.8 Gn2Man3 1339.5 0.6 0.1 17.5 0.6 0.8 0.5 0.1 11.9 0.5 0.6 0.6 0.1 18.3 0.5 0.7 Hex6 1419.5 43.2 0.7 1.6 42.7 44.0 38.6 1.2 3.0 37.4 39.7 40.7 2.5 6.1 38.2 43.2 Hex7 1581.5 1.2 0.0 3.7 1.2 1.2 0.8 0.0 4.1 0.8 0.8 1.0 0.1 10.8 0.9 1.2 Hex8 1743.6 0.6 0.3 57.0 0.3 1.0 0.4 0.1 34.8 0.3 0.5 0.1 0.2 173.2 0.0 0.3 clone 215A, day 5 clone 216A, day 5 clone 217A, day 5 Composition m/z Average SD RSD MIN MAX Average SD RSD MIN MAX Average SD RSD MIN MAX Man2 771.3 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.9 0.0 5.0 0.9 1.0 Man3 933.3 43.4 1.9 4.4 41.3 45.1 42.6 2.0 4.6 40.5 44.4 54.1 1.1 1.9 53.0 55.0 Man4 1095.4 6.3 0.5 8.5 5.7 6.8 6.1 0.6 10.3 5.4 6.7 5.2 0.3 6.5 4.9 5.5 GnMan3 1136.4 1.1 0.1 6.9 1.0 1.2 1.1 0.2 14.1 0.9 1.2 0.9 0.2 17.4 0.7 1.0 Man5 1257.4 8.5 0.4 4.2 8.2 8.9 7.7 0.6 8.4 7.0 8.3 5.8 0.1 2.6 5.6 5.9 Gn2Man3 1339.5 0.7 0.2 29.3 0.6 1.0 0.7 0.2 26.4 0.5 0.9 0.7 0.1 14.7 0.6 0.7 Hex6 1419.5 38.5 1.8 4.6 37.4 40.5 40.5 1.7 4.2 39.0 42.4 31.5 1.5 4.7 30.5 33.3 Hex7 1581.5 1.1 0.1 4.5 1.1 1.2 1.0 0.1 6.4 0.9 1.0 0.9 0.1 12.9 0.8 1.0 Hex8 1743.6 0.4 0.3 88.5 0.0 0.6 0.4 0.3 87.6 0.0 0.6 0.0 0.0 0.0 0.0 0.0 clone 219A, day 5 clone 201B, day 5 clone 202B, day 5 Composition m/z Average SD RSD MIN MAX Average SD RSD MIN MAX Average SD RSD MIN MAX Man2 771.3 0.5 0.4 96.7 0.0 0.9 0.4 0.7 173.2 0.0 1.1 0.6 1.1 173.2 0.0 1.8 Man3 933.3 44.0 1.8 4.1 42.4 45.9 46.9 0.2 0.5 46.6 47.1 40.6 1.7 4.3 38.6 41.8 Man4 1095.4 5.7 0.1 1.5 5.6 5.8 6.9 0.9 12.7 6.0 7.8 8.5 0.9 10.0 7.7 9.4 GnMan3 1136.4 1.0 0.2 16.6 0.9 1.2 1.2 0.4 32.1 0.9 1.6 1.3 0.4 0.0 0.9 1.8 Man5 1257.4 8.0 1.2 15.6 6.7 9.2 8.1 0.5 5.7 7.8 8.6 10.0 0.6 6.2 9.5 10.6 Gn2Man3 1339.5 0.9 0.1 14.2 0.8 1.0 0.8 0.1 7.1 0.8 0.9 0.7 0.5 7.8 0.3 1.3 Hex6 1419.5 38.5 1.1 2.8 37.3 39.2 34.2 0.7 2.1 33.8 35.1 37.5 1.1 2.8 36.7 38.7 Hex7 1581.5 1.0 0.2 15.4 0.8 1.1 1.1 0.1 5.2 1.0 1.2 0.8 0.7 86.9 0.0 1.2 Hex8 1743.6 0.4 0.1 17.9 0.3 0.5 0.4 0.3 90.7 0.0 0.7 0.0 0.0 0.0 0.0 0.0 clone 208B, day 5 clone 210B, day 5 clone 219B, day 5 Composition m/z Average SD RSD MIN MAX Average SD RSD MIN MAX Average SD RSD MIN MAX Man2 771.3 0.9 0.8 87.1 0.0 1.5 0.8 0.7 86.7 0.0 1.2 1.2 0.1 10.3 1.0 1.3 Man3 933.3 48.4 1.2 2.4 47.3 49.6 39.6 1.1 2.7 38.6 40.8 34.9 1.8 5.2 33.2 36.8 Man4 1095.4 7.2 0.2 2.2 7.0 7.3 7.9 0.6 8.0 7.3 8.5 8.1 0.3 4.1 7.8 8.4 GnMan3 1136.4 0.6 0.6 92.1 0.0 1.1 1.0 0.1 12.7 0.9 1.1 1.1 0.1 12.1 1.0 1.2 Man5 1257.4 8.7 0.7 7.6 7.9 9.1 9.6 0.2 2.0 9.4 9.8 11.3 0.8 7.5 10.7 12.3 Gn2Man3 1339.5 0.4 0.2 44.3 0.2 0.6 0.6 0.2 32.4 0.4 0.8 0.6 0.1 13.9 0.5 0.6 Hex6 1419.5 32.4 0.4 1.4 32.1 32.9 38.5 0.3 0.8 38.3 38.9 40.6 0.7 1.8 39.8 41.1 Hex7 1581.5 1.0 0.2 15.5 0.8 1.1 1.5 0.1 8.2 1.4 1.6 1.4 0.2 13.5 1.2 1.5 Hex8 1743.6 0.4 0.4 87.7 0.0 0.7 0.5 0.5 92.4 0.0 0.9 0.8 0.1 16.3 0.7 0.9
Example 5
GnTII/GnTI Fusion Protein
[0330] Generation of GnTII/GnTI Expression Construct
[0331] A GnTII/GnTI fusion expression construct was generated by applying PCR overlap techniques. Fusion fragments were amplified from GnTII and GnTI templates separately with primers containing 50 bp in-frame overlaps at the fusion site. Fragments were purified from an agarose gel and used as PCR template for amplification of the fusion construct according to standard procedures. The fusion construct was cloned into a vector with ApaI/SpeI restriction sites. The resulting construct was verified by sequencing analysis. A vector was generated for expressing the soluble form of GnTII/GnTI in P. pastoris with His tagging at the N-terminus of the target protein. This vector was generated in a similar manner as described above for the GnTI/II fusion construct.
[0332] Purification of Soluble GnTI/GnTI Produced in P. Pastoris
[0333] Expression in P. pastoris and purification procedures were carried out as described above for recombinant GnTI protein.
[0334] Enzyme Activity Tests of GnTII/GnTI Fusion Protein
[0335] Activity assays were carried out as described above for GnTI using Man3Gn oligosaccharide as an acceptor. A MALDI spectrum of the purified reaction mixture from the GnTII/GnTI reaction showed that two GlcNAc.beta.-residues were transferred to the acceptor (FIG. 24).
TABLE-US-00010 TABLE 10 Summary of GnTII/GnTI fusion protein activities. Products formed GnTII/GnTI transformant Acceptor concentration ##STR00002## ##STR00003## Transformant 1 0.5 mM 47% 5% Transformant 1 0.1 mM -- 11% Transformant 2 0.5 mM 3% 2.4%
[0336] Characterization by .beta.-N-acetylglucosaminidase
[0337] The mixture formed in the GnTII/GnTI activity reaction was treated with .beta.1-2,3,4,6-N-acetylglucosaminidase from Streptococcus pneumoniae. MALDI MS analysis was used to determine that both transferred .beta.-linked GlcNAc residues were cleaved (FIG. 25).
[0338] Galactosulation by .beta.1-4GalT
[0339] The mixture formed in the GnTII/GnTI activity reaction was treated with .beta.1-4GalT from bovine milk. .beta.1-4GalT was expected to galactosylate the terminal GlcNAc residues in the product mixture. According to MALDI spectrum of the .beta.1-4GalT reaction mixture, both products were galactosylated. Two galactoses were transferred to the Gn2Man3Gn product, which indicated that the GlcNAc residues were linked to separate mannose branches (FIG. 26).
[0340] Transformation of T. Reesei with GnTII/GnTI Construct by Random Integration
[0341] A chimeric GnTII/GnTI sequence was designed and cloned into a vector containing the gpdA promoter. After verification of the plasmid sequence, it was co-transformed into the T. reesei M124 strain with the hygromycin marker gene. Thirteen PCR positive transformants were identified. All positive transformants and the parental strain M124 were cultivated in TrMM, pH 4.8, supplemented with 4% lactose and 2% spent grain extract. In addition, seven transformants and the parental strain were cultivated in TrMM, pH 5.5, with 4% lactose, 2% spent grain extract, and 1% casamino acids, buffered with 100 mM PIPPS (piperazine1,4bis2propanesulfonic acid). pH measurements were used to monitor the growth rate of the strains. Supernatant and mycelia samples were collected on days 3, 5, and 7, stored frozen, and analyzed for glycan structures. The GnTII/GnTI sequence was also cloned into a plasmid containing the cbh1 promoter. In addition, as a control, T. reesei was transformed with a GnTI construct by random integration.
[0342] Glycan Analysis of T. Reesei GnTII/GnTI Strains Obtained by Random Integration
[0343] 156 supernatant samples of T. reesei strain M124 GnTII/GnTI transformants and parental M124 strain cultivated in two different media were analyzed. The first medium was TrMM, pH 4.8, supplemented with 2% spent grain extract and 4% lactose, and the second medium was TrMM, pH 5.5, supplemented with 2% spent grain extract, 4% lactose, 100 mM PIPPS, and 1% casamino acids. Cells were grown in both types of media for 3, 5 and 7 days.
[0344] N-glycanase reactions without SDS denaturation were carried out in 96-well plates in triplicate for 5 .mu.g of supernatant protein for samples from time points of 3 and 5 days. The protein concentration of the supernatants was measured by Bradford-based assay (Bio Rad Quick Start Bradford Protein Assay) using BSA as a standard. Both neutral and acidic N-glycans were analyzed by MALDI-TOF MS.
[0345] No sign of the expected GnTII/GnTI product was visible in any of the clones from time points of 3 and 5 days. In addition, no product was observed from GnTI and GnTI/II transformants with gpdA promoters that were generated by random integration.
[0346] Transformation of T. Reesei with GnTII/GnTI Construct by Targeted Integration
[0347] A vector having the chimeric GnTII/GnTI sequence under the control of the cbh1 promoter was constructed with a pyr4 gene loopout marker and subcloned into a backbone vector between alg3 flanking region fragments for targeted integration. A PmeI-digested expression cassette was transformed into T. reesei strain M127 (pyr4.sup.- strain of M124). After plate selection, the clones were PCR-screened and purified through single spores. To obtain material for glycan analyses, shake flask cultivations were performed as described. Five PCR positive transformants indicating correct integration to the alg3 locus in the M127 transformation were cultivated in a 300 ml volume for seven days at +28.degree. C. in a media containing TrMM, pH 5.5, supplemented with 40 g/l lactose, 20 g/l spent grain extract, and 100 mM PIPPS. To avoid bacterial contamination, 100 mg/l ampicillin was added into the flasks at the time of inoculation. Samples for glycan analyses were collected on days 3, 5 and 7.
[0348] Glycan Analysis of T. Reesei GnTII/GnTI Strains Obtained by Targeting to alg3 Locus
[0349] Supernatant samples of T. reesei strain M124 (control), five different clones of M127 GnTII/GnTI transformants, and control medium samples were prepared in triplicate on 96-well plates for 5 .mu.g of supernatant protein. The protein concentrations of the supernatants were measured by Bradford-based assay (Bio-Rad Quick Start Bradford Protein Assay) using BSA as a standard. PNGase F reactions were performed as described, but without SDS denaturation. The released N-glycans were first purified with Hypersep C-18 and then with Hypersep Hypercarb (both from Thermo Scientific) where neutral and acidic glycans were separated. Both purifications were performed in 96-well format. Neutral N-glycans were analyzed by MALDI-TOF MS.
[0350] The proportions of neutral N-glycans from T. reesei M127 GnTII/GnTI transformants were compared to proportions from strain M124, which was otherwise the same as strain M127 but pyr4 positive. Four of the five GnTII/GnTI transformants produced G0 as a main glycoform at all time points (3, 5 and 7 days). Only clone 46A was G0 negative (FIG. 27). The proportion of Man3Gn was small in every clone at all time points, but the proportion of Hex6 was still quite large. On day 7, clone 17A produced the most G0 and the least Hex6 in comparison to other clones (FIG. 27). Four clones of the GnTII/GnTI transformants produced around 40% of glycoform G0 on day 5 in shake flask conditions (FIG. 27). Fermentation conditions with controlled pH can increase the amount of G0 product and reduce the amount of Hex6 in alg3 knock-outs.
[0351] In the medium sample, a series of plant-type N-glycans were observed, but no signals corresponding to G0 were observed.
[0352] Transformation of Rituximab-Producing T. reesei with GnTII/GnTI Construct by Targeted Integration
[0353] The expression cassette described in the section entitled "Transformation of T. reesei with GnTII/GnTI Construct by Targeted Integration" was transformed into T. reesei strain M279 (pyr4.sup.- strain of the strain M202). M202 was obtained by deleting pep1 protease in M124 and introducing rituximab heavy and light chain (with Kex2 cleavage site). After plate selection, the clones were PCR-screened and purified through single spores. To obtain material for glycan analyses, shake flask cultivations were performed as described in the section entitled "Transformation of T. reesei with GnTII/GnTI Construct by Targeted Integration" and, in addition, some culture media were supplemented with 0.3 mg/ml soybean trypsin inhibitor (SBTI) and 1% casamino acids. SBTI was added first at inoculation and then daily on days 3-6. PMSF and Pepstatin A were added to all samples before freezing.
[0354] Glycan Analysis of Rituximab-Producing T. reesei GnTII/GnTI Strains Obtained by Targeting to alg3 Locus
[0355] Rituximab was purified with Protein G affinity chromatography from day 5 supernatant samples with SBTI and from day 5 and 7 samples without SBTI. PNGase F reactions were performed for .about.10 .mu.g of denatured protein. The released N-glycans were first purified with Hypersep C-18 and then with Hypersep Hypercarb (both from Thermo Scientific) where neutral and acidic glycans were separated. The purification steps were performed in 96-well format. Neutral and acidic N-glycans were analyzed by MALDI-TOF MS. Two of the GnTII/GnTI transformant clones, 9A-1 and 31A-1, produced G0 glycoform at .about.30% and .about.24%, respectively. However, reasonable quantities of Hex6 and GnMan3 were still observed (FIG. 28). Rituximab from the other clones contained little or no G0.
[0356] Optimization of Spacers
[0357] A series of spacer modifications for GnTII/GnTI fusion proteins were constructed. These variants were produced in Pichia and studied in vitro for enzyme stability and activity.
[0358] The materials and methods for cloning the GnTII/GnTI fusion proteins are described here. T45 sequence was amplified in two parts by using PCR overlapping strategy. First, a fragment was amplified with GP13 5' primer and GP93 3' primer, and a second fragment was amplified with GP92 5' primer and GP2 3' primer. Amplification was carried out with Phusion high-fidelity PCR polymerase (Finnzymes) under the standard conditions provided by the supplier. Cycling conditions were as follows: initial denaturation at 98.degree. C. for 30 seconds, denaturation at 98.degree. C. for 5 seconds, annealing at 65.degree. C. for 30 seconds, extension at 72.degree. C. for 45 seconds, repeat 20 times, and final extension at 72.degree. C. for 20 minutes. The resulting PCR products were purified from the agarose gel with a Fermentas GeneJET gel extraction kit. These fragments with overlapping, modified sequences were combined in the same reaction mixture with standard conditions without primers. Ten annealing/extension cycles were carried out as follows: initial denaturation at 98.degree. C. for 30 seconds, denaturation at 98.degree. C. for 5 seconds, annealing at 65.degree. C. for 30 seconds, extension at 72.degree. C. for 45 seconds, repeat 10 times, and final extension at 72.degree. C. for 20 minutes. Primers GP13 (5') and GP2 (3') were added, and cycling was continued as described above for 20 amplification cycles. The amplified T45 fragment was purified with a Fermentas GeneJET PCR purification kit, digested with EcoRI/KpnI (New England Biolabs) according to standard protocols, and cloned into EcoRI/KpnI digested yeast expression vector pBLARG-SX. The resulting vector was sequenced with primers 3'AOX, 5'AOX, GP9, GP37, GP38 and GP122. The sequence was found to be correct.
[0359] This resulting plasmid was used as a template for the 3.times.G4S spacer modification. Cloning of the T46 sequence was done as described above with T45. GP13 5'-primer and GP95 3'-primer were used for first fragment synthesis, and GP94 5'-primer and GP2 3'-primer were used for second fragment synthesis. Fragments were combined, and primers GP13 (5') and GP2 (3') were added for amplification. Amplified fragment T46 was then digested with EcoRI/KpnI and cloned into yeast expression vector pBLARG-SX. The resulting vector was sequenced with the primers described above, and the sequence was found to be correct.
[0360] Cellulase-related natural spacers were constructed with a similar PCR overlap method. With the CBHI-related spacer, the first fragment was amplified with GP13 5'-primer and GP107 3'-primer. The second fragment was amplified with GP108 5'-primer and GP2 3'-primer (Table 11). With the EGIV-related spacer, the first fragment was amplified with GP13 5'primer and GP109 3'primer. The second fragment was amplified with GP110 5'-primer and GP2 3'-primer (Table 11). In both cases, PCR products were purified from agarose gel, combined, and used as a template for the next PCR reaction to amplify the sequences T50 and T51. T50 and T51 PCR products were then digested with EcoRI/KpnI and cloned into yeast expression vector pBLARG-SX.
[0361] All PCR amplifications were made with high-fidelity Phusion polymerase (Finnzymes). Primers (Table 11) were ordered from MWG Operon. Sequencing was performed by the DNA Sequencing Laboratory of the Institute of Biotechnology, University of Helsinki, as a commercial service.
TABLE-US-00011 TABLE 11 Primer sequences. Primer Sequence 5'-3' 3'AOX ##STR00004## 5'AOX GACTGGTTCCAATTGACAAGC (SEQ ID NO: 100) GP2 ##STR00005## GP9 CGGACCACCGCAAGTTCC (SEQ ID NO: 102) GP13 ##STR00006## GP37 CCTTTCTCTATCCAACTCTACC (SEQ ID NO. 104) GP38 ##STR00007## GP92 CCGCCGGCTCCAGGGAGGTGGGGGCAGTGGAGGTGGCGGCAGT GGGAGGGTGCCCACCGCCGCCCC (SEQ ID NO 106) GP93 ##STR00008## GP94 AGGTGGGGGCAGTGGAGGTGGCGGCAGTGGCGGCGGTGGAAGT GGGAGGGTGCCCACCGCCGCCC (SEQ ID NO: 108) GP95 ##STR00009## GP107 GTTTCCGCCGGGAGGGTTGCCGCCGCTAGGGTTGCCGGTGCTC TGGAGCCGGCGGTAAGACTTGC (SEQ ID NO: 110) GP108 ##STR00010## GP109 CCGCCTCCAGGAACAGTGGCGCTGGCGGTGGCCGTCGCGGCGG AGCTCTGGAGCCGGCGGTAAGACTTGC (SEQ ID NO. 112) GP110 ##STR00011## GP122 CATTAGCGAGAAGTTTACGG (SEQ ID NO. 114) ##STR00012##
[0362] Spacer modified (3.times.G4S and 2.times.G4S) GnTII/GnTI fusion enzymes were processed for an activity assay by concentration and buffer exchange in a similar way as described for GnTI in Example 3. Activity assays were carried out with Man3Gn acceptor, and reaction mixtures were purified as described in the GnTI activity assay. MALDI analysis was also performed as described with the GnTI reaction mixture, but, in addition, formation of the GnTII product, Hex3HexNAc3, was followed. The calculated m/z values for the [M+Na]+ signal of Hex3HexNAc3 was 1136.318 (FIG. 29).
[0363] Spacer Variants
[0364] GnTII/I spacer variants were modified from the wild type spacer sequence of the GnTII/I fusion protein. The modified spacers are listed in Table 12. All four spacer variant strains (GY32, GY33, GY49, and GY50), wild-type GnTII/I fusion strain (GY7-2), and mock strain (GY3) were expressed at +16.degree. C. with protease inhibitors. Strains were inoculated in 60 ml of BMGY-medium at +30.degree. C., 220 rpm, over-night (o/n). Over-night cultures were pelleted and cells were resuspended in 60 ml of BMMY-medium. Protease inhibitors, 1 mM EDTA, 1.5 .mu.M Pepstatin A (Sigma) and 1 Complete EDTA free protease inhibitor cocktail tablet (Roche) were added in cultures at the same time when MeOH induction was started and after that once in a day. 25 ml samples were taken from cultures on day 3 and day 4, and supernatant samples were concentrated using concentration tubes (Millipore), buffer was exchanged in PD-10 columns into 100 mM MES pH 6.1 and concentrated into final 50.times.. Cell pellets were resuspended in 500 .mu.l of 1.times.PBS, except cell pellet of wild type (3.sup.rd), which was resuspended in 500 .mu.l of 100 mM MES pH 6.1 and complete (EDTA free) inhibitor cocktail.
[0365] The amino acid sequence of the GnTII/GnTI fusion protein containing the 3.times.G4S spacer is set forth in SEQ ID NO: 119. The nucleotide sequence of the GnTII/GnTI fusion protein containing the 3.times.G4S spacer is set forth in SEQ ID NO: 141. The amino acid sequence of the GnTII/GnTI fusion protein containing the 2.times.G4S spacer is set forth in SEQ ID NO: 121. The nucleotide sequence of the GnTII/GnTI fusion protein containing the 2.times.G4S spacer is set forth in SEQ ID NO: 139. The amino acid sequence of the GnTII/GnTI fusion protein containing the CBHI spacer is set forth in SEQ ID NO: 123. The nucleotide sequence of the GnTII/GnTI fusion protein containing the CBHI spacer is set forth in SEQ ID NO: 143. The amino acid sequence of the GnTII/GnTI fusion protein containing the EGIV spacer is set forth in SEQ ID NO: 125. The nucleotide sequence of the GnTII/GnTI fusion protein containing the EGIV spacer is set forth in SEQ ID NO: 145.
[0366] A 200 .mu.l sample of cell suspension was washed by repeating centrifuging and resuspending cells in 100 mM MES pH 6.1 with complete (EDTA free) inhibitor cocktail. A cell lysate was prepared by taking 200 .mu.l of washed cell sample, adding 50 .mu.l glass beads and 2 .mu.l Triton X-100 and putting in bead beater for 6 min. GnTI activity assays of 50.times. concentrated P. pastoris culture supernantants, cell sample and cell lysate were performed as above.
TABLE-US-00012 TABLE 12 Description of yeast strains. Sequence Yeast Strains Description of spacer variant GY3 Mock strain GY7-2 Wild-type GnTII/I fusion GY32-5 GnTII/I fusion 3xG4S spacer variant SEQ ID NO: 118 GY32-9 GY33-7 GnTII/I fusion 2xG4S spacer variant SEQ ID NO: 120 GY33-8 GY49-3 GnTII/I fusion CBHI spacer variant SEQ ID NO: 122 GY50-7 GnTII/I fusion EGIV spacer variant SEQ ID NO: 124 GY50-10
[0367] Western blots analysis of cell pellets and 50.times. concentrated culture supernatants from day 3 are shown in FIG. 30. The CBHI spacer variant (GY49) gave a strong signal from the cell pellet sample but not from the supernatant. The EGIV spacer variant (GY50) was detected from the supernatant, but only faint signal was obtained. Faint signals from supernatant samples were also obtained with the wild-type GnTII/I fusion strain (GY7-2) and the 2.times.G4S spacer variant strains GY33-7 and GY33-8 (FIG. 30).
[0368] The activities of the GnTII/I fusion protein containing the spacer variants were then compared to the activity of the GnTII/I fusion protein containing the wild-type spacer.
[0369] Fusion GnTII/I activity in supernatants. The GnTI substrate Man3Gn was provided and the reaction product, GnMan3Gn, acted as the acceptor for the GnTII activity of the fusion protein. Samples for activity assays were taken after day 3 and day 4 expression phases. FIG. 31 shows activity assay results of cultures of GnTII/I fusion proteins containing either the wild type spacer or the spacer variants. Sample cultivations were done in the presence of inhibitors (1.5 .mu.M pepstatin A, 1 mM EDTA, 1 tablet/50 ml of complete EDTA free protease inhibitor cocktail tablet). For simplicity, the GnTI and GnTII reaction products were added together. All activity assay samples contained only minor amounts (<5%) of GnTI product GnMan3Gn, indicating that GnTII actively transformed the GnMan3Gn to Gn2Man3Gn.
[0370] All four spacer variants showed GnT activities, although there was some variability between clones and cultivation days. The GnTII/I fusion proteins containing the 2.times.G4S (clone_1), 3.times.G4S (clone_1 and clone_2), or EGIV spacer variants showed higher activity than the enzyme with the wild-type spacer (FIG. 31). The GnTII/I fusion protein containing the CBHI spacer variant showed comparable activity with the enzyme with the wild-type spacer (FIG. 31) The GnTII/I fusion protein containing the 2.times.G4S variant (clone_2) had lower activity than the enzyme with the wild-type spacer (FIG. 31). Day 4 samples had higher activities than day 3 samples, with the exception of the GnTII/I fusion protein containing the 3.times.G4S spacer variants (clone_1 and clone_2), which showed higher activity on day 3 (FIG. 31). The GnTII/I fusion protein containing the EGIV spacer variant had the highest activity on day 4 (FIG. 31).
[0371] Fusion GnTII/I activity in cells and cell lysates. Activity assays of cell, cell lysate, and supernatant samples from cells containing the GnTII/I fusion protein having the wild-type spacer indicated that lysate samples contained the highest activity (FIG. 32). The second highest activity was on the cell surface, and lowest activity was seen in the supernatant samples (FIG. 32). Accordingly, it appears that most of the GnTII/I fusion protein was localized in cells or on the cell surface, with only a small amount being secreted.
[0372] GnT activities of cells containing GnTII/I fusion proteins having either the wild-type spacer or the spacer variants are shown in FIG. 33. The cells were resuspended in 500 .mu.l of 100 mM MES, pH 6.1 with complete EDTA free inhibitor cocktail and spacer variants in 500 .mu.l PBS and cells and lysates for activity testing were prepared as above.
[0373] As shown in FIG. 33, GnTII/I fusion proteins containing the spacer variants had much higher GnTII/I activity in cells than in supernatants. In lysates, the enzymes appeared to be inactive. It is believed that this lack of activity is due to the action of released proteases. The GnTII/I fusion protein containing the CBHI spacer variant showed a high activity in cells and lysates (FIG. 33), which correlates with Western blot analysis showing higher signal in the cell pellet sample (FIG. 30).
[0374] Discussion. In supernatants, the GnTII/I fusion proteins containing the 2.times.G4S and 3.times.G4S spacer variants had higher activity that the GnTII/I fusion protein containing the wild-type spacer, while the CBHI spacer variant had comparable activity to the GnTII/I fusion protein containing the wild-type spacer. Moreover, the GnTII/I fusion protein containing the EGIV spacer variant showed the highest GnT activity. Western blot analysis of day 3 samples had some correlation with the results of day 4 activities. Western blot analysis showed faint bands with supernatant samples of wild-type, both clones of 2.times.G4S and EGIV. The activities were detected in the following order: EGIV>2.times.G4S (clone_1)>3.times.G4S (clone_2)>3.times.G4S (clone_1).gtoreq.CBHI=wild-type=2.times.G4S (clone_2).
[0375] Determination of GnTII/I fusion protein activity in supernatant, cell, and cell lysate samples of the GnTII/I fusion protein containing the wild-type spacer showed that most of the activity is associated within the cells and lower amount is secreted. It is believed that this explains why much better signals of His-tagged GnTII/I were seen in cell fractions rather than in supernatant fractions in Western blot analysis.
[0376] The inhibition of serine and cysteine proteases by complete EDTA free inhibitor tablet, metalloproteinases by EDTA and aspartic proteases by pepstatin A, improved the yield of GnTII/I fusion protein. This observation on the use of serine protease inhibitor is in accordance with the work of Salamin et al. (Appl. Environ. Microbiol., 76 (2010) 4269-4276), which showed that serine type protease activity in the media of P. pastoris was completed inhibited with PMSF. In addition, Vad et al. (J. Biotechnol. 116 (2005) 251-260) reported high production, over 300 mg/l, of intact human parathyroid hormone in P. pastoris in the presence of 10 mM EDTA combined with co-expression of Saccharomyces cerevisiae protein disulphide isomerase.
[0377] All GnTII/I fusion proteins containing each of the four spacer variants possessed GnTII/I activity, and the activity of the enzymes having the 2.times.G4S and EGIV spacer variants had higher activities that the GnTII/I fusion protein containing the wild-type spacer.
Example 6
Use of Fusion Proteins with Man5 as the Acceptor Glycan
[0378] Construction of Rituximab-Expressing T. Reesei Strain with Man5 Type N-glycosylation
[0379] The native rituximab sequence is codon harmonized. Original plasmids containing the synthesized rituximab light chain and heavy chain are generated. The antibody chains and CBHI fusion protein are designed with 40-nucleotide overlapping sequences as are the expression vectors pHHO1 (acetamidase selection marker, cbh1 flanks for integration into the cbh1 locus) for the heavy chain or pHHO2 (hygromycin selection marker, egl1 flanks for integration into the egl1 locus) for the light chain, to enable cloning using yeast homologous recombination.
[0380] The obtained gene plasmids are transformed into E. coli. DNA is prepared, and the synthetic genes are digested and isolated from the plasmid backbones. The expression vectors are constructed by yeast homologous recombination on the T. reesei expression vectors with the CBHI fusion protein and either heavy or light chain. The recombined plasmids are rescued from yeast and transformed into E. coli. After PCR screening, correct clones are isolated and sequenced. The expression cassette fragments are digested and isolated from the plasmid backbone resulting in around 10.2 kb fragments for the heavy chain constructs and 10.8 kb fragments for the light chain constructs. The heavy and light chain fragments are cotransformed into the T. reesei strain M124. Transformants are selected for hygromycin resistance and ability to grow on acetamide as a sole nitrogen source. Transformants are streaked on the double selective medium for two successive rounds and tested by PCR for integration of the expression constructs into the genome.
[0381] Introduction of GnTII/I Tandem Enzyme and Mannosidase II to T. Reesei Strain Expressing Rituximab Antibody
[0382] In addition to introducing a recombinant GnTII/I into a Man5-producing strain such as M124, a mannosidase II activity is further needed to remove two mannoses from the GlcNAcMan5 glycan structure so that GnTII/I can use GlcNAcMan3 as an acceptor molecule.
[0383] The GnTII/I expression cassette described in previous examples can be targeted to, for example, the cbh2 locus of T. reesei, using methods essentially as described above. To generate a GlcNAcMan3 acceptor molecule for GnTII/I fusion protein, mannosidase II activity is then introduced to the strain using transformation methods described above.
[0384] Mannosidase II activity is introduced to the rituximab antibody-expressing M124 strain by designing a desired mannosidase-containing expression cassette with a promoter for driving the mannosidase expression. Useful promoters are those from gpdA or cbh1. Mannosidase II activity can be transformed by random integration followed by screening of strains with most suitable expression level. The expression cassette is linked with a proprietary selection marker gene, or a selection marker is co-transformed as a separate expression cassette. Transformation is performed according methods described above.
[0385] A mannosidase II fusion construct can be derived from a T. reesei cytoplasmic, transmembrane and stem domain, or targeting peptide, of KRE2 and ligated in-frame to an N-terminal amino acid deletion of a human mannosidase II. The encoded fusion protein localizes in the ER/Golgi by means of the KRE2 targeting peptide sequence while retaining its mannosidase catalytic domain activity and is capable of hydrolyzing GlcNAcMan5GlcNAc2 into GlcNAcMan3GlcNAc2. In certain embodiments, a full-length human mannosidase II can be expressed in an M124 strain.
[0386] The KRE2 targeting peptide comprises the amino acids from about 1 to about 106 or from about 1 to about 83 of KRE2.
TABLE-US-00013 Kre2 aa 1-106 (SEQ ID NO: 115) MASTNARYVRYLLIAFFTILVFYFVSNSKYEGVDLNKGTFTAPDSTKTTP KPPATGDAKDFPLALTPNDPGFNDLVGIAPGPRMNATFVTLARNSDVWDI ARSIRQ Kre2 aa 1-83 (SEQ ID NO: 116) MASTNARYVRYLLIAFFTILVFYFVSNSKYEGVDLNKGTFTAPDSTKTTP KPPATGDAKDFPLALTPNDPGFNDLVGIAPGPR
[0387] After transformation of Trichoderma with the mannosidase II construct described above, Trichoderma strains are selected, streaked on selective medium for two successive rounds, and tested by PCR for integration of the expression constructs into the genome. Selected transformants of Trichoderma strains producing Man5 and expressing the GnTII/I fusion protein, mannosidase II, and rituximab antibody are then cultured in shake flasks or fermentor conditions and analyzed for glycan content as described above.
Example 7
Expression of GnTI and GnTII in T. Reesei
[0388] Transformation of T. Reesei M124 with GnTI Construct by Random Integration
[0389] Codon optimized human GntI was transformed into the T. reesei M124 strain. The GntI gene was cloned into a vector under the control of two different promoters: (1) the inducible promoter of the cbh1 gene; and (2) the constitutively expressed promoter of the gpdA gene. The vectors containing GntI under either of the two promoters were each co-transformed into the T. reesei M124 strain with a plasmid containing either an acetamidase or a hygromycin resistance marker gene.
[0390] Thirty-four transformants with GntI under the gpdA promoter and under acetamide selection were screened by PCR, and all were positive for GntI. For transformants with GntI under the cbh1 promoter and under acetamide selection, 19 of 26 were PCR-positive for the GntI construct. In addition, initial DNA extraction was performed for five strains with GntI under the cbh1 promoter and under hygromycin selection. All of these strains were PCR-positive. Twenty-five gpdA promoter transformants and all of the cbh1 promoter transformants (14+5) were purified to uninuclear clones and spore suspensions were prepared.
[0391] For initial analysis purposes, 23 gpdA promoter transformants and 19 cbh1 promoter transformants (14 grown from acetamide and five from hygromycin selection), as well as the parental strain M124 were cultivated in 250 ml shake flasks with 50 ml of Trichoderma minimal medium supplied with 2% spent grain extract and 4% lactose. Growth of the strains was monitored by pH measurements. Samples (supernatants and mycelia) were collected on days 3, 5, and 7, stored frozen until used for glycan structure analysis.
[0392] Glycan Analysis of T. Reesei GnTI Strains Obtained by Random Integration
[0393] The protein concentration of all supernatant samples was measured by Bradford-based assay (BioRad Quickstart Bradford Protein Assay) using BSA as a standard. Secreted protein content of samples subjected to N-glycan analysis was adjusted to 5 .mu.g or 10 .mu.g. N-glycan analysis was performed either on 96-well plates for 5 .mu.g of supernatant protein, or in 1.5 ml tubes for 10 .mu.g of supernatant protein. All N-glycan analyses were performed in triplicate. Both neutral and acidic N-glycans were analyzed with MALDI-TOF MS.
[0394] To get more exact measurements of the amount of the GnT1 product Gn1Hex5 produced in four of GnT1 transformants (from days 3 and 5) and also of the amount of produced acidic N-glycans, the MALDI spectra was spiked with a known glycan. For neutral and acidic N-glycans, an internal calibrant of 2 pmol/spectrum Hex2HexNAc4 at the mass value of 1177 Da and 0.5 pmol of monosialylated Hex4HexNAc2 at the mass value of 1362 Da were used, respectively. Analyses were performed in triplicate.
[0395] No GnT1 product was observed in any of the gpdA promoter transformants. However, eight cbhI promoter transformants produced the GnT1 product Gn1Man5 (FIGS. 34 and 35, and Table 13); five with hygromycin selection, three with acetamide selection.
TABLE-US-00014 TABLE 13 The percentages of signal intensities of Man5 and Gn1Man5 compared to internal calibrant Hex2HexNAc4 in four positive GnT1 transformants and parental M124 strain on days 3 and 5. Man5 is the main glycoform in parental M124 strain. M1241., day 3 M1241., day 5 Composition m/z Average SD RSD MIN MAX Average SD RSD MIN MAX Hex2HexNAc4 1177.42 97.7 0.5 0.5 97.1 98.0 36.5 0.8 2.3 35.9 37.1 Hex5HexNAc2 1257.42 2.3 0.5 22.5 2.0 2.9 63.5 0.8 1.3 62.9 64.1 Hex5HexNAc3 1460.5 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 M124/GNT1, clone HM1, day 3 M124/GNT1, clone HM1, day 5 Composition m/z Average SD RSD MIN MAX Average SD RSD MIN MAX Hex2HexNAc4 1177.42 78.5 14.5 18.4 68.2 88.7 50.1 10.6 21.2 42.6 57.6 Hex5HexNAc2 1257.42 14.5 9.9 68.0 7.5 21.5 44.0 9.6 21.9 37.2 50.8 Hex5HexNAc3 1460.5 7.1 4.6 65.6 3.8 10.3 5.9 1.0 16.7 5.2 6.6 M124/GNT1, clone 8, day 3 M124/GNT1, clone 8, day 5 Composition m/z Average SD RSD MIN MAX Average SD RSD MIN MAX Hex2HexNAc4 1177.42 77.3 7.6 9.8 72.0 82.7 67.3 10.0 14.9 56.5 76.3 Hex5HexNAc2 1257.42 15.0 5.2 34.4 11.4 18.7 18.9 6.2 32.5 12.8 25.1 Hex5HexNAc3 1460.5 7.6 2.4 31.6 5.9 9.3 13.8 4.0 29.1 10.8 18.3 M124/GNT1, clone 39, day 3 M124/GNT1, clone 39, day 5 Composition m/z Average SD RSD MIN MAX Average SD RSD MIN MAX Hex2HexNAc4 1177.42 83.7 1.5 1.8 82.7 84.8 40.0 1.9 4.6 37.9 41.1 Hex5HexNAc2 1257.42 8.3 1.0 11.7 7.6 8.9 46.9 1.8 3.8 45.6 49.0 Hex5HexNAc3 1460.5 8.0 0.6 6.9 7.6 8.4 13.1 0.3 2.1 12.7 13.3 M124/GNT1, clone 90, day 3 M124/GNT1, clone 90, day 5 Composition m/z Average SD RSD MIN MAX Average SD RSD MIN MAX Hex2HexNAc4 1177.42 93.8 1.6 1.7 92.4 95.6 92.6 2.7 2.9 89.8 95.3 Hex5HexNAc2 1257.42 3.7 1.0 25.9 2.6 4.5 4.7 1.4 30.9 3.2 6.0 Hex5HexNAc3 1460.5 2.5 0.7 26.2 1.8 3.1 2.7 1.3 47.8 1.5 4.1
[0396] The GnT1 products Gn1Man6P1, Gn1Man7P1, and Gn1Man8P1 were also found in phosphorylated N-glycans of all positive transformants. The amount of phosphorylated N-glycans had increased in GnT1 transformants, and the profile was biased toward larger N-glycans, with Man7P1 or Man8P1 having the strongest signal (Man6P1 in parental M124) (FIG. 36).
[0397] Eight GnTI transformants produced the Gn1Man5 structure. Gn1Man5 was most abundant in clone 39. However, the best clone appeared to be clone 8, which produced the second highest level of Gn1Man5, but had a high proportion of Man5 and Gn1Man5 (FIG. 35). Clone 8, which contains GnTI under the control of the cbhI promoter, was named strain M198, and was selected for continued analysis.
[0398] Transformation of T. Reesei M198 Strain with GnTII Construct by Targeted Integration
[0399] Five GnTII-harboring vectors were created (Table 14). Two of the vectors contained the native mammalian Golgi targeting peptide in GNTII. In the three other vectors, the mammalian targeting peptide was replaced by a T. reesei MNT1 (.alpha.-1,2-mannosyltransferase) targeting peptide. All five vectors contained either a cbh1 promoter or a gpdA promoter, and a pyr4 loop-out marker. Additionally, all five vectors were targeted to integrate into the alg3 locus, thus deleting the alg3 gene. In the MNT1/GnTII constructs under the cbh1 promoter, two different sized GnTII sequence deletions were tested.
TABLE-US-00015 TABLE 14 Constructed GNT2 vectors. N-terminal Plasmid name Promoter Targeting peptide deletion (GnTII) pTTv140 cbh1 mammalian N/A pTTv141 gpdA mammalian N/A pTTv142 cbh1 Trichoderma MNT1 74 amino acids pTTv143 cbh1 Trichoderma MNT1 104 amino acid pTTv144 gpdA Trichoderma MNT1 74 amino acids
[0400] These vectors, except for the pTTv144 vector, were transformed into the best py4-negative GnTI producing strain M198 (M319) as PmeI fragments. Transformants were purified to uninuclear clones and PCR screened. Clones showing the correct integration at both ends were then selected for continued analysis.
[0401] To study the growth characteristics of the generated GNTII-expressing strains, large shake flask cultures were prepared. Shake flask culture were prepared in two separate batches. The first batch contained pTTv140, pTTv142, and pTTv143. The second batch contained pTTv141. The parental strain M198 was used as a control strain. The cells were grown in TrMM medium supplemented with 40 g/l lactose, 20 g/l spent grain extract, and 100 mM PIPPS, pH 5.5. Five transformants per construct were cultured. The pTTv140, pTTv142, and pTTv143 cultures were sampled on days 3, 5, 7, and 9. The pTTv141 cultures were sampled on days 3, 5, 7, and 10. The pH and cell dry weight of each sample were measured and culture supernatant samples were used for glycan structure analysis.
[0402] Glycan Analysis of T. Reesei Strains Obtained by Targeting GnTII to alg3 Locus of T. Reesei M198 Strain
[0403] Five different clones containing the pTTv140 vector (containing the native targeting peptide and the cbh1 promoter), the pTTv142 vector (containing the MNT1 targeting peptide, the GNTII 74 aa N-terminal deletion, and the cbh1 promoter), the pTTv143 vector (containing the MNT1 targeting peptide, the GNTII 110 aa N-terminal deletion, and the cbh1 promoter), and the pTTv141 vector (containing the targeting peptide and the gpdA promoter) were analyzed.
[0404] N-glycan analyses were prepared in triplicate for day 5 samples, and in duplicate for day 3 and 7 samples on 96-well plates for 5 .mu.g of supernatant protein. The protein concentrations of the supernatants were measured by Bradford-based assay (BioRad Quickstart Bradford Protein Assay) using BSA as a standard. PNGase F reactions were performed as described. The released N-glycans were first purified with Hypersep C-18 100 mg and then with Hypersep Hypercarb 10 mg (both from Thermo Scientific) where neutral and acidic glycans were separated. Both purifications were performed in 96-well format. Neutral N-glycans were analyzed by MALDI-TOF MS.
[0405] N-glycans of Four Different Strains Transformed with GnTII were Analyzed Clone
[0406] 1-117A, which was transformed with the pTTv140 vector, and thus contained the native targeting peptide and the cbh1 promoter, produced about 40% of G0 and about 13% of Hex6 (FIG. 37A). Clones transformed with the pTTv143 vector, thus containing the MNT1 targeting peptide, the GnTII 110 aa N-terminal deletion, and the cbh1 promoter, produced about 10% of G0 (FIG. 37C). Clone 3B, which contained the gbdA promoter produced about 28% of G0 and about 19% of Hex6 (FIG. 37D).
[0407] The glycosylation patterns of representative clones containing the pTTv140, pTTv141, and pTTv142 vectors were also shown to be stable as function of time (FIG. 38).
[0408] Protein Specific Glycosylation
[0409] To analyze protein specific changes in glycosylation, samples from the pTTv142 vector-containing clone 3-17A and from the parental strain M198 were separated with SDS-PAGE and blotted to a PVDF membrane. The protein bands of interest (four bands of M198 and four of the 3-17A clone) were excised, and the N-glycans were liberated with on-membrane enzymatic release with PNGase F (FIG. 39).
[0410] Detached and purified neutral N-glycans were analyzed using MALDI-TOF MS. The glycosylation pattern of total secreted proteins was similar to a separated 50 kDa protein of the M198 parental strain (FIG. 40). The smallest size protein band was unglycosylated.
[0411] In the GnTII clone 3-17A, most of the untypical signals had disappeared, confirming their origin from the medium. Additionally, the glycosylation pattern of clone 3-17A differed from the glycan patterns of total secreted proteins (FIG. 40B). The amount of G0 from clone 3-17A was about 35 to 36% (FIG. 40B).
[0412] Fermenter Cultivation of GnTII Strain
[0413] Fermenter cultivation of the GnTII strain 1-117A M329 (which contains the pTTv140vector) was fermented in TrMM pH 5.5+2% Spent grain extract+6% lactose+0.5% KH.sub.2PO.sub.4+0.5% (NH.sub.4).sub.2SO.sub.4 at +28.degree. C. (pH 5.5). N-glycan analysis was performed in triplicate to 5 .mu.g of the secreted proteins described in the "Protein specific glycosylation" section above on samples taken on day 3. The amount of G0 was about 48% and the amount of Hex6 was about 19% on day 3 (FIG. 41).
Example 8
T. Reesei ALG3 Homologs
[0414] Transformation of T. Reesei M124 with GnTI Construct by Random Integration
[0415] T. reesei ALG3 homologs were identified from other organisms. These homologs can be used to design ALG3 deletion constructs for filamentous fungal cells other than T reesei. The ALG3 homologs are listed in Table 15. A multiple amino acid sequence alignment of T. reesei ALG3 and ALG3 homologs are shown in FIG. 42.
TABLE-US-00016 TABLE 15 ALG3 Homologs. Reference sequence Organism SEQ ID NO: Trire2|104121|fgenesh5_pg.C_scaffold_3000076 Trichoderma reesei 126 Triat2|270085|fgenesh1_pg.contig_14_#_149 Trichoderma atroviride 127 TriviGv29_8_2|194462|fgenesh1_pm.87_#_115 Trichoderma virens 128 EGU81920.1 Fusarium oxysporum Fo5176 129 XP_389829.1 Gibberella zeae PH-1 130 AEO60805.1 Myceliophthora thermophila 131 XP_962259.1 Neurospora crassa OR74A 132 XP_001824044.1 Aspergillus oryzae RIB40 133 XP_001259497.1 Neosartorya fischeri NRRL 181 134 XP_001398696.2 Aspergillus niger CBS 513.88 135 XP_362427.2 Magnaporthe oryzae 70-15 136 NP_593853.1 Schizosaccharomyces pombe 972h 137
Example 9
GnTII/GnTI Fusion Protein Variants
[0416] Generation of GnTII/GnTI Expression Construct
[0417] A recombinant GnTI/II fusion protein under the control of the inducible promoter cbh1 and containing 1 of 4 spacer variants is constructed as described in Examples 4 and 5. The four spacer variants are the 2.times.G4S spacer, the 3.times.G4S spacer, the CBHI spacer, and the EGIV spacer.
[0418] Briefly, the fusion fragments are amplified from GnTII and GnTI templates separately with primers containing 50 bp in-frame overlaps at the fusion site. Fragments are purified from an agarose gel and used as PCR template for amplification of the fusion construct according to standard procedures. The fusion construct is cloned into a vector with ApaI/SpeI restriction sites, under the control of the inducible promoter cbh1. Additionally, the native mammalian Golgi targeting peptide in the GNTII domain was replaced by a T. reesei MNT1 (.alpha.-1,2-mannosyltransferase) targeting peptide.
[0419] To introduce the 2.times.G4S spacer variants into the fusion protein, T45 sequence is amplified in two parts by using PCR overlapping strategy. First, a fragment is amplified with AKT1-6-1 5' primer (GGTACCGGGCCCACTGCGCATCATGCGCTTCCGAATCTACAAGCG (SEQ ID NO: 146)) and GP93 3' primer, and a second fragment is amplified with GP92 5' primer and AKT1-6-4 3' primer (GGCGCGCCACTAGTCTAATTCCAGCTGGGATCATAGCC (SEQ ID NO: 147)). Amplification is carried out with Phusion high-fidelity PCR polymerase (Finnzymes) under the standard conditions provided by the supplier. Cycling conditions are as described in Example 5. The resulting PCR product is purified from the agarose gel, and the fragments with overlapping, modified sequences are combined in the same reaction mixture with standard conditions without primers. Ten annealing/extension cycles are carried out as described in Example 5. Primers AKT1-6-1 (5') and AKT1-6-4 (3') are added, and cycling is continued as described in Example 5 for 20 amplification cycles. The amplified T45 fragment is then purified, digested with ApaI/SpeI (New England Biolabs) according to standard protocols, and cloned into the Trichoderma reesei expression vector. The cloned fragment is then verified by sequencing with appropriate set of primers and the generated sequence is used for construction of T. reesei expression vector with 2.times.G4S promoter and alg3 targeting.
[0420] The resulting plasmid is used as a template for the 3.times.G4S spacer modification. Cloning of the T46 sequence is done as described above with T45. AKT1-6-1 5'-primer and GP95 3'-primer are used for first fragment synthesis, and GP94 5'-primer and AKT1-6-4 3'-primer are used for second fragment synthesis. Fragments are combined, and primers AKT1-6-1 (5') and AKT1-6-4 (3') are added for amplification. Amplified fragment T46 is then digested with ApaI/SpeI and cloned into the Trichoderma reesei expression vector. The cloned fragment is then verified by sequencing with an appropriate set of primers and the generated sequence is used for construction of T. reesei expression vector with 3.times.G4S promoter and alg3 targeting.
[0421] The CBHI and EGIV spacers are constructed with a similar PCR overlap method. For the CBHI spacer, the first fragment is amplified with AKT1-6-1 5'-primer and GP107 3'-primer. The second fragment is amplified with GP108 5'-primer and AKT1-6-4 3'-primer (Table 11). For the EGIV spacer, the first fragment is amplified with AKT1-6-1 5'primer and GP109 3'primer. The second fragment is amplified with GP110 5'-primer and AKT1-6-4 3'-primer (Table 11). In both cases, the PCR products are purified from agarose gel, combined, and used as a template for the next PCR reaction to amplify the sequences T50 and T51. T50 and T51 PCR products are then digested with ApaI/SpeI and cloned into the Trichoderma reesei expression vector. The cloned fragments are then verified by sequencing with appropriate sets of primers and the generated sequences are used for construction of T. reesei expression vectors with either CBHI or EGIV promoter and alg3 targeting.
[0422] All PCR amplifications are made with high-fidelity Phusion polymerase (Finnzymes). Primers (Table 11) are ordered from MWG Operon. Sequencing is performed by the DNA Sequencing Laboratory of the Institute of Biotechnology, University of Helsinki, as a commercial service.
[0423] The Trichoderma reesei expression vectors with the described chimeric GnTII/GnTI sequences with spacer variations (2.times.G4S, 3.times.G4S, CBHI, and EGIV) are subcloned under the control of the cbh1 promoter, with a pyr4 gene loopout marker and alg3 flanking region fragments for targeted integration in the backbone are then constructed. Expression cassettes are transformed into T. reesei strain M279 (pyr4.sup.- strain of M202). After plate selection, the clones are PCR-screened and purified through single spores. To obtain material for glycan analyses, shake flask cultivations are performed as described.
[0424] Introduction of GnTII/I Fusion Protein Variants to T. Reesei Strain Expressing Rituximab Antibody
[0425] The recombinant GnTII/I fusion protein variants are introduced into the rituximab-expressing T. reesei strain M279 described in Example 5.
[0426] Briefly, the vectors having the GnTII/GnTI fusion protein under the control of the cbh1 promoter, the MNTI targeting peptide, the pyr4 loop-out marker, and each of the 4 spacer variants are each subcloned into a backbone vector between alg3 flanking region fragments for targeted integration, thus deleting the alg3 gene. A PmeI-digested expression cassette is transformed into T. reesei strain M279 (a pyr4.sup.- strain). After plate selection, the clones are PCR-screened and purified through single spores.
[0427] Glycan Analysis of Rituximab-Producing T. reesei GnTII/GnTI Variant Strains Obtained by Targeting to alg3 Locus
[0428] To obtain material for glycan analysis, shake flask cultivations are performed as described in Example 5 and, in addition, some culture media are supplemented with 0.3 mg/ml soybean trypsin inhibitor (SBTI) and 1% casamino acids. SBTI is added first at inoculation and then daily on days 3-6. PMSF and Pepstatin A is added to all samples before freezing.
[0429] Rituximab is purified with Protein G affinity chromatography from day 5 supernatant samples with SBTI and from day 5 and 7 samples without SBTI. PNGase F reactions are performed for .about.10 .mu.g of denatured protein. The released N-glycans are first purified with Hypersep C-18 and then with Hypersep Hypercarb (both from Thermo Scientific) where neutral and acidic glycans are separated. The purification steps are performed in 96-well format. Neutral and acidic N-glycans are analyzed by MALDI-TOF MS to test for the presence of the G0 glycoform on the rituximab antibody.
Sequence CWU
1
1
1471445PRTHomo sapiens 1Met Leu Lys Lys Gln Ser Ala Gly Leu Val Leu Trp
Gly Ala Ile Leu1 5 10 15
Phe Val Ala Trp Asn Ala Leu Leu Leu Leu Phe Phe Trp Thr Arg Pro
20 25 30 Ala Pro Gly Arg
Pro Pro Ser Val Ser Ala Leu Asp Gly Asp Pro Ala 35
40 45 Ser Leu Thr Arg Glu Val Ile Arg Leu
Ala Gln Asp Ala Glu Val Glu 50 55 60
Leu Glu Arg Gln Arg Gly Leu Leu Gln Gln Ile Gly Asp Ala
Leu Ser65 70 75 80
Ser Gln Arg Gly Arg Val Pro Thr Ala Ala Pro Pro Ala Gln Pro Arg
85 90 95 Val Pro Val Thr Pro
Ala Pro Ala Val Ile Pro Ile Leu Val Ile Ala 100
105 110 Cys Asp Arg Ser Thr Val Arg Arg Cys Leu
Asp Lys Leu Leu His Tyr 115 120
125 Arg Pro Ser Ala Glu Leu Phe Pro Ile Ile Val Ser Gln Asp
Cys Gly 130 135 140
His Glu Glu Thr Ala Gln Ala Ile Ala Ser Tyr Gly Ser Ala Val Thr145
150 155 160 His Ile Arg Gln Pro
Asp Leu Ser Ser Ile Ala Val Pro Pro Asp His 165
170 175 Arg Lys Phe Gln Gly Tyr Tyr Lys Ile Ala
Arg His Tyr Arg Trp Ala 180 185
190 Leu Gly Gln Val Phe Arg Gln Phe Arg Phe Pro Ala Ala Val Val
Val 195 200 205 Glu
Asp Asp Leu Glu Val Ala Pro Asp Phe Phe Glu Tyr Phe Arg Ala 210
215 220 Thr Tyr Pro Leu Leu Lys
Ala Asp Pro Ser Leu Trp Cys Val Ser Ala225 230
235 240 Trp Asn Asp Asn Gly Lys Glu Gln Met Val Asp
Ala Ser Arg Pro Glu 245 250
255 Leu Leu Tyr Arg Thr Asp Phe Phe Pro Gly Leu Gly Trp Leu Leu Leu
260 265 270 Ala Glu Leu
Trp Ala Glu Leu Glu Pro Lys Trp Pro Lys Ala Phe Trp 275
280 285 Asp Asp Trp Met Arg Arg Pro Glu
Gln Arg Gln Gly Arg Ala Cys Ile 290 295
300 Arg Pro Glu Ile Ser Arg Thr Met Thr Phe Gly Arg Lys
Gly Val Ser305 310 315
320 His Gly Gln Phe Phe Asp Gln His Leu Lys Phe Ile Lys Leu Asn Gln
325 330 335 Gln Phe Val His
Phe Thr Gln Leu Asp Leu Ser Tyr Leu Gln Arg Glu 340
345 350 Ala Tyr Asp Arg Asp Phe Leu Ala Arg
Val Tyr Gly Ala Pro Gln Leu 355 360
365 Gln Val Glu Lys Val Arg Thr Asn Asp Arg Lys Glu Leu Gly
Glu Val 370 375 380
Arg Val Gln Tyr Thr Gly Arg Asp Ser Phe Lys Ala Phe Ala Lys Ala385
390 395 400 Leu Gly Val Met Asp
Asp Leu Lys Ser Gly Val Pro Arg Ala Gly Tyr 405
410 415 Arg Gly Ile Val Thr Phe Gln Phe Arg Gly
Arg Arg Val His Leu Ala 420 425
430 Pro Pro Pro Thr Trp Glu Gly Tyr Asp Pro Ser Trp Asn
435 440 445 2445PRTPan troglodytes 2Met
Leu Lys Lys Gln Ser Ala Gly Leu Val Leu Trp Gly Ala Ile Leu 1
5 10 15 Phe Val Ala Trp Asn Ala
Leu Leu Leu Leu Phe Phe Trp Thr Arg Pro 20 25
30 Ala Pro Gly Arg Pro Pro Ser Val Ser Ala Leu
Asp Asp Asp Pro Ala 35 40 45
Ser Leu Thr Arg Glu Val Ile Arg Leu Ala Gln Asp Ala Glu Val Glu
50 55 60 Leu Glu Arg
Gln Arg Gly Leu Leu Gln Gln Ile Gly Asp Ala Leu Ser65 70
75 80 Ser Gln Arg Gly Arg Val Pro Thr
Ala Ala Pro Pro Ala Gln Pro Arg 85 90
95 Val Pro Val Thr Pro Ala Pro Ala Val Ile Pro Ile Leu
Val Ile Ala 100 105 110
Cys Asp Arg Ser Thr Val Arg Arg Cys Leu Asp Lys Leu Leu His Tyr
115 120 125 Arg Pro Ser Ala
Glu Leu Phe Pro Ile Ile Val Ser Gln Asp Cys Gly 130
135 140 His Glu Glu Thr Ala Gln Ala Ile
Ala Ser Tyr Gly Ser Ala Val Thr145 150
155 160 His Ile Arg Gln Pro Asp Leu Ser Ser Ile Ala Val
Pro Pro Asp His 165 170
175 Arg Lys Phe Gln Gly Tyr Tyr Lys Ile Ala Arg His Tyr Arg Trp Ala
180 185 190 Leu Gly Gln
Val Phe Arg Gln Phe Gly Phe Pro Ala Ala Val Val Val 195
200 205 Glu Asp Asp Leu Glu Val Ala Pro
Asp Phe Phe Glu Tyr Phe Gln Ala 210 215
220 Thr Tyr Pro Leu Leu Lys Ala Asp Pro Ser Leu Trp Cys
Val Ser Ala225 230 235
240 Trp Asn Asp Asn Gly Lys Glu Gln Met Val Asp Ala Ser Arg Pro Glu
245 250 255 Leu Leu Tyr Arg
Thr Asp Phe Phe Pro Gly Leu Gly Trp Leu Leu Leu 260
265 270 Ala Glu Leu Trp Ala Glu Leu Glu Pro
Lys Trp Pro Lys Ala Phe Trp 275 280
285 Asp Asp Trp Met Arg Arg Pro Glu Gln Arg Gln Gly Arg Ala
Cys Ile 290 295 300
Arg Pro Glu Ile Ser Arg Thr Met Thr Phe Gly Arg Lys Gly Val Ser305
310 315 320 His Gly Gln Phe Phe
Asp Gln His Leu Lys Phe Ile Lys Leu Asn Gln 325
330 335 Gln Phe Val His Phe Thr Gln Leu Asp Leu
Ser Tyr Leu Gln Arg Glu 340 345
350 Ala Tyr Asp Arg Asp Phe Leu Ala Arg Val Tyr Gly Ala Pro Gln
Leu 355 360 365 Gln
Val Glu Lys Val Arg Thr Asn Asp Arg Lys Glu Leu Gly Glu Val 370
375 380 Arg Val Gln Tyr Thr Gly
Arg Asp Ser Phe Lys Ala Phe Ala Lys Ala385 390
395 400 Leu Gly Val Met Asp Asp Leu Lys Ser Gly Val
Pro Arg Ala Gly Tyr 405 410
415 Arg Gly Ile Val Thr Phe Gln Phe Arg Gly Arg Arg Val His Leu Ala
420 425 430 Pro Pro Pro
Thr Trp Glu Gly Tyr Asp Pro Ser Trp Asn 435 440
445 3445PRTPongo abelii 3Met Leu Lys Lys Gln Ser Ala Gly Leu
Val Leu Trp Gly Ala Ile Leu 1 5 10
15 Phe Val Ala Trp Asn Ala Leu Leu Leu Leu Phe Phe Trp Thr
Arg Pro 20 25 30
Ala Pro Gly Arg Pro Pro Ser Val Ser Ala Leu Asp Asp Asp Pro Ala 35
40 45 Ser Leu Thr Arg Glu
Val Ile Arg Leu Ala Gln Asp Ala Glu Val Glu 50 55
60 Leu Glu Arg Gln Arg Gly Leu Leu Gln Gln
Ile Gly Asp Ala Leu Trp65 70 75
80 Ser Gln Arg Gly Arg Val Pro Thr Pro Ala Leu Pro Ala Gln Pro
Arg 85 90 95 Val
Pro Ala Thr Pro Ala Pro Ala Val Ile Pro Ile Leu Val Ile Ala
100 105 110 Cys Asp Arg Ser Thr
Val Arg Arg Cys Leu Asp Lys Leu Leu Gln Tyr 115
120 125 Arg Pro Ser Ala Glu Leu Phe Pro Ile
Ile Val Ser Gln Asp Cys Gly 130 135
140 His Glu Glu Thr Ala Gln Ala Ile Ala Ser Tyr Gly Ser
Ala Val Thr145 150 155
160 His Ile Arg Gln Pro Asp Leu Ser Ser Ile Ala Val Pro Pro Asp His
165 170 175 Arg Lys Phe Gln
Gly Tyr Tyr Lys Ile Ala Arg His Tyr Arg Trp Ala 180
185 190 Leu Gly Gln Ile Phe Gln Arg Phe Arg
Phe Pro Ala Ala Val Val Val 195 200
205 Glu Asp Asp Leu Glu Val Ala Pro Asp Phe Phe Glu Tyr Phe
Gln Ala 210 215 220
Thr Tyr Pro Leu Leu Lys Ala Asp Pro Ser Leu Trp Cys Val Ser Ala225
230 235 240 Trp Asn Asp Asn Gly
Lys Glu Gln Met Val Asp Ala Ser Lys Pro Glu 245
250 255 Leu Leu Tyr Arg Thr Asp Phe Phe Pro Gly
Leu Gly Trp Leu Leu Leu 260 265
270 Ala Glu Leu Trp Ala Glu Leu Glu Pro Lys Trp Pro Lys Ala Phe
Trp 275 280 285 Asp
Asp Trp Met Arg Arg Pro Glu Gln Arg Lys Gly Arg Ala Cys Ile 290
295 300 Arg Pro Glu Ile Ser Arg
Thr Met Thr Phe Gly Arg Lys Gly Val Ser305 310
315 320 His Gly Gln Phe Phe Asp Gln His Leu Lys Phe
Ile Lys Leu Asn Gln 325 330
335 Gln Phe Val His Phe Thr Gln Leu Asp Leu Ser Tyr Leu Gln Arg Glu
340 345 350 Ala Tyr Asp
Arg Asp Phe Leu Ala Arg Val Tyr Gly Ala Pro Gln Leu 355
360 365 Gln Val Glu Lys Val Arg Thr Asn
Asp Arg Lys Glu Leu Gly Glu Val 370 375
380 Arg Val Gln Tyr Thr Gly Arg Asp Ser Phe Lys Ala Phe
Ala Lys Ala385 390 395
400 Leu Gly Val Met Asp Asp Leu Lys Ser Gly Val Pro Arg Ala Gly Tyr
405 410 415 Arg Gly Ile Val
Thr Phe Gln Phe Arg Gly Arg Arg Val His Leu Ala 420
425 430 Pro Pro Pro Thr Trp Glu Gly Tyr Asp
Pro Ser Trp Asn 435 440 445
4445PRTMacaca mulatta 4Met Leu Lys Lys Gln Ser Ala Gly Leu Val Leu Trp
Gly Ala Ile Leu 1 5 10 15
Phe Val Ala Trp Asn Ala Leu Leu Leu Leu Phe Phe Trp Thr Arg Pro
20 25 30 Ala Pro Gly Arg
Pro Pro Ser Val Ser Ala Leu Asn Asp Asp Pro Ala 35
40 45 Ser Leu Thr Arg Glu Val Ile Arg Leu
Ala Gln Asp Ala Glu Val Glu 50 55 60
Leu Glu Arg Gln Arg Gly Leu Leu Gln Gln Ile Gly Asp Ala
Leu Trp65 70 75 80
Ser Gln Arg Gly Arg Val Pro Thr Ala Gly Pro Pro Ala Gln Pro His
85 90 95 Val Pro Val Thr Pro
Ala Pro Ala Val Ile Pro Ile Leu Val Ile Ala 100
105 110 Cys Asp Arg Ser Thr Val Arg Arg Cys Leu
Asp Lys Leu Leu His Tyr 115 120
125 Arg Pro Ser Ala Glu Arg Phe Pro Ile Ile Val Ser Gln Asp
Cys Gly 130 135 140
His Glu Glu Thr Ala Gln Ala Ile Ala Ser Tyr Gly Ser Ala Val Thr145
150 155 160 His Ile Arg Gln Pro
Asp Leu Ser Ser Ile Ala Val Pro Pro Asp His 165
170 175 Arg Lys Phe Gln Gly Tyr Tyr Lys Ile Ala
Arg His Tyr Arg Trp Ala 180 185
190 Leu Gly Gln Val Phe His Arg Phe Arg Phe Pro Ala Ala Val Val
Val 195 200 205 Glu
Asp Asp Leu Glu Val Ala Pro Asp Phe Phe Glu Tyr Phe Gln Ala 210
215 220 Thr Tyr Pro Leu Leu Lys
Ala Asp Pro Ser Leu Trp Cys Val Ser Ala225 230
235 240 Trp Asn Asp Asn Gly Lys Glu Gln Met Val Asp
Ser Gly Lys Pro Glu 245 250
255 Leu Leu Tyr Arg Thr Asp Phe Phe Pro Gly Leu Gly Trp Leu Leu Leu
260 265 270 Ala Glu Leu
Trp Ala Glu Leu Glu Pro Lys Trp Pro Lys Ala Phe Trp 275
280 285 Asp Asp Trp Met Arg Arg Pro Glu
Gln Arg Lys Gly Arg Ala Cys Ile 290 295
300 Arg Pro Glu Ile Ser Arg Thr Met Thr Phe Gly Arg Lys
Gly Val Ser305 310 315
320 His Gly Gln Phe Phe Asp Gln His Leu Lys Phe Ile Lys Leu Asn Gln
325 330 335 Gln Phe Val His
Phe Thr Gln Leu Asp Leu Ser Tyr Leu Gln Arg Glu 340
345 350 Ala Tyr Asp Arg Asp Phe Leu Ala Arg
Val Tyr Ala Ala Pro Gln Leu 355 360
365 Gln Val Glu Lys Val Arg Thr Asn Asp Arg Lys Glu Leu Gly
Glu Val 370 375 380
Arg Val Gln Tyr Thr Gly Arg Asp Ser Phe Lys Ala Phe Ala Lys Ala385
390 395 400 Leu Gly Val Met Asp
Asp Leu Lys Ser Gly Val Pro Arg Ala Gly Tyr 405
410 415 Arg Gly Ile Val Thr Phe Gln Phe Arg Gly
Arg Arg Val His Leu Ala 420 425
430 Pro Pro Pro Thr Trp Glu Gly Tyr Asp Pro Ser Trp Asn
435 440 445 5447PRTCricetulus griseus
5Met Leu Lys Lys Gln Ser Ala Gly Leu Val Leu Trp Gly Ala Ile Leu 1
5 10 15 Phe Val Gly Trp Asn
Ala Leu Leu Leu Leu Phe Phe Trp Thr Arg Pro 20
25 30 Ala Pro Gly Arg Pro Pro Ser Asp Ser Ala
Ile Asp Asp Asp Pro Ala 35 40 45
Ser Leu Thr Arg Glu Val Phe Arg Leu Ala Glu Asp Ala Glu Val
Glu 50 55 60 Leu
Glu Arg Gln Arg Gly Leu Leu Gln Gln Ile Arg Glu His His Ala65
70 75 80 Leu Trp Arg Gln Arg Trp
Lys Val Pro Thr Val Ala Pro Pro Ala Trp 85
90 95 Pro Arg Val Pro Ala Thr Pro Ser Pro Ala Val
Ile Pro Ile Leu Val 100 105
110 Ile Ala Cys Asp Arg Ser Thr Val Arg Arg Cys Leu Asp Lys Leu
Leu 115 120 125 His
Tyr Arg Pro Ser Ala Glu His Phe Pro Ile Ile Val Ser Gln Asp 130
135 140 Cys Gly His Glu Glu Thr
Ala Gln Val Ile Ala Ser Tyr Gly Ser Ala145 150
155 160 Val Thr His Ile Arg Gln Pro Asp Leu Ser Asn
Ile Ala Val Pro Pro 165 170
175 Asp His Arg Lys Phe Gln Gly Tyr Tyr Lys Ile Ala Arg His Tyr Arg
180 185 190 Trp Ala Leu
Gly Gln Ile Phe Asn Lys Phe Lys Phe Pro Ala Ala Val 195
200 205 Val Val Glu Asp Asp Leu Glu Val
Ala Pro Asp Phe Phe Glu Tyr Phe 210 215
220 Gln Ala Thr Tyr Pro Leu Leu Arg Thr Asp Pro Ser Leu
Trp Cys Val225 230 235
240 Ser Ala Trp Asn Asp Asn Gly Lys Glu Gln Met Val Asp Ser Ser Lys
245 250 255 Pro Glu Leu Leu
Tyr Arg Thr Asp Phe Phe Pro Gly Leu Gly Trp Leu 260
265 270 Leu Met Ala Glu Leu Trp Thr Glu Leu
Glu Pro Lys Trp Pro Lys Ala 275 280
285 Phe Trp Asp Asp Trp Met Arg Arg Pro Glu Gln Arg Lys Gly
Arg Ala 290 295 300
Cys Ile Arg Pro Glu Ile Ser Arg Thr Met Thr Phe Gly Arg Lys Gly305
310 315 320 Val Ser His Gly Gln
Phe Phe Asp Gln His Leu Lys Phe Ile Lys Leu 325
330 335 Asn Gln Gln Phe Val Ser Phe Thr Gln Leu
Asp Leu Ser Tyr Leu Gln 340 345
350 Arg Glu Ala Tyr Asp Arg Asp Phe Leu Ala Arg Val Tyr Ser Ala
Pro 355 360 365 Leu
Leu Gln Val Glu Lys Val Arg Thr Asn Asp Gln Lys Glu Leu Gly 370
375 380 Glu Val Arg Val Gln Tyr
Thr Ser Arg Asp Ser Phe Lys Ala Phe Ala385 390
395 400 Lys Ala Leu Gly Val Met Asp Asp Leu Lys Ser
Gly Val Pro Arg Ala 405 410
415 Gly Tyr Arg Gly Val Val Thr Phe Gln Phe Arg Gly Arg Arg Val His
420 425 430 Leu Ala Pro
Pro Gln Thr Trp Glu Gly Tyr Asp Pro Ser Trp Asn 435
440 445 6447PRTRattus norvegicus 6Met Leu Lys
Lys Gln Ser Ala Gly Leu Val Leu Trp Gly Ala Ile Ile 1 5
10 15 Phe Val Gly Trp Asn Ala Leu Leu
Leu Leu Phe Phe Trp Thr Arg Pro 20 25
30 Ala Pro Gly Arg Leu Pro Ser Asp Ser Ala Leu Gly Asp
Asp Pro Ala 35 40 45
Ser Leu Thr Arg Glu Val Ile His Leu Ala Glu Asp Ala Glu Ala Glu 50
55 60 Leu Glu Arg Gln Arg
Gly Leu Leu Gln Gln Ile Lys Glu His Tyr Ser65 70
75 80 Leu Trp Arg Gln Arg Trp Arg Val Pro Thr
Val Ala Pro Pro Ala Trp 85 90
95 Pro Arg Val Pro Gly Thr Pro Ser Pro Ala Val Ile Pro Ile Leu
Val 100 105 110 Ile
Ala Cys Asp Arg Ser Thr Val Arg Arg Cys Leu Asp Lys Leu Leu 115
120 125 His Tyr Arg Pro Ser Ala
Glu His Phe Pro Ile Ile Val Ser Gln Asp 130 135
140 Cys Gly His Glu Glu Thr Ala Gln Val Ile Ala
Ser Tyr Gly Thr Ala145 150 155
160 Val Thr His Ile Arg Gln Pro Asp Leu Ser Asn Ile Ala Val Gln Pro
165 170 175 Asp His Arg
Lys Phe Gln Gly Tyr Tyr Lys Ile Ala Arg His Tyr Arg 180
185 190 Trp Ala Leu Gly Gln Ile Phe Asn
Lys Phe Lys Phe Pro Ala Ala Val 195 200
205 Val Val Glu Asp Asp Leu Glu Val Ala Pro Asp Phe Phe
Glu Tyr Phe 210 215 220
Gln Ala Thr Tyr Pro Leu Leu Lys Ala Asp Pro Ser Leu Trp Cys Val225
230 235 240 Ser Ala Trp Asn Asp
Asn Gly Lys Glu Gln Met Val Asp Ser Ser Lys 245
250 255 Pro Glu Leu Leu Tyr Arg Thr Asp Phe Phe
Pro Gly Leu Gly Trp Leu 260 265
270 Leu Leu Ala Asp Leu Trp Ala Glu Leu Glu Pro Lys Trp Pro Lys
Ala 275 280 285 Phe
Trp Asp Asp Trp Met Arg Arg Pro Glu Gln Arg Lys Gly Arg Ala 290
295 300 Cys Ile Arg Pro Glu Ile
Ser Arg Thr Met Thr Phe Gly Arg Lys Gly305 310
315 320 Val Ser His Gly Gln Phe Phe Asp Gln His Leu
Lys Phe Ile Lys Leu 325 330
335 Asn Gln Gln Phe Val Pro Phe Thr Gln Leu Asp Leu Ser Tyr Leu Gln
340 345 350 Arg Glu Ala
Tyr Asp Arg Asp Phe Leu Ala Gln Val Tyr Gly Ala Pro 355
360 365 Gln Leu Gln Val Glu Lys Val Arg
Thr Asn Asp Arg Lys Glu Leu Gly 370 375
380 Glu Val Arg Val Gln Tyr Thr Ser Arg Asp Ser Phe Lys
Ala Phe Ala385 390 395
400 Lys Ala Leu Gly Val Met Asp Asp Leu Lys Ser Gly Val Pro Arg Ala
405 410 415 Gly Tyr Arg Gly
Ile Val Thr Phe Gln Phe Arg Gly Arg Arg Val His 420
425 430 Leu Ala Pro Pro Glu Thr Trp Asn Gly
Tyr Asp Pro Ser Trp Asn 435 440
445 7447PRTMus musculus 7Met Leu Lys Lys Gln Thr Ala Gly Leu Val
Leu Trp Gly Ala Ile Ile 1 5 10
15 Phe Val Gly Trp Asn Ala Leu Leu Leu Leu Phe Phe Trp Thr Arg
Pro 20 25 30 Ala
Pro Gly Arg Leu Pro Ser Asp Ser Ala Leu Gly Asp Asp Pro Ala 35
40 45 Ser Leu Thr Arg Glu Val
Ile His Leu Ala Glu Asp Ala Glu Ala Glu 50 55
60 Leu Glu Arg Gln Arg Gly Leu Leu Gln Gln Ile
Lys Glu His Tyr Ala65 70 75
80 Leu Trp Arg Gln Arg Trp Arg Val Pro Thr Val Ala Pro Pro Ala Trp
85 90 95 Pro Arg Val
Pro Val Thr Pro Ser Pro Val Gln Ile Pro Ile Leu Val 100
105 110 Ile Ala Cys Asp Arg Ser Thr Val
Arg Arg Cys Leu Asp Lys Leu Leu 115 120
125 His Tyr Arg Pro Ser Ala Glu Arg Phe Pro Ile Ile Val
Ser Gln Asp 130 135 140
Cys Gly His Glu Glu Thr Ala Gln Val Ile Ala Ser Tyr Gly Thr Ala145
150 155 160 Val Thr His Ile Arg
Gln Pro Asp Leu Ser Asn Ile Ala Val Gln Pro 165
170 175 Asp His Arg Lys Phe Gln Gly Tyr Tyr Lys
Ile Ala Arg His Tyr Arg 180 185
190 Trp Ala Leu Gly Gln Ile Phe Asn Lys Phe Lys Phe Pro Ala Ala
Val 195 200 205 Val
Val Glu Asp Asp Leu Glu Val Ala Pro Asp Phe Phe Glu Tyr Phe 210
215 220 Gln Ala Thr Tyr Pro Leu
Leu Arg Thr Asp Pro Ser Leu Trp Cys Val225 230
235 240 Ser Ala Trp Asn Asp Asn Gly Lys Glu Gln Met
Val Asp Ser Ser Lys 245 250
255 Pro Glu Leu Leu Tyr Arg Thr Asp Phe Phe Pro Gly Leu Gly Trp Leu
260 265 270 Leu Leu Ala
Asp Leu Trp Ala Glu Leu Glu Pro Lys Trp Pro Lys Ala 275
280 285 Phe Trp Asp Asp Trp Met Arg Arg
Pro Glu Gln Arg Lys Gly Arg Ala 290 295
300 Cys Ile Arg Pro Glu Ile Ser Arg Thr Met Thr Phe Gly
Arg Lys Gly305 310 315
320 Val Ser His Gly Gln Phe Phe Asp Gln His Leu Lys Phe Ile Lys Leu
325 330 335 Asn Gln Gln Phe
Val Pro Phe Thr Gln Leu Asp Leu Ser Tyr Leu Gln 340
345 350 Gln Glu Ala Tyr Asp Arg Asp Phe Leu
Ala Gln Val Tyr Gly Ala Pro 355 360
365 Gln Leu Gln Val Glu Lys Val Arg Thr Asn Asp Gln Lys Glu
Leu Gly 370 375 380
Glu Val Arg Val Gln Tyr Thr Ser Arg Asp Ser Phe Lys Ala Phe Ala385
390 395 400 Lys Ala Leu Gly Val
Met Asp Asp Leu Lys Ser Gly Val Pro Arg Ala 405
410 415 Gly Tyr Arg Gly Ile Val Thr Phe Gln Phe
Arg Gly Arg Arg Val His 420 425
430 Leu Ala Pro Pro Gln Thr Trp Thr Gly Tyr Asp Pro Ser Trp Asn
435 440 445
8447PRTOryctolagus cuniculus 8Met Leu Lys Lys Gln Ser Ala Gly Leu Val Leu
Trp Gly Ala Ile Leu 1 5 10
15 Phe Val Ala Trp Asn Ala Leu Leu Leu Leu Phe Phe Trp Thr Arg Pro
20 25 30 Val Pro Ser
Arg Leu Pro Ser Asp Asn Ala Leu Asp Asp Asp Pro Ala 35
40 45 Ser Leu Thr Arg Glu Val Ile Arg
Leu Ala Gln Asp Ala Glu Val Glu 50 55
60 Leu Glu Arg Gln Arg Gly Leu Leu Gln Gln Ile Arg Glu
His His Ala65 70 75 80
Leu Trp Ser Gln Arg Trp Lys Val Pro Thr Ala Ala Pro Pro Ala Gln
85 90 95 Pro His Val Pro Val
Thr Pro Pro Pro Ala Val Ile Pro Ile Leu Val 100
105 110 Ile Ala Cys Asp Arg Ser Thr Val Arg Arg
Cys Leu Asp Lys Leu Leu 115 120
125 His Tyr Arg Pro Ser Ala Glu Leu Phe Pro Ile Ile Val Ser
Gln Asp 130 135 140
Cys Gly His Glu Glu Thr Ala Gln Val Ile Ala Ser Tyr Gly Ser Ala145
150 155 160 Val Thr His Ile Arg
Gln Pro Asp Leu Ser Asn Ile Ala Val Gln Pro 165
170 175 Asp His Arg Lys Phe Gln Gly Tyr Tyr Lys
Ile Ala Arg His Tyr Arg 180 185
190 Trp Ala Leu Gly Gln Ile Phe His Asn Phe Asn Tyr Pro Ala Ala
Val 195 200 205 Val
Val Glu Asp Asp Leu Glu Val Ala Pro Asp Phe Phe Glu Tyr Phe 210
215 220 Gln Ala Thr Tyr Pro Leu
Leu Lys Ala Asp Pro Ser Leu Trp Cys Val225 230
235 240 Ser Ala Trp Asn Asp Asn Gly Lys Glu Gln Met
Val Asp Ser Ser Lys 245 250
255 Pro Glu Leu Leu Tyr Arg Thr Asp Phe Phe Pro Gly Leu Gly Trp Leu
260 265 270 Leu Leu Ala
Glu Leu Trp Ala Glu Leu Glu Pro Lys Trp Pro Lys Ala 275
280 285 Phe Trp Asp Asp Trp Met Arg Arg
Pro Glu Gln Arg Lys Gly Arg Ala 290 295
300 Cys Val Arg Pro Glu Ile Ser Arg Thr Met Thr Phe Gly
Arg Lys Gly305 310 315
320 Val Ser His Gly Gln Phe Phe Asp Gln His Leu Lys Phe Ile Lys Leu
325 330 335 Asn Gln Gln Phe
Val Pro Phe Thr Gln Leu Asp Leu Ser Tyr Leu Gln 340
345 350 Gln Glu Ala Tyr Asp Arg Asp Phe Leu
Ala Arg Val Tyr Gly Ala Pro 355 360
365 Gln Leu Gln Val Glu Lys Val Arg Thr Asn Asp Arg Lys Glu
Leu Gly 370 375 380
Glu Val Arg Val Gln Tyr Thr Gly Arg Asp Ser Phe Lys Ala Phe Ala385
390 395 400 Lys Ala Leu Gly Val
Met Asp Asp Leu Lys Ser Gly Val Pro Arg Ala 405
410 415 Gly Tyr Arg Gly Ile Val Thr Phe Leu Phe
Arg Gly Arg Arg Val His 420 425
430 Leu Ala Pro Pro Gln Thr Trp Asp Gly Tyr Asp Pro Ser Trp Thr
435 440 445
9447PRTMesocricetus auratus 9Met Leu Lys Lys Gln Ser Ala Gly Leu Val Leu
Trp Gly Ala Ile Ile 1 5 10
15 Phe Val Gly Trp Asn Ala Leu Leu Leu Leu Phe Phe Trp Thr Arg Pro
20 25 30 Ala Pro Gly
Arg Pro Pro Leu Asp Ser Ala Leu Asp Asp Asp Pro Ala 35
40 45 Ser Leu Thr Arg Glu Val Ile Arg
Leu Ala Glu Asp Ala Glu Val Glu 50 55
60 Leu Glu Arg Gln Arg Gly Leu Leu Gln Gln Ile Arg Glu
His His Thr65 70 75 80
Leu Trp Asn Gln Arg Trp Lys Val Pro Thr Val Ala Pro Pro Ala Trp
85 90 95 Pro Arg Val Pro Val
Thr Pro Ser Pro Pro Val Ile Pro Ile Leu Val 100
105 110 Ile Ala Cys Asp Arg Ser Thr Val Arg Arg
Cys Leu Asp Lys Leu Leu 115 120
125 His Tyr Arg Pro Ser Ala Glu His Phe Pro Ile Ile Val Ser
Gln Asp 130 135 140
Cys Gly His Glu Glu Thr Ala Gln Val Ile Ala Ser Tyr Gly Ser Ala145
150 155 160 Val Thr His Ile Arg
Gln Pro Asp Leu Ser Asn Ile Ala Val Gln Pro 165
170 175 Asp His Arg Lys Phe Gln Gly Tyr Tyr Lys
Ile Ala Arg His Tyr Arg 180 185
190 Trp Ala Leu Gly Gln Ile Phe Asn Lys Phe Lys Phe Pro Ala Ala
Val 195 200 205 Val
Val Glu Asp Asp Leu Glu Val Ala Pro Asp Phe Phe Glu Tyr Phe 210
215 220 Gln Ala Thr Tyr Pro Leu
Leu Arg Thr Asp Pro Ser Leu Trp Cys Val225 230
235 240 Ser Ala Trp Asn Asp Asn Gly Lys Glu Gln Met
Val Asp Ser Ser Lys 245 250
255 Pro Glu Leu Leu Tyr Arg Thr Asp Phe Phe Pro Gly Leu Gly Trp Leu
260 265 270 Leu Leu Ala
Glu Leu Trp Ala Glu Leu Glu Pro Lys Trp Pro Lys Ala 275
280 285 Phe Trp Asp Asp Trp Met Arg Arg
Pro Glu Gln Arg Lys Gly Arg Ala 290 295
300 Cys Ile Arg Pro Glu Ile Ser Arg Thr Met Thr Phe Gly
Arg Lys Gly305 310 315
320 Val Ser His Gly Gln Phe Phe Asp Gln His Leu Lys Phe Ile Lys Leu
325 330 335 Asn Gln Gln Phe
Val Ser Phe Thr Gln Leu Asp Leu Ser Tyr Leu Gln 340
345 350 Arg Glu Ala Tyr Asp Arg Asp Phe Leu
Ala Arg Val Tyr Gly Ala Pro 355 360
365 Leu Leu Gln Val Glu Lys Val Arg Thr Asn Asp Gln Lys Glu
Leu Gly 370 375 380
Glu Val Arg Val Gln Tyr Thr Ser Arg Asp Ser Phe Lys Ala Phe Ala385
390 395 400 Lys Ala Leu Gly Val
Met Asp Asp Leu Lys Ser Gly Val Pro Arg Ala 405
410 415 Gly Tyr Arg Gly Ile Val Thr Phe Gln Phe
Arg Gly Arg Arg Val His 420 425
430 Leu Ala Pro Pro Arg Ser Trp Glu Gly Tyr Asp Pro Ser Trp Thr
435 440 445
10445PRTAiluropoda melanoleuca 10Met Leu Lys Lys Gln Ser Ala Gly Leu Val
Leu Trp Gly Ala Ile Leu 1 5 10
15 Phe Val Ala Trp Asn Ala Leu Leu Leu Leu Phe Phe Trp Thr Arg
Pro 20 25 30 Ser
Pro Gly Arg Leu Pro Ser Glu Ser Ala Leu Asp Asp Asp Pro Ala 35
40 45 Val Leu Thr Arg Glu Val
Ile Arg Leu Ala Glu Asp Ala Glu Val Glu 50 55
60 Leu Glu Arg Gln Arg Gly Leu Leu Gln Gln Ile
Arg Glu His His Ala65 70 75
80 Arg Trp Ser Gln Arg Trp Arg Ala Pro Thr Ala Thr Val Pro Ala Pro
85 90 95 Ala Pro Ala
Ser Asn Ala Pro Ala Val Ile Pro Ile Leu Val Ile Ala 100
105 110 Cys Asp Arg Ser Thr Val Arg Arg
Cys Leu Asp Lys Leu Leu His Tyr 115 120
125 Arg Pro Ser Ala Glu His Phe Pro Ile Ile Val Ser Gln
Asp Cys Gly 130 135 140
His Glu Glu Thr Ala Gln Val Ile Ala Ser Tyr Gly Ser Ala Val Thr145
150 155 160 His Ile Arg Gln Pro
Asp Leu Ser Ser Ile Ala Val Pro Pro Asp His 165
170 175 Arg Lys Phe Gln Gly Tyr Tyr Lys Ile Ala
Arg His Tyr Arg Trp Ala 180 185
190 Leu Gly Gln Val Phe His Arg Phe Lys Phe Pro Ala Ala Val Val
Val 195 200 205 Glu
Asp Asp Leu Glu Val Ala Pro Asp Phe Phe Glu Tyr Phe Gln Ala 210
215 220 Thr Tyr Pro Leu Leu Arg
Ala Asp Pro Ser Leu Trp Cys Val Ser Ala225 230
235 240 Trp Asn Asp Asn Gly Lys Glu Gln Met Val Asp
Ser Ser Lys Pro Glu 245 250
255 Leu Leu Tyr Arg Thr Asp Phe Phe Pro Gly Leu Gly Trp Leu Leu Leu
260 265 270 Ala Glu Leu
Trp Ala Glu Leu Glu Pro Lys Trp Pro Arg Ala Phe Trp 275
280 285 Asp Asp Trp Met Arg Arg Pro Glu
Gln Arg Gln Gly Arg Ala Cys Val 290 295
300 Arg Pro Glu Ile Ser Arg Thr Met Thr Phe Gly Arg Lys
Gly Val Ser305 310 315
320 His Gly Gln Phe Phe Asp Gln His Leu Lys Phe Ile Lys Leu Asn Gln
325 330 335 His Phe Val Pro
Phe Thr Gln Leu Asp Leu Ser Tyr Leu Arg Gln Glu 340
345 350 Thr Tyr Asp Arg Asp Phe Leu Ala Arg
Val Tyr Gly Ala Pro Leu Leu 355 360
365 Gln Val Glu Lys Val Arg Thr Ser Glu Arg Asn Glu Leu Gly
Glu Val 370 375 380
Arg Val Gln Tyr Thr Gly Arg Asp Ser Phe Lys Ala Phe Ala Lys Ala385
390 395 400 Leu Gly Val Met Asp
Asp Leu Lys Ser Gly Val Pro Arg Ala Gly Tyr 405
410 415 Arg Gly Ile Val Ser Phe Leu Phe Arg Gly
Arg Arg Val His Leu Ala 420 425
430 Pro Pro Gln Thr Trp Asp Gly Tyr Asp Pro Ser Trp Asn
435 440 445 11447PRTSus scrofa 11Met Leu
Lys Lys Gln Ser Ala Gly Leu Val Leu Trp Gly Ala Ile Leu 1 5
10 15 Phe Val Ala Trp Asn Ala Leu
Leu Leu Leu Phe Phe Trp Thr Arg Pro 20 25
30 Ala Pro Gly Arg Leu Pro Ser Asp Ser Ala Leu Asp
Asp Asp Pro Ala 35 40 45
Ser Leu Thr Arg Glu Val Ile Arg Leu Ala Gln Asp Ala Glu Val Glu
50 55 60 Leu Glu Arg
Gln Arg Gly Leu Leu Gln Gln Ile Arg Glu His His Ala65 70
75 80 Arg Trp Ser Gln Arg Trp Arg Val
Pro Thr Val Ala Pro Pro Val Pro 85 90
95 Pro Arg Val Pro Val Thr Ser Ala Pro Thr Val Ile Pro
Ile Leu Val 100 105 110
Ile Ala Cys Asp Arg Ser Thr Val Arg Arg Cys Leu Asp Lys Leu Leu
115 120 125 His Tyr Arg Pro
Ser Ala Glu His Phe Pro Ile Ile Val Ser Gln Asp 130
135 140 Cys Gly His Glu Glu Thr Ala Gln
Val Ile Ala Ser Tyr Gly Ser Ala145 150
155 160 Val Thr His Ile Arg Gln Pro Asp Leu Ser Asn Ile
Val Val Pro Pro 165 170
175 Asp His Arg Lys Phe Gln Gly Tyr Tyr Lys Ile Ala Arg His Tyr Arg
180 185 190 Trp Ala Leu
Gly Gln Val Phe Glu Lys Phe Lys Phe Ser Ala Ala Val 195
200 205 Val Val Glu Asp Asp Leu Glu Val
Ala Pro Asp Phe Phe Glu Tyr Phe 210 215
220 Gln Ala Thr Tyr Pro Leu Leu Arg Ala Asp Pro Ser Leu
Trp Cys Val225 230 235
240 Ser Ala Trp Asn Asp Asn Gly Lys Glu Gln Met Val Asp Ser Ser Lys
245 250 255 Pro Glu Leu Leu
Tyr Arg Thr Asp Phe Phe Pro Gly Leu Gly Trp Leu 260
265 270 Leu Leu Ala Glu Leu Trp Ala Glu Leu
Glu Pro Lys Trp Pro Lys Ala 275 280
285 Phe Trp Asp Asp Trp Met Arg Arg Pro Glu Gln Arg Gln Gly
Arg Ala 290 295 300
Cys Val Arg Pro Glu Ile Ser Arg Thr Met Thr Phe Gly Arg Lys Gly305
310 315 320 Val Ser His Gly Gln
Phe Phe Asp Gln His Leu Lys Phe Ile Lys Leu 325
330 335 Asn Gln His Phe Val Pro Phe Thr Gln Leu
Asp Leu Ser Tyr Leu Arg 340 345
350 Arg Glu Ala Tyr Asp Arg Asp Phe Leu Ala Arg Val Tyr Gly Ala
Pro 355 360 365 Leu
Leu Gln Val Glu Lys Val Arg Thr Ser Glu Arg Ser Glu Leu Gly 370
375 380 Glu Val Arg Val Gln Tyr
Thr Ser Arg Asp Ser Phe Lys Ala Phe Ala385 390
395 400 Lys Ala Leu Gly Val Met Asp Asp Leu Lys Ser
Gly Val Pro Arg Ala 405 410
415 Gly Tyr Arg Gly Ile Val Ser Phe Leu Phe Arg Gly Arg Arg Val Tyr
420 425 430 Leu Ala Pro
Pro Glu Thr Trp Asp Gly Tyr Asp Pro Ser Trp Asn 435
440 445 12447PRTCanis familiaris 12Met Leu Lys
Lys Gln Ser Ala Gly Leu Val Leu Trp Gly Ala Ile Leu 1 5
10 15 Phe Val Ala Trp Asn Ala Leu Leu
Leu Leu Phe Phe Trp Thr Arg Pro 20 25
30 Ser Pro Ser Arg Leu Pro Ser Asp Ser Ala Leu Asp Asp
Asp Pro Ala 35 40 45
Ser Leu Thr Arg Glu Val Ile Arg Leu Ala Glu Asp Ala Glu Val Glu 50
55 60 Leu Glu Arg Gln Arg
Gly Leu Leu Gln Gln Ile Arg Glu His His Ala65 70
75 80 Arg Trp Ser Gln Arg Trp Arg Val Pro Thr
Ala Ala Pro Pro Ala Pro 85 90
95 Pro Arg Val Pro Val Ser Ser Pro Pro Ala Val Ile Pro Ile Leu
Val 100 105 110 Ile
Ala Cys Asp Arg Ser Thr Val Arg Arg Cys Leu Asp Lys Leu Leu 115
120 125 His Tyr Arg Pro Ser Ala
Glu His Phe Pro Ile Ile Val Ser Gln Asp 130 135
140 Cys Gly His Glu Glu Thr Ala Gln Val Ile Ala
Ser Tyr Gly Ser Ala145 150 155
160 Ile Thr His Ile Arg Gln Pro Asp Leu Ser Ser Ile Thr Val Pro Pro
165 170 175 Asp His Arg
Lys Phe Gln Gly Tyr Tyr Lys Ile Ala Arg His Tyr Arg 180
185 190 Trp Ala Leu Gly Gln Val Phe His
Lys Phe Lys Phe Pro Ala Ala Val 195 200
205 Val Val Glu Asp Asp Leu Glu Val Ala Pro Asp Phe Phe
Glu Tyr Phe 210 215 220
Gln Ala Thr Tyr Pro Leu Leu Arg Ala Asp Pro Ser Leu Trp Cys Val225
230 235 240 Ser Ala Trp Asn Asp
Asn Gly Lys Glu Gln Met Val Asp Ser Ser Lys 245
250 255 Pro Glu Leu Leu Tyr Arg Thr Asp Phe Phe
Pro Gly Leu Gly Trp Leu 260 265
270 Leu Leu Ala Glu Leu Trp Ala Glu Leu Glu Pro Lys Trp Pro Arg
Ala 275 280 285 Phe
Trp Asp Asp Trp Met Arg Arg Pro Glu Gln Arg Gln Gly Arg Ala 290
295 300 Cys Val Arg Pro Glu Ile
Ser Arg Thr Met Thr Phe Gly Arg Lys Gly305 310
315 320 Val Ser His Gly Gln Phe Phe Asp Gln His Leu
Lys Phe Ile Lys Leu 325 330
335 Asn Gln His Phe Val Pro Phe Thr Gln Leu Asp Leu Ser Tyr Leu Arg
340 345 350 Gln Glu Thr
Tyr Asp Arg Asp Phe Leu Ala Arg Val Tyr Gly Ala Pro 355
360 365 Leu Leu Gln Val Glu Lys Val Arg
Thr Ser Glu Arg Ser Glu Leu Gly 370 375
380 Glu Val Arg Val Gln Tyr Thr Gly Arg Asp Ser Phe Lys
Ala Phe Ala385 390 395
400 Lys Ala Leu Gly Val Met Asp Asp Leu Lys Ser Gly Val Pro Arg Ala
405 410 415 Gly Tyr Arg Gly
Ile Val Ser Phe Leu Phe Arg Gly Arg Arg Val His 420
425 430 Leu Ala Pro Pro Gln Thr Trp Asp Gly
Tyr Asp Pro Ser Trp Asn 435 440
445 13447PRTBos taurus 13Met Leu Lys Lys Gln Ser Ala Gly Leu Val
Leu Trp Gly Ala Ile Leu 1 5 10
15 Phe Val Ala Trp Asn Ala Leu Leu Leu Leu Phe Phe Trp Thr Arg
Pro 20 25 30 Ala
Pro Gly Arg Leu Pro Ser Asp Ser Ala Leu Asp Asp Asp Pro Ala 35
40 45 Ser Leu Thr Arg Glu Val
Ile Arg Leu Ala Gln Asp Ala Glu Val Glu 50 55
60 Leu Glu Arg Gln Arg Gly Leu Leu Gln Gln Ile
Arg Glu His His Ala65 70 75
80 Arg Trp Ser Gln Arg Trp Arg Val Pro Thr Val Ala Pro Pro Val Pro
85 90 95 Pro Arg Val
Pro Val Thr Thr Pro Pro Ala Val Ile Pro Ile Leu Val 100
105 110 Ile Ala Cys Asp Arg Ser Thr Val
Arg Arg Cys Leu Asp Lys Leu Leu 115 120
125 Asn Tyr Arg Pro Ser Ala Glu His Phe Pro Ile Ile Val
Ser Gln Asp 130 135 140
Cys Gly His Glu Glu Thr Ala Gln Val Ile Ala Ser Tyr Gly Ser Ala145
150 155 160 Val Met His Ile Arg
Gln Pro Asp Leu Ser Thr Ile Ala Val Pro Pro 165
170 175 Asp His Arg Lys Phe Gln Gly Tyr Tyr Lys
Ile Ala Arg His Tyr Arg 180 185
190 Trp Ala Leu Gly Gln Val Phe His Glu Phe Lys Phe Pro Ala Ala
Val 195 200 205 Val
Val Glu Asp Asp Leu Glu Val Ala Pro Asp Phe Phe Glu Tyr Phe 210
215 220 Gln Ala Thr Tyr Pro Leu
Leu Arg Ala Asp Pro Ser Leu Trp Cys Val225 230
235 240 Ser Ala Trp Asn Asp Asn Gly Lys Glu Gln Met
Val Asp Ser Ser Lys 245 250
255 Pro Glu Leu Leu Tyr Arg Thr Asp Phe Phe Pro Gly Leu Gly Trp Leu
260 265 270 Leu Leu Ala
Glu Leu Trp Ala Glu Leu Glu Pro Lys Trp Pro Lys Ala 275
280 285 Phe Trp Asp Asp Trp Met Arg Arg
Pro Glu Gln Arg Gln Gly Arg Ala 290 295
300 Cys Val Arg Pro Glu Ile Ser Arg Thr Met Thr Phe Gly
Arg Lys Gly305 310 315
320 Val Ser His Gly Gln Phe Phe Asp Gln His Leu Lys Phe Ile Lys Leu
325 330 335 Asn Gln His Phe
Val Pro Phe Thr Gln Leu Asp Leu Ser Tyr Leu Arg 340
345 350 Gln Glu Thr Tyr Asp Arg Asp Phe Leu
Ala Arg Val Tyr Gly Ala Pro 355 360
365 Leu Leu Gln Val Glu Lys Val Arg Thr Ser Glu Arg Ser Glu
Leu Gln 370 375 380
Glu Val Arg Val Gln Tyr Thr Ser Arg Asp Ser Phe Lys Ala Phe Ala385
390 395 400 Lys Ala Leu Gly Val
Met Asp Asp Leu Lys Ser Gly Val Pro Arg Ala 405
410 415 Gly Tyr Arg Gly Ile Val Ser Phe Leu Tyr
Arg Gly Arg Arg Val His 420 425
430 Leu Ala Pro Pro Gln Thr Trp Asp Gly Tyr Asp Pro Ser Trp Asn
435 440 445 14447PRTEquus
caballus 14Met Leu Lys Lys Gln Ser Ala Gly Leu Val Leu Trp Gly Ala Ile
Leu 1 5 10 15 Phe
Val Ala Trp Asn Ala Leu Leu Leu Leu Phe Phe Trp Met Arg Pro 20
25 30 Ser Pro Ser Arg Leu Pro
Ser Asp Gly Thr Leu Asp Asp Asp Pro Thr 35 40
45 Gly Leu Thr Arg Lys Val Ile His Leu Ala Gln
Asp Val Glu Val Glu 50 55 60
Leu Glu Arg Gln Arg Gly Leu Leu Gln Gln Ile Arg Glu His His
Ala65 70 75 80 Arg
Trp Ser Gln Trp Trp Arg Val Pro Thr Val Pro Pro Pro Val Pro
85 90 95 Pro His Val Ser Val Thr
Ser Leu Pro Ala Val Ile Pro Ile Leu Val 100
105 110 Ile Ala Cys Asp Arg Ser Thr Val Arg Arg
Cys Leu Asp Lys Leu Leu 115 120
125 His Tyr Arg Pro Ser Ala Glu His Phe Pro Ile Ile Val Ser
Gln Asp 130 135 140
Cys Gly His Glu Glu Thr Ala Gln Val Ile Ala Ser Tyr Gly Ser Ala145
150 155 160 Val Thr His Ile Arg
Gln Pro Asp Leu Ser Asn Ile Ala Val Pro Pro 165
170 175 Asp His Arg Lys Phe Gln Gly Tyr Tyr Lys
Ile Ala Arg His Tyr Arg 180 185
190 Trp Ala Leu Ala Gln Val Phe His Arg Phe Lys Phe Pro Ala Ala
Val 195 200 205 Val
Val Glu Asp Asp Leu Glu Val Ala Pro Asp Phe Phe Glu Tyr Phe 210
215 220 Gln Ala Thr Tyr Pro Leu
Leu Arg Ala Asp Pro Ser Leu Trp Cys Val225 230
235 240 Ser Ala Trp Asn Asp Asn Gly Lys Glu Gln Met
Val Asp Ser Ser Lys 245 250
255 Pro Glu Leu Leu Tyr Arg Thr Asp Phe Phe Pro Gly Leu Gly Trp Leu
260 265 270 Leu Leu Ala
Glu Leu Trp Ala Glu Leu Glu Pro Lys Trp Pro Lys Ala 275
280 285 Phe Trp Asp Asp Trp Met Arg Arg
Pro Glu Gln Arg Gln Gly Arg Ala 290 295
300 Cys Val Arg Pro Glu Ile Ser Arg Thr Met Thr Phe Gly
Arg Ile Gly305 310 315
320 Val Ser His Gly Gln Phe Phe Asp Gln His Leu Lys Phe Ile Lys Leu
325 330 335 Asn Gln His Phe
Val Pro Phe Thr Gln Leu Asp Leu Ser Tyr Leu Arg 340
345 350 Gln Glu Ala Tyr Asp Lys Asp Phe Leu
Ala Arg Val Tyr Gly Ala Pro 355 360
365 Leu Leu Gln Val Glu Lys Val Arg Thr Gly Glu Arg Ser Glu
Leu Gly 370 375 380
Glu Val Arg Val Gln Tyr Thr Gly Arg Asp Ser Phe Lys Ala Phe Ala385
390 395 400 Lys Ala Leu Gly Val
Met Asp Asp Leu Lys Ser Gly Val Pro Arg Ala 405
410 415 Gly Tyr Arg Gly Ile Val Ser Phe Leu Phe
Arg Gly Arg Arg Val His 420 425
430 Leu Ala Pro Pro Gln Thr Trp Glu Gly Tyr Asp Pro Ser Trp Asn
435 440 445
15447PRTMonodelphis domestica 15Met Leu Lys Lys Gln Ser Ala Gly Leu Val
Leu Trp Gly Ala Ile Leu 1 5 10
15 Phe Val Ala Trp Asn Ala Leu Leu Leu Phe Phe Phe Trp Ala Arg
Pro 20 25 30 Leu
Pro Gly Gly Pro Ser Ser Glu Asp Pro Phe Ala Asn Asp Pro Ala 35
40 45 Ser Leu Ser Arg Arg Val
Ile Arg Leu Ala Gln Glu Ala Glu Ile Glu 50 55
60 Leu Glu Arg Gln His Val Leu Leu Gln Gln Ile
Gln Lys His Ser Val65 70 75
80 Leu Trp Asn Gln Arg Gln Gln Val Ala Thr Ala Gly Pro Pro Ala Val
85 90 95 Ser His Pro
Thr Val Ala Pro Thr Thr Phe Val Leu Pro Ile Leu Val 100
105 110 Ile Ala Cys Asp Arg Ser Thr Val
Arg Arg Cys Leu Asp Lys Leu Leu 115 120
125 His Tyr Arg Pro Ser Ala Glu Arg Phe Pro Ile Ile Val
Ser Gln Asp 130 135 140
Cys Gly His Lys Val Thr Ala Gln Val Ile Ala Ser Tyr Gly Asn Ala145
150 155 160 Ile Met His Ile Lys
Gln Pro Asp Leu Ser Ser Ile Pro Val Pro Thr 165
170 175 Glu His Arg Lys Phe Gln Gly Tyr Tyr Lys
Ile Ala Arg His Tyr Arg 180 185
190 Trp Ala Leu Asn Gln Val Phe Arg Thr Phe Lys Tyr Gln Ala Ala
Val 195 200 205 Val
Val Glu Asp Asp Leu Glu Val Ala Pro Asp Phe Phe Glu Tyr Phe 210
215 220 Gln Ala Thr Tyr Pro Leu
Leu Arg Thr Asp Pro Ser Leu Trp Cys Val225 230
235 240 Ser Ala Trp Asn Asp Asn Gly Lys Glu Gln Met
Val Asp Ala Lys Arg 245 250
255 Pro Asp Leu Leu Tyr Arg Thr Asp Phe Phe Pro Gly Leu Gly Trp Leu
260 265 270 Leu Leu Ala
Glu Leu Trp Asp Glu Leu Glu Pro Lys Trp Pro Lys Ala 275
280 285 Phe Trp Asp Asp Trp Met Arg Gln
Pro Glu Gln Arg Arg Asp Arg Ala 290 295
300 Cys Leu Arg Pro Glu Ile Ser Arg Thr Met Thr Phe Gly
Arg Lys Gly305 310 315
320 Val Ser Gln Gly Gln Phe Phe Asp Gln His Leu Lys Phe Ile Lys Leu
325 330 335 Asn Gln Gly Phe
Val Phe Phe Thr Gln Leu Asp Leu Ser Tyr Leu Lys 340
345 350 Gln Glu Ala Tyr Asp Arg Asp Phe Ser
Ala Arg Val Tyr Ala Ala Pro 355 360
365 Gln Val Gln Val Glu Glu Leu Lys Ser Asn Gln Lys Gln Glu
Leu Gly 370 375 380
Glu Val Arg Val Gln Tyr Arg Gly Arg Asp Ser Phe Arg Ala Phe Ala385
390 395 400 Lys Ala Leu Gly Val
Met Asp Asp Leu Lys Ser Gly Val Pro Arg Ala 405
410 415 Ser Tyr Arg Gly Ile Val Ser Phe Leu Phe
Arg Gly Arg Arg Val Tyr 420 425
430 Leu Ala Pro Pro Gln Asp Trp Thr Gly Tyr Asp Pro Ser Trp Ser
435 440 445 16438PRTSalmo
salar 16Met Leu Arg Lys Arg Gly Ser Ala Ile Leu Cys Gly Ala Phe Leu Phe 1
5 10 15 Val Ala Trp
Asn Ala Val Val Val Leu Tyr Leu Trp Gly Arg Pro Leu 20
25 30 Ser Gly Arg Glu Glu Arg Glu Met
Asp Gly Gly Arg Gly Gly Ala Asp 35 40
45 Leu Ala Gly Asp Val Ile His Met Ala Glu Ala Phe Glu
Ala Glu Leu 50 55 60
Glu Met Gln Arg Lys Ile Leu Leu Gln Ile Gln Gly His Arg Ser Leu65
70 75 80 Trp Glu Gln Pro Asn
Glu Asn Gly Ala Ser Arg Ile Gly Pro Pro Gln 85
90 95 Val Val Ile Pro Ile Leu Val Ile Ala Cys
Asn Arg Val Thr Val Lys 100 105
110 Arg Cys Leu Asp Lys Leu Leu Glu Tyr Arg Pro Ser Ala Glu Leu
Tyr 115 120 125 Pro
Ile Ile Val Ser Gln Asp Cys Gly His Ala Glu Thr Ala Gln Val 130
135 140 Ile Gly Ser Tyr Gly Ser
Gln Val Thr His Leu Lys Gln Pro Asp Leu145 150
155 160 Ser Asp Ile Ala Val Arg Pro Glu His Lys Lys
Phe Gln Gly Tyr Tyr 165 170
175 Lys Ile Ser Arg His Tyr Arg Trp Ala Leu Asn Gln Val Phe Asn Ser
180 185 190 Leu Ser His
Ser Ser Val Val Ile Val Glu Asp Asp Leu Glu Val Ala 195
200 205 Pro Asp Phe Phe Glu Tyr Phe Arg
Ser Leu His Pro Ile Leu Lys Ser 210 215
220 Asp Leu Ser Leu Trp Cys Val Ser Ala Trp Asn Asp Asn
Gly Arg Asp225 230 235
240 Gly Tyr Val Asp Pro Ala Lys Ala Asp Leu Leu Tyr Arg Thr Asp Phe
245 250 255 Phe Pro Gly Leu
Gly Trp Met Met Leu Lys Glu Leu Trp Val Glu Leu 260
265 270 Glu Pro Lys Trp Pro Gly Ala Phe Trp
Asp Asp Trp Met Arg Gln Pro 275 280
285 Asp Gln Arg Arg Asp Arg Ala Cys Ile Arg Pro Glu Ile Ser
Arg Thr 290 295 300
Leu Thr Phe Gly Arg Lys Gly Val Ser Leu Gly Gln Phe Tyr Asp Lys305
310 315 320 Tyr Leu Arg Tyr Ile
Lys Leu Asn Ser Glu Phe Val Pro Phe Thr Lys 325
330 335 Leu Asp Leu Ala Tyr Leu Lys Glu Glu Lys
Tyr Lys Glu Ile Phe Glu 340 345
350 Lys Gln Val Tyr Ser Ala Pro Leu Val Lys Tyr Glu Glu Val Gln
Arg 355 360 365 Gly
Gln Leu Lys Gly Ala Gly Pro Phe Cys Leu His Tyr Leu Ser Lys 370
375 380 Asp Gly Phe Lys Val Leu
Ala Lys Asn Leu Gly Val Met Glu Asp Leu385 390
395 400 Lys Ser Gly Val Pro Arg Thr Gly Tyr Arg Gly
Val Val Ser Phe Leu 405 410
415 Ser Arg Gly Arg Arg Ile Phe Leu Ala Pro Pro Pro Gly Trp Ser Lys
420 425 430 Tyr Asp Pro
Thr Trp Ser 435 17452PRTDanio rerio 17Met Leu Arg Lys
Arg Ser Pro Leu Val Ile Cys Gly Ala Phe Ile Phe 1 5
10 15 Val Ala Trp Asn Val Val Leu Leu Phe
Val Leu Met Arg Arg Pro Ser 20 25
30 Ser Pro Gly Thr Phe Asn Asn Gln Asp Lys Pro Gly Glu Thr
Glu His 35 40 45
Arg Ala Glu Gly Gly Lys Phe Gly Asn Ile Met Asn Glu Val Ile Arg 50
55 60 Val Ala Asp Ala Phe
Glu Ala Glu Leu Ala Ala Gln Lys Lys Ile Leu65 70
75 80 Gln Gln Ile Gln Ser His Trp Ser Val Trp
Asp Ser Lys Asp Gly Val 85 90
95 Ile Pro Glu Lys Ser Lys Ser Glu Val Glu His Thr Ala Pro Val
Val 100 105 110 Ile
Pro Ile Leu Val Ile Ala Cys Asn Arg Val Thr Val Lys Arg Cys 115
120 125 Leu Asp Lys Leu Ile Glu
His Arg Pro Ser Ala Glu Leu His Pro Ile 130 135
140 Ile Val Ser Gln Asp Cys Gly His Arg Glu Thr
Ser Asp Val Ile Gly145 150 155
160 Ser Tyr Gly Ser Gln Leu Thr His Ile Lys Gln Pro Asp Leu Ser Asp
165 170 175 Val Ala Val
Pro Pro Gln His Lys Lys Phe Gln Gly Tyr Tyr Lys Ile 180
185 190 Ser Arg His Tyr Lys Trp Ala Leu
Ser Gln Val Phe Asn Thr Phe Ser 195 200
205 Tyr Ser Ser Val Val Val Val Glu Asp Asp Leu Glu Val
Ala Pro Asp 210 215 220
Phe Phe Glu Tyr Phe Arg Ala Leu His Pro Met Leu Lys Ser Asp Pro225
230 235 240 Thr Leu Trp Cys Val
Ser Ala Trp Asn Asp Asn Gly Arg Asp Gly Phe 245
250 255 Val Asp Pro Gly Lys Ala Ser Leu Leu Tyr
Arg Thr Asp Phe Phe Pro 260 265
270 Gly Leu Gly Trp Met Leu Thr Lys Asp Leu Trp Ala Glu Leu Glu
Pro 275 280 285 Lys
Trp Pro Ala Ser Phe Trp Asp Asp Trp Met Arg His Pro Asp Gln 290
295 300 Arg Lys Asp Arg Ser Cys
Ile Arg Pro Glu Ile Ser Arg Thr Leu Thr305 310
315 320 Phe Gly Arg Lys Gly Val Ser Leu Gly Gln Phe
Tyr Asp Lys Tyr Leu 325 330
335 Arg Phe Ile Lys Leu Asn Thr Glu Phe Val Pro Phe Thr Lys Met Asp
340 345 350 Leu Ser Tyr
Leu Glu Lys Glu Lys Tyr Asp Glu Ser Phe Glu Lys Glu 355
360 365 Val Tyr Ala Ala Ser Leu Val Thr
Leu Glu Asp Leu Lys Ser Gly Lys 370 375
380 Leu Ser Gly Ser Gly Pro Phe Arg Val Gln Tyr Ser Ser
Pro Asp Ser385 390 395
400 Phe Lys Ser Leu Ala Arg Asn Leu Gly Val Met Asp Asp Leu Lys Ser
405 410 415 Gly Val Pro Arg
Ala Gly Tyr Arg Gly Ala Val Ser Phe Leu Leu Arg 420
425 430 Gly Lys Arg Val Tyr Leu Ala Pro Pro
Ala Gly Trp Ser Arg Tyr Asp 435 440
445 Pro Ser Trp Ser 450 18448PRTXenopus laevis
18Met Pro Arg Lys Val Ser Val Ala Ala Trp Gly Ala Ala Leu Phe Ile 1
5 10 15 Ser Trp Asn Ala
Ile Leu Leu Leu Tyr Leu Met Ser Arg Ser Arg Gly 20
25 30 Thr Asp His Ser Asp Leu Thr Ala His
Val Ile Gln Leu Ala Glu Ala 35 40
45 Ala Glu Ala Glu Leu Glu Lys Gln Lys Gly Leu Leu Gln Gln
Ile His 50 55 60
His Tyr Ser Gly Leu Leu Asn Gln Gln Gln Pro Ser Ser His Val Arg65
70 75 80 Leu Ala Pro Leu Met
Pro Ile Lys Asn Leu Asn Val Ser Ser Pro Phe 85
90 95 Pro Ser Pro Val Gly Ser Gly Pro Leu Pro
Leu Val Ile Pro Ile Leu 100 105
110 Val Val Ala Cys Asp Arg Pro Ser Val Arg Arg Cys Leu Asp Ser
Leu 115 120 125 Leu
Lys Tyr Arg Pro Ser Ala Glu Lys Phe Pro Ile Ile Val Ser Gln 130
135 140 Asp Cys Gly His Glu Glu
Thr Gly Lys Val Ile Asp Ser Tyr Gly Asp145 150
155 160 Ala Val Thr His Ile Lys Gln Pro Asp Leu Ser
Glu Val Ala Val Pro 165 170
175 Pro Glu His Arg Lys Phe Gln Gly Tyr Tyr Lys Ile Ser Arg His Tyr
180 185 190 Arg Trp Ala
Leu Asn Gln Ile Phe Lys Ser Met Gly Tyr Lys Ala Ala 195
200 205 Ile Val Val Glu Asp Asp Leu Glu
Val Ala Pro Asp Phe Tyr Glu Tyr 210 215
220 Phe Gln Ala Thr Leu Pro Leu Leu Gln Lys Asp Arg Met
Leu Trp Cys225 230 235
240 Val Ser Ala Trp Asn Asp Asn Gly Lys Glu Ala Leu Ile Asp Pro Gly
245 250 255 Gly Thr Ser Leu
Leu Tyr Arg Ser Asp Phe Phe Pro Gly Leu Gly Trp 260
265 270 Leu Leu Leu Arg Glu Leu Trp Glu Glu
Leu Glu Pro Lys Trp Pro Ser 275 280
285 Ala Phe Trp Asp Asp Trp Val Arg Arg Pro Glu Gln Arg Leu
Asp Arg 290 295 300
Ala Cys Val Arg Pro Glu Leu Ser Arg Thr Arg Thr Phe Gly Arg Lys305
310 315 320 Gly Val Ser Gln Gly
Gln Phe Phe Asp Gln His Leu Arg Phe Ile Lys 325
330 335 Leu Asn Gln Asp Leu Val Pro Phe Thr Lys
Met Asp Leu Ser Tyr Leu 340 345
350 Leu Lys Asp Thr Tyr Asp Pro Trp Phe Leu Glu Gln Val Tyr Gly
Ala 355 360 365 Pro
Lys Ala Arg Ala Glu Glu Val Leu His Gly Gln Val Pro Gly Gly 370
375 380 Arg Thr Val Arg Val Glu
Tyr Thr Thr Lys Asp Thr Phe Lys Ala Met385 390
395 400 Ala Arg Ala Phe Gly Val Met Glu Asp Leu Lys
Ser Gly Val Ala Arg 405 410
415 Ala Ala Tyr Lys Gly Val Val Ser Phe Ser His Arg Gly Arg Arg Val
420 425 430 Phe Leu Ala
Pro Pro Lys Asp Trp Thr Gly Tyr Asp Pro Leu Trp Asn 435
440 445 19458PRTDrosophila melanogaster
19Met Arg Thr Arg Lys Val Leu Leu Val Ile Gly Phe Leu Val Thr Trp 1
5 10 15 Thr Tyr Ala Thr
Tyr Tyr Leu Leu Leu Arg Gln Thr Gly Ile His Thr 20
25 30 Ser Arg His Gln Ser Leu Gln Ala Tyr
Lys Leu Asn Ser Gln Ala Arg 35 40
45 Asp Ala Asn Met Gln Ser His His Leu Ala Lys Asn Val Phe
Glu Phe 50 55 60
Val Lys Leu Lys Tyr Leu Glu Lys Gln Pro Pro Ser Val Ala Ser Thr65
70 75 80 Pro Gln Ile Ser Ile
Ile Ala Ala Glu Ile Ser Ala Glu Leu Pro Glu 85
90 95 Gln His Val Ala Lys Ser Ala Thr Ala Arg
Ile Pro Thr Lys Thr Tyr 100 105
110 Leu Ala Asn Gly Glu Pro Val Phe Pro Val Val Val Phe Ala Cys
Asn 115 120 125 Arg
Val Ser Val Lys Lys Cys Ile Asp Asn Leu Val Gln Tyr Arg Pro 130
135 140 Ser Val Glu Gln Phe Pro
Ile Ile Val Ser Gln Asp Cys Gly Asp Glu145 150
155 160 Pro Thr Lys Glu Ala Ile Leu Ser Tyr Gly Lys
Gln Val Thr Leu Ile 165 170
175 Glu Gln Pro Asp Leu Ser Asp Ile Thr Val Leu Pro Lys Glu Lys Lys
180 185 190 Phe Lys Gly
Tyr Tyr Lys Ile Ala Arg His Tyr Gly Trp Ala Leu Asn 195
200 205 Thr Thr Phe Ala Val Gly Phe Glu
Phe Val Ile Ile Val Glu Asp Asp 210 215
220 Leu Asn Val Ala Pro Asp Phe Phe Glu Tyr Phe Leu Gly
Thr His Lys225 230 235
240 Leu Leu Lys Gln Asp Pro Ser Leu Trp Cys Val Ser Ala Trp Asn Asp
245 250 255 Asn Gly Lys Ala
Ala Val Val Asp Ala Ala Gln Pro Glu Leu Leu Tyr 260
265 270 Arg Thr Asp Phe Phe Pro Gly Leu Gly
Trp Met Leu Thr Lys Asp Leu 275 280
285 Trp Ala Glu Leu Ser Val Lys Trp Pro Lys Ser Phe Trp Asp
Asp Trp 290 295 300
Ile Arg His Pro Ala Gln Arg Lys Asp Arg Val Cys Ile Arg Pro Glu305
310 315 320 Ile Ser Arg Thr Arg
Thr Phe Gly Lys Ile Gly Val Ser Asn Gly Leu 325
330 335 Phe Phe Asp Lys Tyr Leu Lys His Ile Lys
Leu Ser Glu Asp Phe Val 340 345
350 Gln Phe Thr Lys Ile Asn Met Ser Tyr Leu Leu Lys Asp Asn Tyr
Asp 355 360 365 Asn
Thr Phe Leu Arg Arg Val Tyr Thr Tyr Pro Ile Val Thr Tyr Asp 370
375 380 Glu Leu Arg Arg Asn Leu
Ile Arg Ile Glu Gly Pro Val Arg Ile Gln385 390
395 400 Tyr Thr Thr Arg Glu Gln Tyr Lys Arg Thr Thr
Lys Met Leu Gly Leu 405 410
415 Met Asp Asp Phe Lys Ser Gly Val Pro Arg Thr Ala Tyr His Gly Ile
420 425 430 Val Ser Phe
Tyr Tyr Asn Lys Arg Arg Val His Leu Ala Pro Asn Ala 435
440 445 Asn Trp Lys Gly Tyr Glu Leu Ser
Trp Ser 450 455 20447PRTHomo sapiens 20Met
Arg Phe Arg Ile Tyr Lys Arg Lys Val Leu Ile Leu Thr Leu Val 1
5 10 15 Val Ala Ala Cys Gly Phe
Val Leu Trp Ser Ser Asn Gly Arg Gln Arg 20 25
30 Lys Asn Glu Ala Leu Ala Pro Pro Leu Leu Asp
Ala Glu Pro Ala Arg 35 40 45
Gly Ala Gly Gly Arg Gly Gly Asp His Pro Ser Val Ala Val Gly Ile
50 55 60 Arg Arg Val
Ser Asn Val Ser Ala Ala Ser Leu Val Pro Ala Val Pro65 70
75 80 Gln Pro Glu Ala Asp Asn Leu Thr
Leu Arg Tyr Arg Ser Leu Val Tyr 85 90
95 Gln Leu Asn Phe Asp Gln Thr Leu Arg Asn Val Asp Lys
Ala Gly Thr 100 105 110
Trp Ala Pro Arg Glu Leu Val Leu Val Val Gln Val His Asn Arg Pro
115 120 125 Glu Tyr Leu Arg
Leu Leu Leu Asp Ser Leu Arg Lys Ala Gln Gly Ile 130
135 140 Asp Asn Val Leu Val Ile Phe Ser
His Asp Phe Trp Ser Thr Glu Ile145 150
155 160 Asn Gln Leu Ile Ala Gly Val Asn Phe Cys Pro Val
Leu Gln Val Phe 165 170
175 Phe Pro Phe Ser Ile Gln Leu Tyr Pro Asn Glu Phe Pro Gly Ser Asp
180 185 190 Pro Arg Asp
Cys Pro Arg Asp Leu Pro Lys Asn Ala Ala Leu Lys Leu 195
200 205 Gly Cys Ile Asn Ala Glu Tyr Pro
Asp Ser Phe Gly His Tyr Arg Glu 210 215
220 Ala Lys Phe Ser Gln Thr Lys His His Trp Trp Trp Lys
Leu His Phe225 230 235
240 Val Trp Glu Arg Val Lys Ile Leu Arg Asp Tyr Ala Gly Leu Ile Leu
245 250 255 Phe Leu Glu Glu
Asp His Tyr Leu Ala Pro Asp Phe Tyr His Val Phe 260
265 270 Lys Lys Met Trp Lys Leu Lys Gln Gln
Glu Cys Pro Glu Cys Asp Val 275 280
285 Leu Ser Leu Gly Thr Tyr Ser Ala Ser Arg Ser Phe Tyr Gly
Met Ala 290 295 300
Asp Lys Val Asp Val Lys Thr Trp Lys Ser Thr Glu His Asn Met Gly305
310 315 320 Leu Ala Leu Thr Arg
Asn Ala Tyr Gln Lys Leu Ile Glu Cys Thr Asp 325
330 335 Thr Phe Cys Thr Tyr Asp Asp Tyr Asn Trp
Asp Trp Thr Leu Gln Tyr 340 345
350 Leu Thr Val Ser Cys Leu Pro Lys Phe Trp Lys Val Leu Val Pro
Gln 355 360 365 Ile
Pro Arg Ile Phe His Ala Gly Asp Cys Gly Met His His Lys Lys 370
375 380 Thr Cys Arg Pro Ser Thr
Gln Ser Ala Gln Ile Glu Ser Leu Leu Asn385 390
395 400 Asn Asn Lys Gln Tyr Met Phe Pro Glu Thr Leu
Thr Ile Ser Glu Lys 405 410
415 Phe Thr Val Val Ala Ile Ser Pro Pro Arg Lys Asn Gly Gly Trp Gly
420 425 430 Asp Ile Arg
Asp His Glu Leu Cys Lys Ser Tyr Arg Arg Leu Gln 435
440 445 21447PRTPan troglodytes 21Met Arg Phe
Arg Ile Tyr Lys Arg Lys Val Leu Ile Leu Thr Leu Val 1 5
10 15 Val Ala Ala Cys Gly Phe Val Leu
Trp Ser Ser Asn Gly Arg Gln Arg 20 25
30 Lys Asn Glu Ala Leu Ala Pro Pro Leu Leu Asp Ala Glu
Pro Ala Arg 35 40 45
Gly Ala Gly Gly Arg Gly Gly Asp His Pro Ser Val Ala Val Gly Ile 50
55 60 Arg Arg Val Ser Asn
Val Ser Ala Ala Pro Leu Val Pro Ala Val Pro65 70
75 80 Gln Pro Glu Ala Asp Asn Leu Thr Leu Arg
Tyr Arg Ser Leu Val Tyr 85 90
95 Gln Leu Asn Phe Asp Gln Thr Leu Arg Asn Val Asp Lys Ala Gly
Thr 100 105 110 Trp
Ala Pro Arg Glu Leu Val Leu Val Val Gln Val His Asn Arg Pro 115
120 125 Glu Tyr Leu Arg Leu Leu
Leu Asp Ser Leu Arg Lys Ala Gln Gly Ile 130 135
140 Asp Asn Val Leu Val Ile Phe Ser His Asp Phe
Trp Ser Thr Glu Ile145 150 155
160 Asn Gln Leu Ile Ala Gly Val Asn Phe Cys Pro Val Leu Gln Val Phe
165 170 175 Phe Pro Phe
Ser Ile Gln Leu Tyr Pro Asn Glu Phe Pro Gly Ser Asp 180
185 190 Pro Arg Asp Cys Pro Arg Asp Leu
Pro Lys Asn Ala Ala Leu Lys Leu 195 200
205 Gly Cys Ile Asn Ala Glu Tyr Pro Asp Ser Phe Gly His
Tyr Arg Glu 210 215 220
Ala Lys Phe Ser Gln Thr Lys His His Trp Trp Trp Lys Leu His Phe225
230 235 240 Val Trp Glu Arg Val
Lys Ile Leu Arg Asp Tyr Ala Gly Leu Val Leu 245
250 255 Phe Leu Glu Glu Asp His Tyr Leu Ala Pro
Asp Phe Tyr His Val Phe 260 265
270 Lys Lys Met Trp Lys Leu Lys Gln Gln Glu Cys Pro Glu Cys Asp
Val 275 280 285 Leu
Ser Leu Gly Thr Tyr Ser Ala Ser Arg Ser Phe Tyr Gly Met Ala 290
295 300 Asp Lys Val Asp Val Lys
Thr Trp Lys Ser Thr Glu His Asn Met Gly305 310
315 320 Leu Ala Leu Thr Arg Asn Ala Tyr Gln Lys Leu
Ile Glu Cys Thr Asp 325 330
335 Thr Phe Cys Thr Tyr Asp Asp Tyr Asn Trp Asp Trp Thr Leu Gln Tyr
340 345 350 Leu Thr Val
Ser Cys Leu Pro Lys Phe Trp Lys Val Leu Val Pro Gln 355
360 365 Val Pro Arg Ile Phe His Ala Gly
Asp Cys Gly Met His His Lys Lys 370 375
380 Thr Cys Arg Pro Ser Thr Gln Ser Ala Gln Ile Glu Ser
Leu Leu Asn385 390 395
400 Asn Asn Lys Gln Tyr Met Phe Pro Glu Thr Leu Thr Ile Ser Glu Lys
405 410 415 Phe Thr Val Val
Ala Ile Ser Pro Pro Arg Lys Asn Gly Gly Trp Gly 420
425 430 Asp Ile Arg Asp His Glu Leu Cys Lys
Ser Tyr Arg Arg Leu Gln 435 440
445 22447PRTOryctolagus cuniculus 22Met Arg Phe Arg Ile Tyr Lys
Arg Lys Val Leu Ile Leu Thr Leu Val 1 5 10
15 Val Ala Ala Cys Gly Phe Val Leu Trp Ser Ser Asn
Gly Arg Gln Arg 20 25 30
Lys Asn Glu Ala Leu Ala Pro Pro Leu Leu Asp Ala Glu Pro Ala Arg
35 40 45 Ala Ala Gly Gly
Arg Gly Gly Asp His Pro Ala Val Ser Val Gly Ile 50 55
60 Arg Arg Val Ser Asn Glu Ser Ala Ala
Pro Leu Val Pro Ala Ala Ala65 70 75
80 Gln Pro Glu Ala Asp Asn Gln Thr Leu Arg Tyr Arg Ser Leu
Val Tyr 85 90 95
Gln Leu Asn Phe Asp Gln Thr Leu Arg Asn Val Asp Lys Ala Gly Ser
100 105 110 Trp Ala Pro Arg Glu
Leu Val Leu Val Val Gln Val His Asn Arg Leu 115
120 125 Glu Tyr Leu Arg Leu Leu Leu Asp Ser
Leu Arg Lys Ala Gln Gly Ile 130 135
140 Glu Asp Val Leu Val Ile Phe Ser His Asp Phe Trp Ser
Pro Glu Ile145 150 155
160 Asn Gln Leu Ile Ala Gly Val Asp Phe Cys Pro Ile Leu Gln Val Phe
165 170 175 Phe Pro Phe Ser
Ile Gln Leu Tyr Pro Asn Glu Phe Pro Gly Ser Asp 180
185 190 Pro Arg Asp Cys Pro Arg Asp Leu Gln
Lys Asn Ala Ala Leu Lys Leu 195 200
205 Gly Cys Ile Asn Ala Glu Tyr Pro Asp Ser Phe Gly His Tyr
Arg Glu 210 215 220
Ala Lys Phe Ser Gln Thr Lys His His Trp Trp Trp Lys Leu His Phe225
230 235 240 Val Trp Glu Arg Val
Lys Val Leu Gln Asp Tyr Ala Gly Leu Ile Leu 245
250 255 Phe Leu Glu Glu Asp His Tyr Leu Ala Pro
Asp Phe Tyr His Val Phe 260 265
270 Lys Lys Met Trp Lys Leu Lys Gln Gln Glu Cys Pro Glu Cys Asp
Val 275 280 285 Leu
Ser Leu Gly Thr Tyr Thr Ala Ser Arg Ser Phe His Gly Ile Ala 290
295 300 His Lys Val Asp Val Lys
Thr Trp Lys Ser Thr Glu His Asn Met Gly305 310
315 320 Leu Ala Leu Thr Arg Asn Ala Tyr Gln Lys Leu
Ile Glu Cys Thr Asp 325 330
335 Thr Phe Cys Thr Tyr Asp Asp Tyr Asn Trp Asp Trp Thr Leu Gln Tyr
340 345 350 Leu Thr Val
Ser Cys Leu Pro Lys Leu Trp Arg Val Leu Val Pro Gln 355
360 365 Val Pro Arg Val Phe His Ala Gly
Asp Cys Gly Met His His Lys Lys 370 375
380 Thr Cys Arg Pro Phe Thr Gln Ser Ala Gln Ile Glu Ser
Leu Leu Asn385 390 395
400 Ser Asn Arg Gln Tyr Met Phe Pro Glu Thr Leu Ile Ile Ser Glu Lys
405 410 415 Ser Pro Val Val
Ser Ile Ala Ser Pro Arg Lys Asn Gly Gly Trp Gly 420
425 430 Asp Ile Arg Asp His Glu Leu Cys Lys
Ser Tyr Arg Arg Leu Gln 435 440
445 23446PRTAiluropoda melanoleuca 23Met Arg Phe Arg Ile Tyr Lys
Arg Lys Val Leu Ile Leu Thr Leu Val 1 5 10
15 Val Ala Ala Cys Gly Phe Val Leu Trp Ser Ser Asn
Gly Arg Gln Arg 20 25 30
Lys Asn Glu Ala Leu Ala Pro Pro Leu Leu Asp Ala Glu Pro Ala Arg
35 40 45 Gly Ala Gly Gly
Arg Gly Gly Asp His Ser Ala Val Ser Ala Gly Ile 50 55
60 Arg Arg Val Ser Asn Asp Ser Ala Ala
Pro Leu Val Pro Ala Ala Pro65 70 75
80 Gln Pro Glu Ala Asp Asn Leu Thr Leu Arg Tyr Arg Ser Leu
Val Tyr 85 90 95
Gln Leu Asn Phe Asp Gln Thr Leu Arg Asn Val Asp Lys Ala Gly Ser
100 105 110 Trp Ala Pro Arg Glu
Leu Val Leu Val Val Gln Val His Asn Arg Pro 115
120 125 Asp Tyr Leu Arg Leu Leu Leu Asp Ser
Leu Arg Lys Ala Gln Gly Ile 130 135
140 Asp Asn Val Leu Val Ile Phe Ser His Asp Phe Trp Ser
Thr Glu Ile145 150 155
160 Asn Gln Leu Ile Ala Gly Val Asp Phe Cys Pro Val Leu Gln Val Phe
165 170 175 Phe Pro Phe Ser
Ile Gln Leu Tyr Pro Asn Glu Phe Pro Gly Ser Asp 180
185 190 Pro Arg Asp Cys Pro Arg Asp Leu Glu
Lys Asn Ala Ala Leu Lys Met 195 200
205 Gly Cys Ile Asn Ala Glu Tyr Pro Asp Ser Phe Gly His Tyr
Arg Glu 210 215 220
Ala Lys Phe Ser Gln Thr Lys His His Trp Trp Trp Lys Leu His Phe225
230 235 240 Val Trp Glu Arg Val
Lys Val Leu Arg Asp Tyr Ala Gly Leu Ile Leu 245
250 255 Phe Leu Glu Glu Asp His Tyr Leu Ala Pro
Asp Phe Tyr His Val Phe 260 265
270 Lys Lys Met Trp Lys Leu Lys Gln Glu Glu Cys Thr Glu Cys Asp
Val 275 280 285 Leu
Ser Leu Gly Thr Tyr Thr Ala Val Arg Ser Phe His Gly Ile Ala 290
295 300 Asp Lys Val Asp Val Lys
Thr Trp Lys Ser Thr Glu His Asn Met Gly305 310
315 320 Leu Ala Leu Thr Arg Asp Ala Tyr Gln Lys Leu
Ile Glu Cys Thr Asp 325 330
335 Thr Phe Cys Thr Tyr Asp Asp Tyr Asn Trp Asp Trp Thr Leu Gln Tyr
340 345 350 Leu Thr Val
Ser Cys Leu Pro Lys Phe Trp Lys Val Leu Val Pro Gln 355
360 365 Val Pro Arg Ile Phe His Ala Gly
Asp Cys Gly Met His His Lys Lys 370 375
380 Thr Cys Arg Pro Ser Thr Gln Ser Ala Gln Ile Glu Ser
Leu Leu Asn385 390 395
400 Asn Asn Lys Gln Tyr Leu Phe Pro Glu Thr Leu Ile Ile Ser Glu Lys
405 410 415 Phe Val Ala Ala
Ile Ser Pro Pro Arg Lys Asn Gly Gly Trp Gly Asp 420
425 430 Ile Arg Asp His Glu Leu Cys Lys Ser
Tyr Arg Arg Leu Gln 435 440 445
24446PRTCanis familiaris 24Met Arg Phe Arg Ile Tyr Lys Arg Lys Val Leu
Ile Leu Thr Leu Val 1 5 10
15 Val Ala Ala Cys Gly Phe Val Leu Trp Ser Ser Asn Gly Arg Gln Arg
20 25 30 Lys Asn Glu
Ala Leu Ala Pro Pro Leu Leu Asp Ala Glu Pro Ala Arg 35
40 45 Gly Ala Gly Gly Arg Gly Gly Asp
His Ser Ala Val Ser Val Gly Ile 50 55
60 Arg Arg Gly Ser Asn Glu Ser Ala Ala Pro Leu Val Pro
Ala Ala Pro65 70 75 80
Gln Pro Glu Ala Asp Asn Leu Thr Leu Arg Tyr Arg Ser Leu Val Tyr
85 90 95 Gln Leu Asn Phe Asp
Gln Thr Leu Arg Asn Val Asp Lys Ala Gly Ser 100
105 110 Trp Ala Pro Arg Glu Leu Val Leu Val Val
Gln Val His Asn Arg Pro 115 120
125 Asp Tyr Leu Arg Leu Leu Leu Asp Ser Leu Arg Lys Ala Gln
Gly Ile 130 135 140
Asp Asn Val Leu Val Ile Phe Ser His Asp Phe Trp Ser Thr Glu Ile145
150 155 160 Asn Gln Leu Ile Ala
Gly Val Asp Phe Cys Pro Val Leu Gln Val Phe 165
170 175 Phe Pro Phe Ser Ile Gln Leu Tyr Pro Asn
Glu Phe Pro Gly Ser Asp 180 185
190 Pro Arg Asp Cys Pro Arg Asp Leu Glu Lys Asn Ala Ala Leu Lys
Met 195 200 205 Gly
Cys Ile Asn Ala Glu Tyr Pro Asp Ser Phe Gly His Tyr Arg Glu 210
215 220 Ala Lys Phe Ser Gln Thr
Lys His His Trp Trp Trp Lys Leu His Phe225 230
235 240 Val Trp Glu Arg Val Lys Val Leu Arg Asp Tyr
Ala Gly Leu Ile Leu 245 250
255 Phe Leu Glu Glu Asp His Tyr Leu Ala Pro Asp Phe Tyr His Val Phe
260 265 270 Lys Lys Met
Trp Lys Leu Lys Gln Glu Glu Cys Pro Glu Cys Asp Val 275
280 285 Leu Ser Leu Gly Thr Tyr Thr Ala
Ile Arg Ser Phe His Gly Ile Ala 290 295
300 Asp Lys Val Asp Val Lys Thr Trp Lys Ser Thr Glu His
Asn Met Gly305 310 315
320 Leu Ala Leu Thr Arg Asp Ala Tyr Gln Lys Leu Ile Glu Cys Thr Asp
325 330 335 Thr Phe Cys Thr
Tyr Asp Asp Tyr Asn Trp Asp Trp Thr Leu Gln Tyr 340
345 350 Leu Thr Val Ser Cys Leu Pro Lys Phe
Trp Lys Val Leu Val Pro Gln 355 360
365 Val Pro Arg Ile Phe His Ala Gly Asp Cys Gly Met His His
Lys Lys 370 375 380
Thr Cys Lys Pro Ser Thr Gln Ser Ala Gln Ile Glu Ser Leu Leu Asn385
390 395 400 Ser Asn Lys Gln Tyr
Leu Phe Pro Glu Thr Leu Ile Ile Ser Glu Lys 405
410 415 Phe Val Ala Ala Ile Ser Pro Pro Arg Lys
Asn Gly Gly Trp Gly Asp 420 425
430 Ile Arg Asp His Glu Leu Cys Lys Ser Tyr Arg Arg Leu Gln
435 440 445 25446PRTSus scrofa
25Met Arg Phe Arg Ile Tyr Lys Arg Lys Val Leu Ile Leu Thr Phe Val 1
5 10 15 Val Ala Ala Cys
Gly Phe Val Leu Trp Ser Ser Asn Gly Arg Gln Arg 20
25 30 Lys Asn Glu Ala Leu Ala Pro Pro Leu
Leu Asp Ala Glu Pro Val Arg 35 40
45 Gly Ala Gly Ala Arg Ala Gly Asp His Pro Ala Ile Ser Val
Gly Ile 50 55 60
Arg Arg Gly Ser Asn Asp Ser Ala Ala Pro Leu Val Ala Ala Ala Pro65
70 75 80 Gln Pro Glu Val Asp
Asn Leu Thr Leu Arg Tyr Arg Ser Leu Val Tyr 85
90 95 Gln Leu Asn Phe Asp Gln Thr Leu Arg Asn
Val Asp Lys Val Ser Ser 100 105
110 Trp Val Pro Arg Glu Leu Val Leu Val Val Gln Val His Asn Arg
Ala 115 120 125 Glu
Tyr Leu Lys Leu Leu Leu Asp Ser Leu Arg Lys Ala Gln Gly Ile 130
135 140 Asp Asn Val Leu Val Ile
Phe Ser His Asp Phe Trp Ser Thr Glu Ile145 150
155 160 Asn Gln Leu Ile Ala Gly Val Asp Phe Cys Pro
Val Leu Gln Val Phe 165 170
175 Phe Pro Phe Ser Ile Gln Leu Tyr Pro Asn Glu Phe Pro Gly Thr Asp
180 185 190 Pro Arg Asp
Cys Pro Arg Asp Leu Glu Lys Asn Ala Ala Leu Lys Met 195
200 205 Gly Cys Ile Asn Ala Glu Tyr Pro
Asp Ser Phe Gly His Tyr Arg Glu 210 215
220 Ala Lys Phe Ser Gln Thr Lys His His Trp Trp Trp Lys
Leu His Phe225 230 235
240 Val Trp Glu Arg Val Lys Val Leu Arg Asp Tyr Ala Gly Leu Ile Leu
245 250 255 Phe Leu Glu Glu
Asp His Tyr Val Ala Pro Asp Phe Tyr His Val Phe 260
265 270 Lys Lys Met Trp Asn Leu Lys Gln Gln
Glu Cys Pro Glu Cys Asp Val 275 280
285 Leu Ser Leu Gly Thr Tyr Thr Thr Val Arg Ser Phe Arg Asp
Val Ala 290 295 300
Asp Lys Val Asp Val Lys Thr Trp Lys Ser Thr Glu His Asn Met Gly305
310 315 320 Leu Ala Leu Thr Arg
Asp Ala Tyr Gln Lys Leu Ile Glu Cys Thr Asp 325
330 335 Thr Phe Cys Thr Tyr Asp Asp Tyr Asn Trp
Asp Trp Thr Leu Gln Tyr 340 345
350 Leu Thr Val Ser Cys Leu Pro Lys Phe Trp Lys Val Leu Val Pro
Gln 355 360 365 Val
Pro Arg Ile Phe His Ala Gly Asp Cys Gly Met His His Lys Lys 370
375 380 Thr Cys Arg Pro Ser Thr
Gln Ser Ala Gln Ile Glu Ser Leu Leu Asn385 390
395 400 Ser Asn Lys Gln Tyr Met Phe Pro Glu Thr Leu
Thr Ile Ser Glu Lys 405 410
415 Leu Thr Ala Ala Leu Ser Pro Pro Arg Lys Asn Gly Gly Trp Gly Asp
420 425 430 Ile Arg Asp
His Glu Leu Cys Lys Ser Tyr Arg Arg Leu Gln 435
440 445 26446PRTBos taurus 26Met Arg Phe Arg Ile Tyr
Lys Arg Lys Val Leu Ile Leu Met Leu Val 1 5
10 15 Val Ala Ala Cys Gly Phe Val Leu Trp Ser Ser
Asn Gly Arg Gln Arg 20 25 30
Lys Asn Glu Ala Leu Ala Pro Pro Leu Leu Asp Ala Asp Pro Val Arg
35 40 45 Gly Ala Gly
Ala Arg Ala Gly Asp His Pro Ala Val Ser Val Gly Ile 50
55 60 Arg Arg Gly Ser Asn Glu Ser Ala
Ala Pro Leu Val Ala Ala Ala Pro65 70 75
80 Gln Pro Glu Val Asp Asn Leu Thr Leu Arg Tyr Arg Ser
Leu Val Tyr 85 90 95
Gln Leu Asn Phe Asp Gln Thr Leu Arg Asn Val Asp Lys Ala Ala Ser
100 105 110 Trp Thr Pro Arg Glu
Leu Ala Leu Val Val Gln Val His Asn Arg Pro 115
120 125 Glu Tyr Leu Lys Leu Leu Leu Asp Ser
Leu Arg Lys Ala Gln Gly Ile 130 135
140 Asp Asp Val Leu Val Ile Phe Ser His Asp Phe Trp Ser
Thr Glu Ile145 150 155
160 Asn Gln Leu Ile Ala Gly Val Asp Phe Cys Pro Val Leu Gln Val Phe
165 170 175 Phe Pro Phe Ser
Ile Gln Leu Tyr Pro Asn Glu Phe Pro Gly Thr Asp 180
185 190 Pro Arg Asp Cys Pro Arg Asp Met Glu
Lys Asn Ala Ala Leu Arg Met 195 200
205 Gly Cys Ile Asn Ala Glu Tyr Pro Asp Ser Phe Gly His Tyr
Arg Glu 210 215 220
Ala Lys Phe Ser Gln Thr Lys His His Trp Trp Trp Lys Leu His Phe225
230 235 240 Val Trp Glu Arg Val
Lys Val Leu Arg Asp Tyr Ala Gly Leu Ile Leu 245
250 255 Phe Leu Glu Glu Asp His Tyr Leu Ala Pro
Asp Phe Tyr His Val Phe 260 265
270 Lys Lys Met Trp Lys Leu Lys Gln Leu Glu Cys Pro Glu Cys Asp
Val 275 280 285 Leu
Ser Leu Gly Thr Tyr Thr Ala Ile Arg Asn Phe Tyr Asp Val Ala 290
295 300 Asp Lys Val Asp Val Lys
Thr Trp Lys Ser Thr Glu His Asn Met Gly305 310
315 320 Leu Ala Leu Thr Arg Glu Ala Tyr Gln Lys Leu
Ile Glu Cys Thr Asp 325 330
335 Thr Phe Cys Thr Tyr Asp Asp Tyr Asn Trp Asp Trp Thr Leu Gln Tyr
340 345 350 Leu Thr Val
Ser Cys Leu Pro Lys Phe Trp Lys Val Leu Val Pro Gln 355
360 365 Val Pro Arg Ile Phe His Ala Gly
Asp Cys Gly Met His His Gln Lys 370 375
380 Thr Cys Arg Pro Ala Thr Gln Ser Ala Gln Leu Glu Ser
Leu Leu Asn385 390 395
400 Asn Asn Lys Gln Tyr Leu Phe Pro Glu Thr Leu Thr Ile Ser Glu Lys
405 410 415 Phe Met Thr Ser
Leu Ser Pro Pro Arg Lys Asn Gly Gly Trp Gly Asp 420
425 430 Ile Arg Asp His Glu Leu Cys Lys Ser
Tyr Arg Arg Leu Gln 435 440 445
27442PRTRattus norvegicus 27Met Arg Phe Arg Ile Tyr Lys Arg Lys Val Leu
Ile Leu Thr Leu Val 1 5 10
15 Val Ala Ala Cys Gly Phe Val Leu Trp Ser Ser Asn Gly Arg Gln Arg
20 25 30 Lys Asn Asp
Ala Leu Ala Pro Pro Leu Leu Asp Ser Glu Pro Leu Arg 35
40 45 Gly Ala Gly His Phe Ala Ala Ser
Val Gly Ile Arg Arg Val Ser Asn 50 55
60 Asp Ser Ala Ala Pro Leu Val Pro Ala Val Pro Arg Pro
Glu Val Asp65 70 75 80
Asn Leu Thr Leu Arg Tyr Arg Ser Leu Val Tyr Gln Leu Asn Phe Asp
85 90 95 Gln Met Leu Arg Asn
Val Asp Lys Asp Gly Thr Trp Ser Pro Gly Glu 100
105 110 Leu Val Leu Val Val Gln Val His Asn Arg
Pro Glu Tyr Leu Arg Leu 115 120
125 Leu Ile Asp Ser Leu Arg Lys Ala Gln Gly Ile Arg Glu Val
Leu Val 130 135 140
Ile Phe Ser His Asp Phe Trp Ser Ala Glu Ile Asn Ser Leu Ile Ser145
150 155 160 Ser Val Asp Phe Cys
Pro Val Leu Gln Val Phe Phe Pro Phe Ser Ile 165
170 175 Gln Leu Tyr Pro Ser Glu Phe Pro Gly Ser
Asp Pro Arg Asp Cys Pro 180 185
190 Arg Asp Leu Lys Lys Asn Ala Ala Leu Lys Leu Gly Cys Ile Asn
Ala 195 200 205 Glu
Tyr Pro Asp Ser Phe Gly His Tyr Arg Glu Ala Lys Phe Ser Gln 210
215 220 Thr Lys His His Trp Trp
Trp Lys Leu His Phe Val Trp Glu Arg Val225 230
235 240 Lys Val Leu Gln Asp Tyr Thr Gly Leu Ile Leu
Phe Leu Glu Glu Asp 245 250
255 His Tyr Leu Ala Pro Asp Phe Tyr His Val Phe Lys Lys Met Trp Lys
260 265 270 Leu Lys Gln
Gln Glu Cys Pro Gly Cys Asp Val Leu Ser Leu Gly Thr 275
280 285 Tyr Thr Thr Ile Arg Ser Phe Tyr
Gly Ile Ala Asp Lys Val Asp Val 290 295
300 Lys Thr Trp Lys Ser Thr Glu His Asn Met Gly Leu Ala
Leu Thr Arg305 310 315
320 Asp Ala Tyr Gln Lys Leu Ile Glu Cys Thr Asp Thr Phe Cys Thr Tyr
325 330 335 Asp Asp Tyr Asn
Trp Asp Trp Thr Leu Gln Tyr Leu Thr Leu Ala Cys 340
345 350 Leu Pro Lys Val Trp Lys Val Leu Val
Pro Gln Ala Pro Arg Ile Phe 355 360
365 His Ala Gly Asp Cys Gly Met His His Lys Lys Thr Cys Arg
Pro Ser 370 375 380
Thr Gln Ser Ala Gln Ile Glu Ser Leu Leu Asn Asn Asn Lys Gln Tyr385
390 395 400 Leu Phe Pro Glu Thr
Leu Val Ile Gly Glu Lys Phe Pro Met Ala Ala 405
410 415 Ile Ser Pro Pro Arg Lys Asn Gly Gly Trp
Gly Asp Ile Arg Asp His 420 425
430 Glu Leu Cys Lys Ser Tyr Arg Arg Leu Gln 435
440 28442PRTMus musculus 28Met Arg Phe Arg Ile Tyr Lys Arg
Lys Val Leu Ile Leu Thr Leu Val 1 5 10
15 Val Ala Ala Cys Gly Phe Val Leu Trp Ser Ser Asn Gly
Arg Gln Arg 20 25 30
Lys Ser Asp Ala Leu Gly Pro Pro Leu Leu Asp Ala Glu Pro Val Arg
35 40 45 Gly Ala Gly His
Leu Ala Val Ser Val Gly Ile Arg Arg Val Ser Asn 50 55
60 Glu Ser Ala Ala Pro Leu Val Pro Ala
Val Pro Arg Pro Glu Val Asp65 70 75
80 Asn Leu Thr Leu Arg Tyr Arg Ser Leu Val Tyr Gln Leu Asn
Phe Asp 85 90 95
Gln Met Leu Arg Asn Val Gly Asn Asp Gly Thr Trp Ser Pro Gly Glu
100 105 110 Leu Val Leu Val Val
Gln Val His Asn Arg Pro Glu Tyr Leu Arg Leu 115
120 125 Leu Ile Asp Ser Leu Arg Lys Ala Gln
Gly Ile Gln Glu Val Leu Val 130 135
140 Ile Phe Ser His Asp Phe Trp Ser Ala Glu Ile Asn Ser
Leu Ile Ser145 150 155
160 Arg Val Asp Phe Cys Pro Val Leu Gln Val Phe Phe Pro Phe Ser Ile
165 170 175 Gln Leu Tyr Pro
Asn Glu Phe Pro Gly Ser Asp Pro Arg Asp Cys Pro 180
185 190 Arg Asp Leu Lys Lys Asn Ala Ala Leu
Lys Leu Gly Cys Ile Asn Ala 195 200
205 Glu Tyr Pro Asp Ser Phe Gly His Tyr Arg Glu Ala Lys Phe
Ser Gln 210 215 220
Thr Lys His His Trp Trp Trp Lys Leu His Phe Val Trp Glu Arg Val225
230 235 240 Lys Val Leu Gln Asp
Tyr Thr Gly Leu Ile Leu Phe Leu Glu Glu Asp 245
250 255 His Tyr Leu Ala Pro Asp Phe Tyr His Val
Phe Lys Lys Met Trp Lys 260 265
270 Leu Lys Gln Gln Glu Cys Pro Gly Cys Asp Val Leu Ser Leu Gly
Thr 275 280 285 Tyr
Thr Thr Ile Arg Ser Phe Tyr Gly Ile Ala Asp Lys Val Asp Val 290
295 300 Lys Thr Trp Lys Ser Thr
Glu His Asn Met Gly Leu Ala Leu Thr Arg305 310
315 320 Asp Ala Tyr Gln Lys Leu Ile Glu Cys Thr Asp
Thr Phe Cys Thr Tyr 325 330
335 Asp Asp Tyr Asn Trp Asp Trp Thr Leu Gln Tyr Leu Thr Leu Ala Cys
340 345 350 Leu Pro Lys
Ile Trp Lys Val Leu Val Pro Gln Ala Pro Arg Ile Phe 355
360 365 His Ala Gly Asp Cys Gly Met His
His Lys Lys Thr Cys Arg Pro Ser 370 375
380 Thr Gln Ser Ala Gln Ile Glu Ser Leu Leu Asn Ser Asn
Lys Gln Tyr385 390 395
400 Leu Phe Pro Glu Thr Leu Val Ile Gly Glu Lys Phe Pro Met Ala Ala
405 410 415 Ile Ser Pro Pro
Arg Lys Asn Gly Gly Trp Gly Asp Ile Arg Asp His 420
425 430 Glu Leu Cys Lys Ser Tyr Arg Arg Leu
Gln 435 440 29444PRTMonodelphis domestica
29Met Arg Phe Arg Ile Tyr Lys Arg Lys Val Leu Ile Leu Thr Leu Val 1
5 10 15 Val Ala Ala Cys
Gly Phe Val Phe Trp Asn Ser Asn Gly Arg Gln Arg 20
25 30 Lys Asn Glu Ala Phe Ala Gly Ser Val
Pro Ala Pro Val Arg Ala Val 35 40
45 Gly Pro Gly Asp Leu Arg Arg Phe Pro Asn Gly Ser Ala Ala
Pro Pro 50 55 60
Pro Glu Val Asp Asn Met Thr Leu Val Tyr Arg Ser Leu Val Tyr Gln65
70 75 80 Val Asn Phe Asp Gln
Thr Leu Lys Asn Ala Leu Ala Ala Ala Ala Val 85
90 95 Gly Ala Gly Gly Ala Gly Gly Gly Gly Gly
Gly Pro Ala Gln Leu Glu 100 105
110 Leu Glu Leu Val Leu Val Val Gln Val His Asn Arg Pro Asp Tyr
Leu 115 120 125 Lys
Leu Leu Leu Asp Ser Leu Arg Lys Val Gln Gly Ile Gly Asn Leu 130
135 140 Leu Val Ile Phe Ser His
Asp Phe Trp Ser Ala Glu Ile Asn Gln Leu145 150
155 160 Ile Ala Gly Val Asp Phe Cys Pro Val Leu Gln
Val Phe Phe Pro Phe 165 170
175 Ser Ile Gln Leu Tyr Pro Asn Glu Phe Pro Gly Asn Asp Pro Lys Asp
180 185 190 Cys Pro Arg
Asp Leu Gln Lys Lys Ala Ala Leu Lys Met Gly Cys Ile 195
200 205 Asn Ala Glu Tyr Pro Asp Ser Phe
Gly His Tyr Arg Glu Ala Lys Phe 210 215
220 Ser Gln Thr Lys His His Trp Trp Trp Lys Leu His Phe
Ala Trp Glu225 230 235
240 Arg Val Lys Ile Leu Arg Asn Tyr Ala Gly Leu Met Val Phe Leu Glu
245 250 255 Glu Asp His Tyr
Leu Ala Pro Asp Phe Phe His Val Leu Lys Lys Met 260
265 270 Trp Lys Leu Lys Leu Gln Glu Cys Pro
Asp Cys Asp Val Leu Ser Leu 275 280
285 Gly Ser Tyr Ala Val Ser Arg Ser Phe Phe Gly Lys Ala Asp
Lys Val 290 295 300
Glu Val Lys Thr Trp Lys Ser Thr Glu His Asn Met Gly Leu Ala Leu305
310 315 320 Thr Arg Asp Thr Tyr
Gln Lys Leu Ile Glu Cys Thr Asp Thr Phe Cys 325
330 335 Thr Tyr Asp Asp Tyr Asn Trp Asp Trp Thr
Leu Gln Tyr Leu Thr Thr 340 345
350 Thr Cys Leu Lys Asn Phe Trp Lys Val Met Val Pro Glu Val Pro
Arg 355 360 365 Ile
Tyr His Ala Gly Asp Cys Gly Met His His Lys Asp Pro Cys Arg 370
375 380 Pro Ser Thr Gln Ser Ala
Gln Ile Glu Leu Leu Leu Asn Lys Asn Lys385 390
395 400 Gln Tyr Leu Phe Pro Lys Thr Leu Ser Ile Ser
Lys Lys Tyr Ser Met 405 410
415 Val Pro Leu Leu Pro His Gly Lys Asn Gly Gly Trp Gly Asp Ile Arg
420 425 430 Asp His Glu
Leu Cys Lys Ser Tyr Arg Arg Leu Gln 435 440
30432PRTXenopus laevis 30Met Arg Cys Arg Ile Tyr Lys Arg Lys Val
Ile Ile Leu Thr Leu Val 1 5 10
15 Val Val Ala Cys Gly Leu Ala Leu Trp Ser Ser Gly Arg Gln Lys
Lys 20 25 30 Asn
Gly Phe Val Pro Glu Val Glu Ser Asp Arg Phe Gln Asn Lys Gly 35
40 45 His Ile Ser Pro Ala Ala
Arg Lys Val Ser Asn Glu Ser Leu Ala Asn 50 55
60 Lys Glu Gln Lys Thr Arg Val Asp Asn Met Thr
Leu Val Tyr Arg Ser65 70 75
80 Val Val Phe Gln Trp Asn Phe Asp Gln Ala Ile Arg Asn Val Asp Lys
85 90 95 Ile Asn Arg
Pro Gln Asp Asp Val Val Val Val Val Gln Val His Asn 100
105 110 Arg Pro Glu Phe Leu Arg Arg Leu
Leu Asp Ser Leu Gly Lys Ala Lys 115 120
125 Gly Ile Glu Asn Val Leu Leu Val Phe Ser His Asp Tyr
Trp Ser Pro 130 135 140
Glu Ile Asn Gln Ile Ile Ala Ser Val Asp Phe Cys Gln Val Leu Gln145
150 155 160 Ile Phe Phe Pro Phe
Ser Ile Gln Leu Tyr Pro Asn Glu Phe Pro Gly 165
170 175 His Asp Pro Lys Asp Cys Pro Arg Asp Ile
Lys Lys Lys Asp Ala Val 180 185
190 Glu Leu Gly Cys Ile Asn Ala Glu Tyr Pro Asp Ser Phe Gly His
Tyr 195 200 205 Arg
Glu Ala Lys Phe Ser Gln Thr Lys His His Trp Trp Trp Lys Leu 210
215 220 Gln Phe Val Trp Asp Lys
Leu Lys Val Leu Lys Glu His Asn Gly Leu225 230
235 240 Val Leu Phe Ile Glu Glu Asp His Tyr Leu Ser
Pro Asp Phe Tyr Tyr 245 250
255 Thr Leu Lys Lys Met Trp Ser Lys Lys Asn Glu Glu Cys Pro Asp Cys
260 265 270 Asp Met Leu
Cys Leu Gly Thr Tyr Ala His Thr Pro Phe Ala Asp Lys 275
280 285 Ala Gly Lys Val Glu Val Lys Thr
Trp Lys Ser Thr Glu His Asn Met 290 295
300 Gly Met Ala Met Asn Arg Glu Thr Tyr Lys Lys Leu Val
Ala Cys Ser305 310 315
320 Glu Thr Phe Cys Thr Tyr Asp Asp Tyr Asn Trp Asp Trp Thr Leu Gln
325 330 335 Tyr Leu Thr Val
Asn Cys Leu Pro Lys Phe Trp Lys Val Met Val Pro 340
345 350 Glu Val Pro Arg Ile Tyr His Ile Gly
Asp Cys Gly Met His His Asn 355 360
365 Lys Pro Cys Arg Pro Thr Thr Glu Ser Ala Lys Leu Glu Ala
Leu Phe 370 375 380
Thr Ser Asn Gln Arg Asp Leu Phe Pro Glu Lys Ile Asp Ile Ser Arg385
390 395 400 Arg Tyr Thr Met Ala
Ala Leu Ser Pro His Val Lys Asn Gly Gly Trp 405
410 415 Gly Asp Ile Arg Asp His Glu Leu Cys Lys
Ser Tyr His Arg Leu Gln 420 425
430 31450PRTDanio rerio 31Met Arg Phe Arg Ile Tyr Lys Arg Lys
Val Val Ile Leu Thr Leu Val 1 5 10
15 Val Ile Ile Cys Gly Phe Ala Val Trp Asn Ser Gly Lys Pro
Lys Lys 20 25 30
Ala Ser Thr Val Phe Pro Lys Glu Val Glu Thr Val Lys Arg Ser Ser 35
40 45 Val Gly Ser Gln Ile
Gln Ala Thr Ile Pro Val Thr Arg Lys Pro Ile 50 55
60 Asn Glu Ser Ile Pro Glu Lys Gln Gln Gln
Gln Gln Pro Val Ala Lys65 70 75
80 Ser Glu Ala Asp Asn Thr Thr Leu Val Tyr Arg Gly Ile Val Phe
Gln 85 90 95 Leu
Asn Phe Asp Gln Asn Leu Lys Asn Glu Glu Lys Phe Arg Ala Val
100 105 110 Arg Gln Lys Asp Asp
Leu Val Ile Val Val Gln Val His Asn Arg Pro 115
120 125 Glu Tyr Leu Arg Leu Leu Val Asp Ser
Leu Arg Lys Ser Lys Gly Ile 130 135
140 Glu Asn Ile Leu Leu Ile Phe Ser His Asp Phe Trp Ser
Pro Glu Ile145 150 155
160 Asn Gln Ile Val Ala Ser Val Asp Phe Cys Leu Val Leu Gln Ile Phe
165 170 175 Phe Pro Phe Ser
Ile Gln Leu Tyr Pro Gln Glu Phe Pro Gly Asn Asp 180
185 190 Pro Arg Asp Cys Pro Arg Asp Ile Pro
Lys Lys Glu Ala Leu Thr Leu 195 200
205 Gly Cys Ile Asn Ala Glu Tyr Pro Asp Ser Phe Gly His Tyr
Arg Glu 210 215 220
Ala Lys Phe Ser Gln Thr Lys His His Trp Trp Trp Lys Leu His Phe225
230 235 240 Val Trp Asp Arg Val
Arg Val Leu Lys Asp His Lys Gly Leu Val Leu 245
250 255 Leu Ile Glu Glu Asp His Tyr Leu Ala Pro
Asp Phe Tyr His Leu Leu 260 265
270 Lys Leu Met Ala Ser Leu Lys Lys Glu Gln Cys Pro Asp Cys Asp
Ile 275 280 285 Leu
Ser Leu Gly Ser Tyr Gly His Ile Gly Tyr Ser Ser Lys Ala Asn 290
295 300 Lys Val Glu Val Lys Ala
Trp Lys Ser Thr Glu His Asn Met Gly Met305 310
315 320 Ala Leu Asn Arg Asp Ala Tyr Gln Lys Leu Leu
Arg Cys Thr Asp Ala 325 330
335 Phe Cys Thr Tyr Asp Asp Tyr Asn Trp Asp Trp Ser Leu Gln His Leu
340 345 350 Thr Val Thr
Cys Leu Pro Ala Phe Leu Lys Val Met Val Ser Glu Ala 355
360 365 Pro Arg Ile Phe His Ala Gly Asp
Cys Gly Met His His Lys Lys Ser 370 375
380 Ala Cys Met Pro Ser Gly Gln Lys Thr Lys Ile Glu Asn
Val Leu Gln385 390 395
400 Asn Ser Gly Asn Gln Leu Phe Pro Lys Gln Leu Leu Ile Thr Lys Arg
405 410 415 Leu Pro Ala Ser
Gly Ala Lys Gly Val Ala Pro His Val Lys Asn Gly 420
425 430 Gly Trp Gly Asp Ile Arg Asp His Glu
Leu Cys Lys Ser Tyr Leu Arg 435 440
445 Leu Gln 450 32465PRTSalmo salar 32Met Arg Phe Arg Val
Tyr Lys Arg Lys Val Val Ile Leu Thr Leu Val 1 5
10 15 Val Val Val Cys Gly Leu Ala Phe Trp Thr
Ser Gly Lys Gln Lys Lys 20 25
30 Ser Ser Gly Val Val Val Leu Lys Glu Ala Glu Gly Ala Arg Arg
Ser 35 40 45 Ser
Ser Ser Gln Val Gln Pro Gln Pro Gln Ala Thr Pro Glu Val Ser 50
55 60 Arg Ile Pro Asn Val Pro
Pro Ile Ala Pro Val Asn Glu Thr His Pro65 70
75 80 Lys Asn Gln Pro Glu Lys His Leu Glu Lys Glu
Glu Val Val Lys Pro 85 90
95 Glu Val Asp Asn Thr Thr Gln Val Tyr Arg Gly Ile Val Phe Gln Leu
100 105 110 Asn Phe Asp
Gln Thr Val Arg His Glu Glu Lys Phe Arg Ala Ala Arg 115
120 125 Lys Lys Asp Asp Leu Val Val Val
Val Gln Val His Asn Arg Pro Asp 130 135
140 Tyr Leu Arg Leu Leu Val Glu Ser Leu Arg Lys Ala Arg
Gly Val Glu145 150 155
160 Ser Ile Leu Leu Ile Phe Ser His Asp Phe Trp Ser Pro Glu Ile Asn
165 170 175 Gln Val Val Ala
Ser Val Asp Phe Cys Gln Val Leu Gln Ile Phe Phe 180
185 190 Pro Phe Ser Ile Gln Leu Tyr Pro Gln
Glu Phe Pro Gly His Asp Pro 195 200
205 Arg Asp Cys Pro Arg Asp Ile Ser Lys Ile Asp Ala Leu Lys
Leu Gly 210 215 220
Cys Ile Asn Ala Glu Tyr Pro Asp Ser Phe Gly His Tyr Arg Glu Ala225
230 235 240 Lys Phe Ser Gln Thr
Lys His His Trp Trp Trp Lys Leu His Phe Val 245
250 255 Trp Asp Arg Val Arg Ala Leu Lys Asp His
Arg Gly Leu Val Leu Leu 260 265
270 Ile Glu Glu Asp His Phe Leu Ser Pro Asp Phe Leu His Phe Leu
Lys 275 280 285 Leu
Met Ser Ile Leu Lys Arg Glu Asn Cys Pro Asp Cys Asp Ile Leu 290
295 300 Ser Leu Gly Ser Tyr Gly
His Ile Ser Tyr Pro Ser Lys Ala Asn Lys305 310
315 320 Val Glu Val Lys Ala Trp Lys Ser Thr Glu His
Asn Met Gly Met Ala 325 330
335 Leu Ser Arg Glu Thr Tyr Gln Lys Leu Ile Gln Cys Thr Asp Ala Phe
340 345 350 Cys Thr Tyr
Asp Asp Tyr Asn Trp Asp Trp Ser Leu Gln His Leu Thr 355
360 365 Val Thr Cys Leu Pro Ser Tyr Trp
Lys Val Met Val Ser Glu Ala Pro 370 375
380 Arg Val Phe His Ala Gly Asp Cys Gly Met His His Lys
Lys Ser Val385 390 395
400 Cys Met Pro Ser Ser Gln Lys Ser Lys Ile Asp Thr Ile Leu Gln Ser
405 410 415 Ser Ser Asn Gln
Leu Phe Pro Lys Asn Leu Leu Ile Thr Lys Arg Leu 420
425 430 Pro Ala Asn Gly Ala Gly Gly Val Ala
Pro His Val Lys Asn Gly Gly 435 440
445 Trp Gly Asp Ile Arg Asp His Glu Leu Cys Lys Ser Tyr Pro
Arg Leu 450 455 460
Gln465 33471PRTDrosophila melanogaster 33Met Gly Arg Lys Arg Asn Asn Phe
Tyr Met Arg Ser Leu Phe Leu Leu 1 5 10
15 Ala Leu Gly Ile Phe Gly Leu Leu Gln Tyr Asn Asn Phe
Asn Tyr Leu 20 25 30
Asp Ser Arg Asp Asn Val Leu Gly Asp Ala Val Thr Asn Asp Ser Asp
35 40 45 Asp Ala Ile Leu
Ala Met Val Pro Ala Thr Leu His Lys Tyr Leu Thr 50 55
60 Pro His Ser Arg Asn His Ser Ala Ser
Gly Ala Gly Ala Leu Asn Gly65 70 75
80 Ala Ala Leu Leu Leu Asn Ala Ser Ser Pro Gly Ala Ala Thr
Ala Ser 85 90 95
Thr Ile Ser Phe Asp Val Tyr His Pro Pro Asn Ile Thr Glu Ile Lys
100 105 110 Arg Gln Ile Val Arg
Tyr Asn Asp Met Gln Met Val Leu Asn Glu Asp 115
120 125 Val Phe Gly Pro Leu Gln Asn Asp Ser
Val Ile Ile Val Val Gln Val 130 135
140 His Thr Arg Ile Thr Tyr Leu Arg His Leu Ile Val Ser
Leu Ala Gln145 150 155
160 Ala Arg Asp Ile Ser Lys Val Leu Leu Val Phe Ser His Asp Tyr Tyr
165 170 175 Asp Asp Asp Ile
Asn Asp Leu Val Gln Gln Ile Asp Phe Cys Lys Val 180
185 190 Met Gln Ile Phe Tyr Pro Tyr Ser Ile
Gln Thr His Pro Asn Glu Tyr 195 200
205 Pro Gly Val Asp Pro Asn Asp Cys Pro Arg Asn Ile Lys Lys
Glu Gln 210 215 220
Ala Leu Ile Thr Asn Cys Asn Asn Ala Met Tyr Pro Asp Leu Tyr Gly225
230 235 240 His Tyr Arg Glu Ala
Lys Phe Thr Gln Thr Lys His His Trp Ile Trp 245
250 255 Lys Ala Asn Arg Val Phe Asn Glu Leu Glu
Val Thr Arg Tyr His Thr 260 265
270 Gly Leu Val Leu Phe Leu Glu Glu Asp His Tyr Val Ala Glu Asp
Phe 275 280 285 Leu
Tyr Leu Leu Ala Met Met Gln Gln Arg Thr Lys Asp Leu Cys Pro 290
295 300 Gln Cys Asn Val Leu Ser
Leu Gly Thr Tyr Leu Lys Thr Phe Asn Tyr305 310
315 320 Tyr Thr Tyr His Ser Lys Val Glu Val Met Pro
Trp Val Ser Ser Lys 325 330
335 His Asn Met Gly Phe Ala Phe Asn Arg Thr Thr Trp Ser Asn Ile Arg
340 345 350 Lys Cys Ala
Arg His Phe Cys Thr Tyr Asp Asp Tyr Asn Trp Asp Trp 355
360 365 Ser Leu Gln His Val Ser Gln Gln
Cys Leu Arg Arg Lys Leu His Ala 370 375
380 Met Ile Val Lys Gly Pro Arg Val Phe His Ile Gly Glu
Cys Gly Val385 390 395
400 His His Lys Asn Lys Asn Cys Glu Ser Asn Gln Val Ile Ser Lys Val
405 410 415 Gln His Val Leu
Arg Ile Ala Arg Asn Ser His Gln Leu Phe Pro Arg 420
425 430 Ser Leu Thr Leu Thr Val Pro Ser Leu
Met Lys Lys Ser Lys Leu Arg 435 440
445 Lys Gly Asn Gly Gly Trp Gly Asp Met Arg Asp His Glu Leu
Cys Leu 450 455 460
Asn Met Thr Leu Ala Thr Arg465 470 3454PRTHomo
sapiens 34Thr Arg Pro Ala Pro Gly Arg Pro Pro Ser Val Ser Ala Leu Asp Gly
1 5 10 15 Asp Pro
Ala Ser Leu Thr Arg Glu Val Ile Arg Leu Ala Gln Asp Ala 20
25 30 Glu Val Glu Leu Glu Arg Gln
Arg Gly Leu Leu Gln Gln Ile Gly Asp 35 40
45 Ala Leu Ser Ser Gln Arg 50
3515PRTArtificial SequenceSynthesized Construct 35Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser1 5 10
15 3610PRTArtificial SequenceSynthesized Construct
36Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser1 5
10 3721PRTTrichoderma reesei 37Ser Ser Ala Ala Thr Ala Thr Ala Ser
Ala Thr Val Pro Gly Gly Gly1 5 10
15 Ser Gly Pro Thr Ser 20
3819PRTTrichoderma reesei 38Ser Thr Gly Asn Pro Ser Gly Gly Asn Pro Pro
Gly Gly Asn Pro Pro1 5 10
15 Gly Ser Thr3910PRTTrichoderma reesei 39Met Ala Ser Thr Asn Ala
Arg Tyr Val Arg1 5 10 4017PRTTrichoderma
reesei 40Tyr Leu Leu Ile Ala Phe Phe Thr Ile Leu Val Phe Tyr Phe Val Ser1
5 10 15
Asn41379PRTTrichoderma reesei 41Ser Lys Tyr Glu Gly Val Asp Leu Asn Lys
Gly Thr Phe Thr Ala Pro 1 5 10
15 Asp Ser Thr Lys Thr Thr Pro Lys Pro Pro Ala Thr Gly Asp Ala
Lys 20 25 30 Asp
Phe Pro Leu Ala Leu Thr Pro Asn Asp Pro Gly Phe Asn Asp Leu 35
40 45 Val Gly Ile Ala Pro Gly
Pro Arg Met Asn Ala Thr Phe Val Thr Leu 50 55
60 Ala Arg Asn Ser Asp Val Trp Asp Ile Ala Arg
Ser Ile Arg Gln Val65 70 75
80 Glu Asp Arg Phe Asn Arg Arg Tyr Asn Tyr Asp Trp Val Phe Leu Asn
85 90 95 Asp Lys Pro
Phe Asp Asn Thr Phe Lys Lys Val Thr Thr Ser Leu Val 100
105 110 Ser Gly Lys Thr His Tyr Gly Glu
Ile Ala Pro Glu His Trp Ser Phe 115 120
125 Pro Asp Trp Ile Asp Gln Asp Lys Ala Lys Lys Val Arg
Glu Asp Met 130 135 140
Ala Glu Arg Lys Ile Ile Tyr Gly Asp Ser Val Ser Tyr Arg His Met145
150 155 160 Cys Arg Phe Glu Ser
Gly Phe Phe Phe Arg Gln Pro Leu Met Met Asn 165
170 175 Tyr Glu Tyr Tyr Trp Arg Val Glu Pro Ser
Ile Glu Leu Tyr Cys Asp 180 185
190 Ile His Tyr Asp Pro Phe Arg Leu Met Val Glu Gln Gly Lys Lys
Tyr 195 200 205 Ser
Phe Val Ile Ser Leu Tyr Glu Tyr Pro Ala Thr Ile Ala Thr Leu 210
215 220 Trp Glu Ser Thr Lys Lys
Phe Met Lys Asn His Pro Glu His Ile Ala225 230
235 240 Pro Asp Asn Ser Met Arg Phe Leu Ser Asp Asp
Gly Gly Glu Thr Tyr 245 250
255 Asn Asn Cys His Phe Trp Ser Asn Phe Glu Ile Gly Ser Leu Glu Trp
260 265 270 Leu Arg Ser
Lys Gln Tyr Ile Asp Phe Phe Glu Ser Leu Asp Lys Asp 275
280 285 Gly Gly Phe Phe Tyr Glu Arg Trp
Gly Asp Ala Pro Val His Ser Ile 290 295
300 Ala Ala Gly Leu Met Leu Asn Arg Ser Glu Ile His Phe
Phe Asn Asp305 310 315
320 Ile Ala Tyr Trp His Val Pro Phe Thr His Cys Pro Thr Gly Glu Lys
325 330 335 Thr Arg Leu Asp
Leu Lys Cys His Cys Asp Pro Lys Glu Asn Phe Asp 340
345 350 Trp Lys Gly Tyr Ser Cys Thr Ser Arg
Phe Phe Glu Met Asn Gly Met 355 360
365 Asp Lys Pro Glu Gly Trp Glu Asn Gln Gln Asp 370
375 428PRTTrichoderma reesei 42Met Ala Ile Ala
Arg Pro Val Arg1 5 4315PRTTrichoderma reesei
43Ala Leu Gly Gly Leu Ala Ala Ile Leu Trp Cys Phe Phe Leu Tyr1
5 10 15 44371PRTTrichoderma reesei
44Gln Leu Leu Arg Pro Ser Ser Ser Tyr Asn Ser Pro Gly Asp Arg Tyr 1
5 10 15 Ile Asn Phe Glu
Arg Asp Pro Asn Leu Asp Pro Thr Gly Glu Pro Glu 20
25 30 Gly Ile Leu Val Arg Thr Ser Asp Arg
Tyr Ala Pro Asp Ala Lys Asp 35 40
45 Thr Asp Arg Ala Ser Ala Thr Leu Leu Ala Leu Val Arg Asn
Glu Glu 50 55 60
Val Asp Asp Met Val Ala Ser Met Val Asp Leu Glu Arg Thr Trp Asn65
70 75 80 Ser Lys Phe Asn Tyr
Pro Trp Thr Phe Phe Asn Asp Lys Pro Phe Ser 85
90 95 Glu Glu Phe Lys Lys Lys Thr Ser Ala Val
Thr Asn Ala Thr Cys Asn 100 105
110 Tyr Glu Leu Ile Pro Lys Glu His Trp Asp Ala Pro Ser Trp Ile
Asp 115 120 125 Pro
Ala Ile Phe Glu Glu Ser Ala Ala Val Leu Lys Lys Asn Gly Val 130
135 140 Gln Tyr Ala Asn Met Met
Ser Tyr His Gln Met Cys Arg Trp Asn Ser145 150
155 160 Gly Met Phe Tyr Lys His Pro Ala Leu Lys Asp
Val Arg Tyr Tyr Trp 165 170
175 Arg Val Glu Pro Lys Val His Phe Phe Cys Asp Val Asp Tyr Asp Val
180 185 190 Phe Arg Tyr
Met Gln Asp Asn Asn Lys Thr Tyr Gly Phe Thr Ile Asn 195
200 205 Leu Tyr Asp Asp Pro His Thr Leu
Pro Thr Leu Trp Pro Gln Thr Ala 210 215
220 Lys Phe Leu Ala Asp His Pro Asn Tyr Leu His Glu His
Ser Ala Ile225 230 235
240 Lys Trp Val Ile Asp Asp Ala Arg Arg Pro Gln His Asn Arg Glu Ala
245 250 255 Gln Gly Phe Ser
Thr Cys His Phe Trp Ser Asn Phe Glu Val Ala Asp 260
265 270 Met Glu Phe Trp Arg Ser Lys Val Tyr
Glu Asp Tyr Phe Glu His Leu 275 280
285 Asp Arg Ala Gly Gly Phe Phe Tyr Glu Arg Trp Gly Asp Ala
Pro Val 290 295 300
His Ser Ile Ala Leu Gly Leu Phe Glu Asp Ser Ser Lys Ile His Trp305
310 315 320 Phe Arg Asp Ile Gly
Tyr Gln His Ile Pro Phe Phe Asn Cys Pro Asn 325
330 335 Ser Pro Lys Cys Lys Gly Cys Val Thr Gly
Arg Leu Thr Asp Gly Glu 340 345
350 Pro Phe Leu His Arg Glu Asp Cys Arg Pro Asn Trp Phe Lys Tyr
Ala 355 360 365 Gly
Met Gly 370 456PRTTrichoderma reesei 45Met Leu Asn Pro Arg Arg1
5 4615PRTTrichoderma reesei 46Ala Leu Ile Ala Ala Ala Phe
Ile Leu Thr Val Phe Phe Leu Ile1 5 10
15 47352PRTTrichoderma reesei 47Ser Arg Ser His Asn Ser Glu
Ser Ala Ser Thr Ser Glu Pro Lys Asp 1 5 10
15 Ala Glu Ala Glu Ala Leu Ser Ala Ala Asn Ala Gln
Gln Arg Ala Ala 20 25 30
Pro Pro Pro Pro Pro Gln Lys Pro Met Ile Asp Met Ser Gly Met Ser
35 40 45 Thr Tyr Asp Lys
Leu Ala Tyr Ala Tyr Glu Tyr Asp Ile Glu Ser Lys 50 55
60 Phe Pro Ala Tyr Ile Trp Gln Thr Trp
Arg Lys Thr Pro Ser Glu Gly65 70 75
80 Asp Phe Glu Phe Arg Glu Gln Glu Ala Ser Trp Ser Ile Glu
His Pro 85 90 95
Gly Phe Ile His Glu Val Ile Thr Asp Ser Val Ala Asp Thr Leu Leu
100 105 110 Gln Leu Leu Tyr Gly
Ser Ile Pro Glu Val Leu Glu Ala Tyr His Ala 115
120 125 Leu Pro Leu Pro Val Leu Lys Ala Asp
Leu Phe Arg Tyr Leu Ile Leu 130 135
140 Tyr Ala Arg Gly Gly Ile Tyr Ser Asp Ile Asp Thr Tyr
Ala Ile Arg145 150 155
160 Ser Ala Leu Glu Trp Ile Pro Pro Gln Ile Pro Lys Glu Thr Val Gly
165 170 175 Leu Val Ile Gly
Ile Glu Ala Asp Pro Asp Arg Pro Asp Trp Ala Asp 180
185 190 Trp Tyr Ser Arg Arg Ile Gln Phe Cys
Gln Trp Thr Ile Gln Ser Lys 195 200
205 Pro Gly His Pro Val Leu Arg Asp Ile Ile Ser Arg Ile Thr
Asn Gln 210 215 220
Thr Leu Glu Met Lys Lys Ser Gly Lys Leu Ser Ala Phe Gln Gly Asn225
230 235 240 Arg Val Val Asp Leu
Thr Gly Pro Ala Val Trp Thr Asp Thr Ile Met 245
250 255 Asp Tyr Phe Asn Asp Glu Arg Tyr Phe Asp
Met Glu Asn Ser Lys Gly 260 265
270 Arg Ile Asp Tyr Arg Asn Phe Thr Gly Met Glu Thr Ser Lys Arg
Val 275 280 285 Gly
Asp Val Val Val Leu Pro Ile Thr Ser Phe Ser Pro Gly Val Gly 290
295 300 Gln Met Gly Ala Lys Asp
Tyr Asp Asp Pro Met Ala Phe Val Lys His305 310
315 320 Asp Phe Glu Gly Thr Trp Lys Pro Glu Ser Glu
Arg His Ile Gly Glu 325 330
335 Ile Val Gln Glu Leu Gly Glu Gly Gln Gly Glu Ala Pro Lys Glu Gln
340 345 350
4822PRTTrichoderma reesei 48Met Gly Met Gly Gln Cys Gln Trp Ser Pro Phe
Arg Asn Lys Val Pro1 5 10
15 Thr Gln Met Arg Arg Cys 20
4915PRTTrichoderma reesei 49Leu Pro Leu Tyr Ile Thr Val Val Cys Val Phe
Leu Val Ile Val1 5 10 15
50362PRTTrichoderma reesei 50Asn Phe Asp Trp Ile Leu Ala Ile Pro Asn Pro
Ala Ser Val Leu Arg 1 5 10
15 Arg Glu Pro Lys Ala Pro Pro Leu Pro Gly Ser Thr Phe Pro Gln Lys
20 25 30 Ile Trp
Gln Thr Trp Lys Val Asp Pro Leu Asn Phe Asp Glu Arg Asp 35
40 45 Leu Val Thr Ala Arg Thr Trp
Thr Thr Ile Asn Pro Gly Met Arg Tyr 50 55
60 Glu Val Val Thr Asp Ala Asn Glu Met Ala Tyr Ile
Glu Asp Arg Tyr65 70 75
80 Gly Pro Asn Gly Phe Asp Arg Pro Asp Ile Val Glu Phe Tyr Lys Met
85 90 95 Ile Asn Leu Pro
Ile Ile Lys Ala Asp Leu Leu Arg Tyr Met Ile Met 100
105 110 Tyr Ala Glu Gly Gly Ile Tyr Ala Asp
Ile Asp Val Glu Thr Met Lys 115 120
125 Pro Phe His Arg Phe Ile Pro Asp Arg Tyr Asp Glu Lys Asp
Ile Asp 130 135 140
Ile Ile Ile Gly Val Glu Ile Asp Gln Pro Asp Phe Lys Asp His Pro145
150 155 160 Ile Leu Gly Lys Lys
Ser Met Ser Phe Cys Gln Trp Thr Phe Val Ala 165
170 175 Arg Pro Gln Gln Pro Val Met Met Arg Leu
Ile Glu Asn Ile Met Lys 180 185
190 Trp Phe Lys Thr Val Ala Arg Asp Gln Gly Val Pro Leu Gly Glu
Val 195 200 205 Gln
Leu Asp Phe Asp Gln Val Ile Ser Gly Thr Gly Pro Ser Ala Phe 210
215 220 Thr Lys Ala Met Leu Glu
Glu Met Asn Arg Lys Thr Lys Gly Pro Lys225 230
235 240 Val Thr Trp Asp Ala Phe His Asn Leu Asp Glu
Ser Lys Leu Val Gly 245 250
255 Gly Val Leu Val Leu Thr Val Glu Ala Phe Cys Ala Gly Gln Gly His
260 265 270 Ser Asp Ser
Gly Asn His Asn Ala Arg Asn Ala Leu Val Lys His His 275
280 285 Phe His Ala Ser Asn Trp Pro Ser
Arg His Pro Arg Tyr Lys His Pro 290 295
300 Ala Tyr Gly Gln Val Glu Asp Cys Asn Trp Val Pro Glu
Cys Val Arg305 310 315
320 Lys Trp Asp Glu Asp Thr Ser Asn Trp Asp Lys Tyr Ser Glu Asn Glu
325 330 335 Gln Lys Lys Ile
Leu Gln Asp Ile Glu Asn Ala Arg Leu Glu Arg Glu 340
345 350 Arg Gln Gln Gln Ala Leu Ala Ala Leu
Pro 355 360 5117PRTTrichoderma reesei
51Met Ala Arg Pro Met Gly Ser Val Arg Leu Lys Lys Ala Asn Pro Ser1
5 10 15
Thr5216PRTTrichoderma reesei 52Leu Ile Leu Gly Ala Val Leu Cys Ile Phe
Ile Ile Ile Phe Leu Val1 5 10
15 53339PRTTrichoderma reesei 53Ser Pro Ser Ser Pro Ala Ser Ala
Ser Arg Leu Ser Ile Val Ser Ala 1 5 10
15 Gln His His Leu Ser Pro Pro Thr Ser Pro Tyr Gln Ser
Pro Arg Ser 20 25 30
Gly Ala Val Gln Gly Pro Pro Pro Val Thr Arg Tyr Asn Leu Asn Lys
35 40 45 Val Thr Val Thr
Ser Asp Pro Val Arg Asn Gln Glu His Ile Leu Ile 50 55
60 Leu Thr Pro Met Ala Arg Phe Tyr Gln
Glu Tyr Trp Asp Asn Leu Leu65 70 75
80 Arg Leu Asn Tyr Pro His Glu Leu Ile Thr Leu Gly Phe Ile
Leu Pro 85 90 95
Lys Thr Lys Glu Gly Asn Gln Ala Thr Ser Met Leu Gln Lys Gln Ile
100 105 110 Gln Lys Thr Gln Asn
Tyr Gly Pro Glu Lys Asp Arg Phe Lys Ser Ile 115
120 125 Ile Ile Leu Arg Gln Asp Phe Asp Pro
Ala Val Val Ser Gln Asp Glu 130 135
140 Ser Glu Arg His Lys Leu Ala Asn Gln Lys Ala Arg Arg
Glu Val Met145 150 155
160 Ala Lys Ala Arg Asn Ser Leu Leu Phe Thr Thr Leu Gly Pro Ser Thr
165 170 175 Ser Trp Val Leu
Trp Leu Asp Ala Asp Ile Thr Glu Thr Ala Pro Thr 180
185 190 Leu Ile Gln Asp Leu Ala Ser His Asp
Lys Pro Ile Ile Val Ala Asn 195 200
205 Cys Phe Gln Lys Tyr Tyr Asp Pro Glu Ser Lys Lys Met Ala
Glu Arg 210 215 220 Pro
Tyr Asp Phe Asn Ser Trp Gln Asp Ser Glu Thr Ala Leu Lys Met225
230 235 240 Ala Glu Gln Met Gly Pro
Asp Asp Ile Leu Leu Glu Gly Tyr Ala Glu 245
250 255 Met Ala Thr Tyr Arg Thr Leu Leu Ala Tyr Met
Ser Thr Pro Gly Gly 260 265
270 Ser Lys Asp Leu Val Val Pro Leu Asp Gly Val Gly Gly Thr Ala
Leu 275 280 285 Leu
Val Lys Ala Asp Val His Arg Asp Gly Ala Met Phe Pro Pro Phe 290
295 300 Ala Phe Tyr His Leu Ile
Glu Ser Glu Gly Phe Ala Lys Met Ala Lys305 310
315 320 Arg Leu Gly Trp Gln Pro Tyr Gly Leu Pro Asn
Tyr Lys Val Tyr His 325 330
335 Tyr Asn Glu5431PRTTrichoderma reesei 54Met Leu Leu Pro Lys Gly
Gly Leu Asp Trp Arg Ser Ala Arg Ala Gln1 5
10 15 Ile Pro Pro Thr Arg Ala Leu Trp Asn Ala Val
Thr Arg Thr Arg 20 25 30
5515PRTTrichoderma reesei 55Phe Ile Leu Leu Val Gly Ile Thr Gly Leu Ile
Leu Leu Leu Trp 1 5 10 15
56358PRTTrichoderma reesei 56Arg Gly Val Ser Thr Ser Ala Ser Glu Met Gln
Ser Phe Tyr Cys Trp 1 5 10
15 Gly Pro Ala Lys Pro Pro Met Glu Met Ser Pro Asn Glu His Asn Arg
20 25 30 Trp Asn Gly
His Leu Gln Thr Pro Val Ile Phe Asn His His Ala Pro 35
40 45 Val Glu Val Asn Ser Ser Thr Ile
Glu His Val Asp Leu Asn Pro Ile 50 55
60 Asn Ser Thr Lys Gln Ala Val Thr Lys Glu Glu Arg Ile
Leu Ile Leu65 70 75 80
Thr Pro Leu Lys Asp Ala Ala Pro Tyr Leu Ser Lys Tyr Phe Glu Leu
85 90 95 Leu Ala Glu Leu Thr
Tyr Pro His Arg Leu Ile Asp Leu Ala Phe Leu 100
105 110 Val Ser Asp Ser Thr Asp Asp Thr Leu Ala
Val Leu Ala Ser Glu Leu 115 120
125 Asp Arg Ile Gln Lys Arg Pro Asp Gln Ile Pro Phe His Ser
Ala Thr 130 135 140
Val Ile Glu Lys Asp Phe Gly Phe Lys Leu Ser Gln Asn Val Glu Glu145
150 155 160 Arg His Ser Phe Glu
Ala Gln Gly Pro Arg Arg Lys Ala Met Gly Arg 165
170 175 Ala Arg Asn Tyr Leu Leu Tyr Thr Ala Leu
Lys Pro Glu His Ser Trp 180 185
190 Val Tyr Trp Arg Asp Val Asp Ile Val Asp Ser Pro Thr Gly Ile
Leu 195 200 205 Glu
Asp Phe Ile Ala His Asp Arg Asp Ile Leu Val Pro Asn Ile Trp 210
215 220 Phe His Arg Tyr Arg Asp
Gly Val Asp Ile Glu Gly Arg Phe Asp Tyr225 230
235 240 Asn Ser Trp Val Glu Ser Asp Lys Gly Arg Lys
Leu Ala Asn Ser Leu 245 250
255 Asp Lys Asp Val Val Leu Ala Glu Gly Tyr Lys Gln Tyr Asp Thr Gly
260 265 270 Arg Thr Tyr
Met Ala Lys Met Gly Asp Trp Arg Glu Asn Lys Asp Val 275
280 285 Glu Leu Glu Leu Asp Gly Ile Gly
Gly Val Asn Ile Leu Val Lys Ala 290 295
300 Asp Val His Arg Ser Gly Ile Asn Phe Pro Cys Tyr Ala
Phe Glu Asn305 310 315
320 Gln Ala Glu Thr Glu Gly Phe Ala Lys Met Ala Lys Arg Ala Gly Tyr
325 330 335 Glu Val Tyr Gly
Leu Pro Asn Tyr Val Val Trp His Ile Asp Thr Glu 340
345 350 Glu Lys Gly Gly Asn Ala 355
5745PRTTrichoderma reesei 57Met Met Pro Arg His His Ser Ser Gly
Phe Ser Asn Gly Tyr Pro Arg 1 5 10
15 Ala Asp Thr Phe Glu Ile Ser Pro His Arg Phe Gln Pro Arg
Ala Thr 20 25 30
Leu Pro Pro His Arg Lys Arg Lys Arg Thr Ala Ile Arg 35
40 45 5816PRTTrichoderma reesei 58Val Gly Ile Ala
Val Val Val Ile Leu Val Leu Val Leu Trp Phe Gly1 5
10 15 59407PRTTrichoderma reesei 59Gln Pro
Arg Ser Val Ala Ser Leu Ile Ser Leu Gly Ile Leu Ser Gly 1 5
10 15 Tyr Asp Asp Leu Lys Leu Glu
Thr Val Arg Tyr Tyr Asp Leu Ser Asn 20 25
30 Val Gln Gly Thr Ala Arg Gly Trp Glu Arg Glu Glu
Arg Ile Leu Leu 35 40 45
Cys Val Pro Leu Arg Asp Ala Glu Gln His Leu Pro Met Phe Phe Ser
50 55 60 His Leu Lys
Asn Phe Thr Tyr Pro His Asn Leu Ile Asp Leu Ala Phe65 70
75 80 Leu Val Ser Asp Ser Lys Asp His
Thr Leu Glu Ser Leu Thr Glu His 85 90
95 Leu Glu Ala Ile Gln Ala Asp Pro Asp Pro Lys Gln Pro
Tyr Gly Glu 100 105 110
Ile Ser Ile Ile Glu Lys Asp Phe Gly Gln Lys Val Asn Gln Asp Val
115 120 125 Glu Ser Arg His
Gly Phe Ala Ala Gln Ala Ser Arg Arg Lys Leu Met 130
135 140 Ala Gln Ala Arg Asn Trp Leu Leu
Ser Ala Ala Leu Arg Pro Tyr His145 150
155 160 Ser Trp Val Tyr Trp Arg Asp Val Asp Val Glu Thr
Ala Pro Phe Thr 165 170
175 Ile Leu Glu Asp Leu Met Arg His Asn Lys Asp Val Ile Val Pro Asn
180 185 190 Val Trp Arg
Pro Leu Pro Asp Trp Leu Gly Gly Glu Gln Pro Tyr Asp 195
200 205 Leu Asn Ser Trp Gln Glu Ser Glu
Thr Ala Leu Ala Leu Ala Asp Thr 210 215
220 Leu Asp Glu Asp Ala Val Ile Val Glu Gly Tyr Ala Glu
Tyr Ala Thr225 230 235
240 Trp Arg Pro His Leu Ala Tyr Leu Arg Asp Pro Tyr Gly Asp Pro Asp
245 250 255 Met Glu Met Glu
Ile Asp Gly Val Gly Gly Val Ser Ile Leu Ala Lys 260
265 270 Ala Lys Val Phe Arg Ala Gly Val His
Phe Pro Ala Phe Ser Phe Glu 275 280
285 Lys His Ala Glu Thr Glu Gly Phe Gly Lys Met Ala Lys Arg
Met His 290 295 300
Phe Ser Val Val Gly Leu Pro His Tyr Thr Ile Trp His Leu Tyr Glu305
310 315 320 Pro Ser Val Asp Asp
Ile Lys His Met Glu Glu Met Glu Arg Glu Arg 325
330 335 Ile Ala Arg Glu Lys Glu Glu Glu Glu Arg
Lys Lys Lys Glu Ala Gln 340 345
350 Ile Lys Glu Glu Phe Gly Asp Ala Asn Ser Gln Trp Glu Gln Asp
Lys 355 360 365 Gln
Gln Met Gln Asp Leu Lys Leu Gln Asp Arg Gly Gly Asp Lys Glu 370
375 380 Ala Ala Ala Ala Gly Val
Asn Gln Gly Ala Ala Ala Lys Ala Ala Gly385 390
395 400 Ala Met Glu Gly Gln Lys Asn
405 60119PRTTrichoderma reesei 60Met Ser Leu Ser Arg Ser Pro Ser
Pro Val Pro Gly Gly Gly Trp Ser 1 5 10
15 Ser Pro Gly Leu Asn Ile Asn Ser Gly Arg Ser Ser Pro
Ser Asn Ala 20 25 30
Ala Gly Ser Ser Val Ser Trp Glu Ser Ala Lys Met Arg Lys Gln Gly
35 40 45 Ala Asn Gly Tyr
Pro Ser Phe Ser Thr Gln Asn Gln Gly Phe Phe Thr 50 55
60 Arg His Met Arg Arg Ile Ser Ser Ser
Leu Pro Arg Phe Ala Ala Gly65 70 75
80 Pro Gly Asn Thr Tyr Ala Glu Arg Glu Lys Tyr Glu Arg Gly
Gly His 85 90 95
Ser Pro His Ala Gly Gly Gly Arg Leu Arg Ala Phe Leu Ala Arg Ile
100 105 110 Gly Arg Arg Leu Lys
Trp Arg 115 6115PRTTrichoderma reesei 61Ile Leu
Leu Pro Leu Ile Ile Ile Cys Thr Ile Val Ala Tyr Tyr 1 5
10 15 62325PRTTrichoderma reesei 62Gly Thr
His Glu Ala Pro Gly Phe Val His Trp Trp Arg Arg Ile Ser 1 5
10 15 Met Gly Gly Gly Gly Glu Lys
Phe Val Ile Ile Leu Gly Ala Asn Val 20 25
30 Gly Gly Gly Val Met Glu Trp Lys Gly Ala Arg Glu
Trp Ala Ile Glu 35 40 45
Arg Asp Ser Val Arg Asn Lys Arg Lys Tyr Ala Thr Arg Trp Gly Tyr
50 55 60 Asp Leu Glu
Ile Val Asp Met Lys Thr Lys Lys Arg Tyr Ala His Glu65 70
75 80 Trp Arg Glu Ser Trp Glu Lys Val
Asp Phe Ile Arg Ala Ala Met Arg 85 90
95 Lys Tyr Pro Lys Ala Glu Trp Phe Trp Trp Leu Asp Leu
Asn Thr Tyr 100 105 110
Val Met Glu Pro Ser Tyr Ser Leu Gln Arg His Leu Phe Asn His Leu
115 120 125 Asp Arg His Val
Tyr Arg Asp Ile Asn Val Phe Asn Pro Leu Asn Ile 130
135 140 Thr His Pro Pro Thr Glu Glu Tyr
Leu Asp Ala Glu Ala Arg Ser Pro145 150
155 160 Val Gly Asp Gly Asn Ile Asn Ser Val Asn Leu Met
Leu Thr Gln Asp 165 170
175 Cys Ser Gly Phe Asn Leu Gly Ser Phe Phe Ile Arg Arg Ser Ala Trp
180 185 190 Thr Glu Gln
Leu Leu Asp Ile Trp Trp Asp Pro Val Leu Tyr Glu Gln 195
200 205 Lys His Met Glu Trp Glu His Lys
Glu Gln Asp Ala Leu Glu Gln Leu 210 215
220 Tyr Arg Thr Gln Pro Trp Ile Arg Gln His Thr Gly Phe
Leu Pro Gln225 230 235
240 Arg Leu Ile Asn Ser Phe Pro Pro Ala Ala Cys Ala Asp Glu Ser Gly
245 250 255 Leu Asn Asn Thr
Arg Ile His Tyr Asn Glu Lys Asp Arg Asp Phe Val 260
265 270 Val Asn Met Ala Gly Cys Glu Trp Gly
Arg Asp Cys Trp Gly Glu Met 275 280
285 Tyr His Tyr Arg Glu Phe Ser Tyr Trp Leu Asn Arg Asn Pro
Trp Glu 290 295 300
Leu Phe Lys Glu Glu Ile Val Ala Val Ile Trp Tyr Lys Leu Thr Gly305
310 315 320 Gln Arg Val Lys Leu
325 6333PRTTrichoderma reesei 63Met His Phe Ala Tyr Pro Ser
Arg Lys Ser Ser Asn Pro Pro Pro Phe 1 5 10
15 Arg Pro Arg Ser Thr Arg Leu Pro Gly Leu Arg Arg
Ser Arg Ile Lys 20 25 30
Thr6415PRTTrichoderma reesei 64Ile Gly Ile Val Leu Phe Leu Val Leu
Ala Thr Leu Trp Phe Phe 1 5 10
15 65262PRTTrichoderma reesei 65Ser Asn Pro Arg Val Pro Arg Pro Asp
Pro Glu Arg Val Pro Ser Gly 1 5 10
15 Arg Pro Pro Val Val Leu Val Thr Val Ile Asp Pro Thr Gln
Tyr Pro 20 25 30
Asn Ala Tyr Leu Lys Thr Ile Lys Glu Asn Arg Glu Gln Tyr Ala Ala 35
40 45 Lys His Gly Tyr Glu
Ala Phe Ile Val Lys Ala Tyr Asp Tyr Asp Thr 50 55
60 Gln Gly Ala Pro Gln Ser Trp Ser Lys Leu
Met Ala Met Arg His Ala65 70 75
80 Leu Thr Lys Phe Pro Glu Cys Arg Phe Val Trp Tyr Leu Asp Gln
Asp 85 90 95 Ala
Tyr Ile Met Asp Met Ser Lys Ser Leu Glu Glu Gln Leu Leu Asn
100 105 110 Arg Gln Lys Leu Glu
Ser Leu Met Ile Lys Asn Tyr Pro Val Val Pro 115
120 125 Pro Asp Ser Ile Ile Lys Thr Phe Ser
His Leu Arg Pro Asp Glu Val 130 135
140 Asp Leu Ile Val Ser Gln Asp Ser Ser Gly Leu Val Ala
Gly Ser Val145 150 155
160 Val Val Arg Asn Ser Gln Trp Ser Lys Phe Leu Leu Glu Thr Trp Met
165 170 175 Asp Pro Leu Tyr
Arg Ser Tyr Asn Phe Gln Lys Ala Glu Arg His Ala 180
185 190 Leu Glu His Ile Val Gln Trp His Pro
Thr Ile Leu Ser Lys Leu Ala 195 200
205 Leu Val Pro Gln Arg Thr Leu Gly Pro Tyr Thr Arg Thr Asp
Gln Gly 210 215 220
Asp Ala Tyr Gln Asp Gly Asp Phe Val Val Met Phe Thr Gly Cys Thr225
230 235 240 Lys Ser Gly Glu Gln
Ser Cys Glu Thr Val Ser Ala Ser Tyr Tyr Gln 245
250 255 Lys Trp Ser Ser Ser Leu 260
6690PRTTrichoderma reesei 66Met Ile Arg Asp Pro Phe Gly Ile His Ser
Lys Asn Ala Phe Lys Ala 1 5 10
15 Thr Ala Leu Arg Ala Ala Arg Asp Ile Lys Glu Ala Ala Thr Gln
Ala 20 25 30 Gly
Ala Asn Ala Leu Glu Met Ser Phe Ser Leu Pro Lys His Val Pro 35
40 45 Asp Phe Gly Asp Pro Ser
Arg Ala Leu Glu Asp Arg Ala Trp Ala Ala 50 55
60 Leu Leu Pro Met Tyr Lys Asp Lys Pro Tyr Ala
Tyr Ala Pro Ser Met65 70 75
80 Arg Leu Arg Pro Trp Trp Arg Arg Arg Lys 85
90 6719PRTTrichoderma reesei 67Val Leu Gly Met Ile Ala Ala Ala
Val Met Phe Val Leu Tyr Val Thr 1 5 10
15 Gly Phe Phe68565PRTTrichoderma reesei 68Ser Ser Gly
Gln Thr Glu Glu Ala Lys Lys Lys Ala Ser Gly Ser Ala 1 5
10 15 Phe Ser Trp Leu Gly Leu Ser Gln
Glu Arg Gly Gly Val Asp Trp Asp 20 25
30 Glu Arg Arg Lys Ser Val Val Glu Ala Phe Glu Val Trp
Asp Ala Tyr 35 40 45
Glu Arg Tyr Ala Trp Gly Lys Asp Glu Phe His Pro Ile Ser Lys Asn 50
55 60 Gly Arg Asn Met Ala
Pro Lys Gly Leu Gly Trp Ile Ile Ile Asp Ser65 70
75 80 Leu Asp Thr Met Met Leu Met Asn Gln Thr
Thr Arg Leu Gln His Ala 85 90
95 Arg Glu Trp Ile Ser Thr Ser Leu Thr Trp Asp Gln Asp Gln Asp
Val 100 105 110 Asn
Thr Phe Glu Thr Thr Ile Arg Met Leu Gly Gly Leu Leu Ser Ala 115
120 125 His Tyr Leu Ser Thr Glu
Phe Pro Glu Leu Ala Pro Leu Thr Glu Asp 130 135
140 Asp Glu Gly Ala Pro Gly Glu Asp Leu Tyr Leu
Glu Lys Ala Lys Asp145 150 155
160 Leu Ala Asp Arg Leu Leu Ser Ala Phe Glu Ser Glu Ser Gly Ile Pro
165 170 175 Tyr Ala Ser
Val Asn Ile Gly Glu Tyr Lys Gly Pro Ser His Ser Asp 180
185 190 Asn Gly Ala Ser Ser Thr Ala Glu
Ala Thr Thr Leu Gln Leu Glu Phe 195 200
205 Lys Tyr Leu Ala Lys Leu Thr Gly Glu Lys Asn Phe Trp
Asp Lys Val 210 215 220
Glu Lys Val Met Glu Val Val Asp Asp Asn Gln Pro Glu Asp Gly Leu225
230 235 240 Val Pro Ile Tyr Ile
Tyr Ala Thr Thr Gly Glu Phe Arg Gly Gln Asn 245
250 255 Ile Arg Leu Gly Ser Arg Gly Asp Ser Tyr
Tyr Glu Tyr Leu Ile Lys 260 265
270 Gln Tyr Leu Gln Thr Asn Lys Gln Glu Pro Ile Tyr Glu Glu Met
Trp 275 280 285 Asp
Glu Ala Leu Ala Gly Val Arg Lys His Leu Val Thr Tyr Thr Glu 290
295 300 Pro Ser Glu Phe Thr Ile
Ile Ala Glu Arg Pro Asp Gly Leu Glu His305 310
315 320 Pro Met Ser Pro Lys Met Asp His Leu Val Cys
Phe Met Pro Gly Thr 325 330
335 Ile Ala Leu Ala Ala Thr Gly Gly Leu Thr Glu Ala Glu Ala Arg Lys
340 345 350 Leu Ser Thr
Trp Asn Lys Lys Lys Asp Asp Asp Met Gln Leu Ala Arg 355
360 365 Glu Leu Met His Thr Cys Trp Gly
Met Tyr Lys Tyr Met Lys Thr Gly 370 375
380 Leu Ala Pro Glu Ile Met Tyr Phe Asn Ile Pro Asn Pro
Pro Pro Glu385 390 395
400 Ser Ser Ala Pro His Gln Ala Pro Ala Ala Phe Asp Glu Asp Pro His
405 410 415 Ala Glu Trp Arg
Lys Asp Phe Val Val His Ser Asn Asp Val His Asn 420
425 430 Leu Gln Arg Pro Glu Thr Val Glu Ser
Leu Phe Tyr Met Trp Arg Ile 435 440
445 Thr Gly Asp Val Lys Tyr Arg Glu Trp Gly Trp Asp Met Phe
Lys Ser 450 455 460
Phe Val Asn Tyr Thr Ala Val Glu Asp Gln Gly Gly Phe Thr Ser Leu465
470 475 480 Leu Asp Ala Asn Ser
Ile Pro Pro Thr Pro Lys Asp Asn Met Glu Ser 485
490 495 Phe Trp Leu Ala Glu Thr Leu Lys Tyr Met
Tyr Leu Leu Phe Ser Pro 500 505
510 Asn Asp Val Leu Pro Leu His Lys Ile Val Leu Asn Thr Glu Ala
His 515 520 525 Pro
Phe Pro Arg Phe Asp Met Gly Pro Leu Phe Ser Thr Gly Trp Lys 530
535 540 Arg Lys Pro Arg Asp Gly
Ser Ala Lys Lys Lys Ala Thr Thr Ala Ala545 550
555 560 Thr Thr Asp Ala Glu 565
697PRTTrichoderma reesei 69Met Ala Arg Arg Arg Tyr Arg1 5
7015PRTTrichoderma reesei 70Leu Phe Met Ile Cys Ala Ala Val Ile
Leu Phe Leu Leu Tyr Arg 1 5 10
15 71871PRTTrichoderma reesei 71Val Ser Gln Asn Thr Trp Asp Asp Ser
Ala His Tyr Ala Thr Leu Arg 1 5 10
15 His Pro Pro Ala Ser Asn Pro Pro Ala Ala Gly Gly Glu Ser
Pro Leu 20 25 30
Lys Pro Ala Ala Lys Pro Glu His Glu His Glu His Glu Asn Gly Tyr 35
40 45 Ala Pro Glu Ser Lys
Pro Lys Pro Gln Ser Glu Pro Lys Pro Glu Ser 50 55
60 Lys Pro Ala Pro Glu His Ala Ala Gly Gly
Gln Lys Ser Gln Gly Lys65 70 75
80 Pro Ser Tyr Glu Asp Asp Glu Glu Thr Gly Lys Asn Pro Pro Lys
Ser 85 90 95 Ala
Val Ile Pro Ser Asp Thr Arg Leu Pro Pro Asp Asn Lys Val His
100 105 110 Trp Arg Pro Val Lys
Glu His Phe Pro Val Pro Ser Glu Ser Val Ile 115
120 125 Ser Leu Pro Thr Gly Lys Pro Leu Lys
Val Pro Arg Val Gln His Glu 130 135
140 Phe Gly Val Glu Ser Pro Glu Ala Lys Ser Arg Arg Val
Ala Arg Gln145 150 155
160 Glu Arg Val Gly Lys Glu Ile Glu Arg Ala Trp Ser Gly Tyr Lys Lys
165 170 175 Phe Ala Trp Met
His Asp Glu Leu Ser Pro Val Ser Ala Lys His Arg 180
185 190 Asp Pro Phe Cys Gly Trp Ala Ala Thr
Leu Val Asp Ser Leu Asp Thr 195 200
205 Leu Trp Ile Ala Gly Leu Lys Glu Gln Phe Asp Glu Ala Ala
Arg Ala 210 215 220
Val Glu Gln Ile Asp Phe Thr Thr Thr Pro Arg Asn Asn Ile Pro Val225
230 235 240 Phe Glu Thr Thr Ile
Arg Tyr Leu Gly Gly Leu Leu Gly Ala Phe Asp 245
250 255 Val Ser Gly Gly His Asp Gly Gly Tyr Pro
Met Leu Leu Thr Lys Ala 260 265
270 Val Glu Leu Ala Glu Ile Leu Met Gly Ile Phe Asp Thr Pro Asn
Arg 275 280 285 Met
Pro Ile Leu Tyr Tyr Gln Trp Gln Pro Glu Tyr Ala Ser Gln Pro 290
295 300 His Arg Ala Gly Ser Val
Gly Ile Ala Glu Leu Gly Thr Leu Ser Met305 310
315 320 Glu Phe Thr Arg Leu Ala Gln Leu Thr Ser Gln
Tyr Lys Tyr Tyr Asp 325 330
335 Ala Val Asp Arg Ile Thr Asp Ala Leu Ile Glu Leu Gln Lys Gln Gly
340 345 350 Thr Ser Ile
Pro Gly Leu Phe Pro Glu Asn Leu Asp Ala Ser Gly Cys 355
360 365 Asn His Thr Ala Thr Ala Leu Arg
Ser Ser Leu Ser Glu Ala Ala Gln 370 375
380 Lys Gln Met Asp Glu Asp Leu Ser Asn Lys Pro Glu Asn
Tyr Arg Pro385 390 395
400 Gly Lys Asn Ser Lys Ala Asp Pro Gln Thr Val Glu Lys Gln Pro Ala
405 410 415 Lys Lys Gln Asn
Glu Pro Val Glu Lys Ala Lys Gln Val Pro Thr Gln 420
425 430 Gln Thr Ala Lys Arg Gly Lys Pro Pro
Phe Gly Ala Asn Gly Phe Thr 435 440
445 Ala Asn Trp Asp Cys Val Pro Gln Gly Leu Val Val Gly Gly
Tyr Gly 450 455 460
Phe Gln Gln Tyr His Met Gly Gly Gly Gln Asp Ser Ala Tyr Glu Tyr465
470 475 480 Phe Pro Lys Glu Tyr
Leu Leu Leu Gly Gly Leu Glu Ser Lys Tyr Gln 485
490 495 Lys Leu Tyr Val Asp Ala Val Glu Ala Ile
Asn Glu Trp Leu Leu Tyr 500 505
510 Arg Pro Met Thr Asp Gly Asp Trp Asp Ile Leu Phe Pro Ala Lys
Val 515 520 525 Ser
Thr Ala Gly Asn Pro Ser Gln Asp Leu Val Ala Thr Phe Glu Val 530
535 540 Thr His Leu Thr Cys Phe
Ile Gly Gly Met Tyr Gly Leu Gly Gly Lys545 550
555 560 Ile Phe Gly Arg Glu Lys Asp Leu Glu Thr Ala
Lys Arg Leu Thr Asp 565 570
575 Gly Cys Val Trp Ala Tyr Gln Ser Thr Val Ser Gly Ile Met Pro Glu
580 585 590 Gly Ser Gln
Val Leu Ala Cys Pro Thr Leu Glu Lys Cys Asp Phe Asn 595
600 605 Glu Thr Leu Trp Trp Glu Lys Leu
Asp Pro Ala Lys Asp Trp Arg Asp 610 615
620 Lys Gln Val Ala Asp Asp Lys Asp Lys Ala Thr Val Gly
Glu Ala Leu625 630 635
640 Lys Glu Thr Ala Asn Ser His Asp Ala Ala Gly Gly Ser Lys Ala Val
645 650 655 His Lys Arg Ala
Ala Val Pro Leu Pro Lys Pro Gly Ala Asp Asp Asp 660
665 670 Val Gly Ser Glu Leu Pro Gln Ser Leu
Lys Asp Lys Ile Gly Phe Lys 675 680
685 Asn Gly Glu Gln Lys Lys Pro Thr Gly Ser Ser Val Gly Ile
Gln Arg 690 695 700
Asp Pro Asp Ala Pro Val Asp Ser Val Leu Glu Ala His Arg Leu Pro705
710 715 720 Pro Gln Glu Pro Glu
Glu Gln Gln Val Ile Leu Pro Asp Lys Pro Gln 725
730 735 Thr His Glu Glu Phe Val Lys Gln Arg Ile
Ala Glu Met Gly Phe Ala 740 745
750 Pro Gly Val Val His Ile Gln Ser Arg Gln Tyr Ile Leu Arg Pro
Glu 755 760 765 Ala
Ile Glu Ser Val Trp Tyr Met Tyr Arg Ile Thr Gly Asp Pro Ile 770
775 780 Trp Met Glu Lys Gly Trp
Lys Met Phe Glu Ala Thr Ile Arg Ala Thr785 790
795 800 Arg Thr Glu Ile Ala Asn Ser Ala Ile Asp Asp
Val Asn Ser Glu Glu 805 810
815 Pro Gly Leu Lys Asp Glu Met Glu Ser Phe Trp Leu Ala Glu Thr Leu
820 825 830 Lys Tyr Tyr
Tyr Leu Leu Phe Ser Glu Pro Ser Val Ile Ser Leu Asp 835
840 845 Glu Trp Val Leu Asn Thr Glu Ala
His Pro Phe Lys Arg Pro Gly Gly 850 855
860 Ser Val Ile Gly His Ser Ile865 870
7213PRTTrichoderma reesei 72Met Leu Asn Gln Leu Gln Gly Arg Val Pro Arg
Arg Tyr 1 5 10
7315PRTTrichoderma reesei 73Ile Ala Leu Val Ala Phe Ala Phe Phe Val Ala
Phe Leu Leu Trp 1 5 10 15
74542PRTTrichoderma reesei 74Ser Gly Tyr Asp Phe Val Pro Arg Thr Ala Thr
Val Gly Arg Phe Lys 1 5 10
15 Tyr Val Pro Ser Ser Tyr Asp Trp Ser Lys Ala Lys Val Tyr Tyr Pro
20 25 30 Val Lys Asp
Met Lys Thr Leu Pro Gln Gly Thr Pro Val Thr Phe Pro 35
40 45 Arg Leu Gln Leu Arg Asn Gln Ser
Glu Ala Gln Asp Asp Thr Thr Lys 50 55
60 Ala Arg Lys Gln Ala Val Lys Asp Ala Phe Val Lys Ser
Trp Glu Ala65 70 75 80
Tyr Lys Thr Tyr Ala Trp Thr Lys Asp Gln Leu Gln Pro Leu Ser Leu
85 90 95 Ser Gly Lys Glu Thr
Phe Ser Gly Trp Ser Ala Gln Leu Val Asp Ala 100
105 110 Leu Asp Thr Leu Trp Ile Met Asp Leu Lys
Asp Asp Phe Phe Leu Ala 115 120
125 Val Lys Glu Val Ala Val Ile Asp Trp Ser Lys Thr Lys Asp
Asn Lys 130 135 140
Val Ile Asn Leu Phe Glu Val Thr Ile Arg Tyr Leu Gly Gly Leu Ile145
150 155 160 Ala Ala Tyr Asp Leu
Ser Gln Glu Pro Val Leu Arg Ala Lys Ala Ile 165
170 175 Glu Leu Gly Asp Thr Leu Tyr Ala Thr Phe
Asp Thr Pro Asn Arg Leu 180 185
190 Pro Ser His Trp Leu Asp Tyr Ser Lys Ala Lys Lys Gly Thr Gln
Arg 195 200 205 Ala
Asp Asp Ser Met Ser Gly Ala Ala Gly Gly Thr Leu Cys Met Glu 210
215 220 Phe Thr Arg Leu Ser Gln
Ile Thr Gly Asp Pro Lys Tyr Tyr Asp Ala225 230
235 240 Thr Glu Arg Ile Lys Gln Phe Phe Tyr Arg Phe
Gln Asn Glu Thr Thr 245 250
255 Leu Pro Gly Met Trp Pro Val Met Met Asn Tyr Arg Glu Glu Thr Met
260 265 270 Val Glu Ser
Arg Tyr Ser Met Gly Gly Ser Ala Asp Ser Leu Tyr Glu 275
280 285 Tyr Leu Val Lys Met Pro Ala Leu
Leu Gly Gly Leu Asp Pro Gln Tyr 290 295
300 Pro Glu Met Ala Ile Arg Ala Leu Asp Thr Ala Arg Asp
Asn Leu Leu305 310 315
320 Phe Arg Pro Met Thr Glu Lys Gly Asp Asn Ile Leu Ala Leu Gly Asn
325 330 335 Ala Leu Val Asp
His Gly Asn Val Gln Arg Ile Thr Glu Met Gln His 340
345 350 Leu Thr Cys Phe Ala Gly Gly Met Tyr
Ala Met Ala Gly Lys Leu Phe 355 360
365 Lys Arg Asp Asp Tyr Val Asp Leu Gly Ser Arg Ile Ser Ser
Gly Cys 370 375 380
Val Trp Ala Tyr Asp Ser Phe Pro Ser Gly Ile Met Pro Glu Ser Ala385
390 395 400 Asp Met Ala Ala Cys
Ala Lys Leu Asp Gly Pro Cys Pro Tyr Asp Glu 405
410 415 Val Lys Ala Pro Val Asp Pro Asp Gly Arg
Arg Pro His Gly Phe Ile 420 425
430 His Val Lys Ser Arg His Tyr Leu Leu Arg Pro Glu Ala Ile Glu
Ser 435 440 445 Val
Phe Tyr Met Trp Arg Ile Thr Gly Asp Gln Val Trp Arg Asp Thr 450
455 460 Ala Trp Arg Met Trp Glu
Asn Ile Val Arg Glu Ala Glu Thr Glu His465 470
475 480 Ala Phe Ala Ile Val Glu Asp Val Thr Arg Thr
Ala Ser Lys Leu Thr 485 490
495 Asn Asn Tyr Leu Leu Gln Thr Phe Trp Leu Ala Glu Thr Leu Lys Tyr
500 505 510 Phe Tyr Leu
Ile Phe Asp Asp Glu Ser Ala Ile Asp Leu Asp Lys Trp 515
520 525 Val Phe Asn Thr Glu Ala His Pro
Phe Lys Arg Pro Ala Val 530 535 540
7513PRTTrichoderma reesei 75Met Leu Val Val Gly Arg Pro Arg Leu Val
Arg Asn Ser 1 5 10
7616PRTTrichoderma reesei 76Ile Ile Leu Thr Leu Ala Ile Leu Ser Ile Trp
His Leu Gly Leu Leu 1 5 10
15 77576PRTTrichoderma reesei 77Ser Arg Thr Pro Thr Ser Ala Ser Ala
Leu Val Ser Ala Ser Val Ser 1 5 10
15 Ala Ser Ser Glu Trp Ser Arg Leu Glu Arg Leu Met Asn Arg
Gly Ala 20 25 30
Pro Leu Thr Pro Tyr Pro Asp Ser Asn Ser Ser Phe Asp Trp Ser Ala 35
40 45 Ile Pro Phe Arg Tyr
Pro Pro His Asn Thr Thr His Leu Pro Pro Arg 50 55
60 His Lys Gln Pro Pro Leu Pro Arg Ile Gln
His Arg Phe Gly Pro Glu65 70 75
80 Ser Pro Ala Ala Ala Lys Glu Arg Ile Lys Arg Leu Lys Ala Val
Lys 85 90 95 Gln
Val Phe Leu Arg Ala Trp Gln Ala Tyr Lys Gly Tyr Ala Trp Lys
100 105 110 Gln Asp Ala Leu Leu
Pro Ile Ser Gly Gly Gly Arg Glu Gln Phe Ser 115
120 125 Gly Trp Ala Ala Thr Leu Val Asp Ala
Leu Asp Thr Leu Trp Ile Met 130 135
140 Gly Leu Arg Glu Glu Phe Asp Glu Ala Val Ala Ala Val
Ala Glu Ile145 150 155
160 Asp Phe Gly Ser Ser Thr Ser Ser Arg Val Asn Ile Phe Glu Thr Asn
165 170 175 Ile Arg Tyr Leu
Gly Gly Leu Leu Ala Ala Tyr Asp Leu Ser Gly Arg 180
185 190 Glu Val Leu Leu Lys Lys Ala Val Glu
Leu Gly Asp Leu Ile Tyr Ala 195 200
205 Gly Phe Asn Thr Glu Asn Gly Met Pro Val Asp Phe Leu Asn
Phe Tyr 210 215 220
Ser Ala Lys Ser Gly Glu Gly Leu Val Val Glu Ser Ser Val Val Ser225
230 235 240 Ala Ser Pro Gly Thr
Leu Ser Leu Glu Leu Ala His Leu Ser Gln Val 245
250 255 Thr Gly Asp Asp Lys Tyr Tyr Ser Ala Val
Ser Gln Val Met Asp Val 260 265
270 Phe Tyr Gln Gly Gln Asn Lys Thr Arg Leu Pro Gly Val Trp Pro
Ile 275 280 285 Asp
Val Asn Met Arg Ala Lys Asp Val Val Ser Gly Ser Arg Phe Thr 290
295 300 Leu Gly Gly Cys Ala Asp
Ser Leu Tyr Glu Tyr Leu Pro Lys Met His305 310
315 320 Gln Leu Leu Gly Gly Gly Glu Pro Lys Tyr Glu
Thr Met Ser Arg Thr 325 330
335 Phe Leu Gln Ala Ala Asp Arg His Phe Val Phe Arg Pro Met Leu Pro
340 345 350 Gly Ala Glu
Glu Asp Val Leu Met Pro Gly Asn Val Asn Val Asp Glu 355
360 365 Asp Ser Gly Glu Ala Val Leu Asp
Pro Glu Thr Glu His Leu Ala Cys 370 375
380 Phe Val Gly Gly Met Phe Gly Leu Ala Gly Arg Leu Phe
Ser Arg Pro385 390 395
400 Asp Asp Val Glu Thr Gly Val Arg Leu Thr Asn Gly Cys Val Tyr Ala
405 410 415 Tyr Arg Ala Phe
Pro Thr Gly Met Met Pro Glu Arg Leu Asp Leu Ala 420
425 430 Pro Cys Arg Asp Arg Ser Ser Arg Cys
Pro Trp Asp Glu Glu His Trp 435 440
445 Leu Glu Glu Arg Ala Lys Arg Pro Glu Trp Glu Pro His Leu
Pro Arg 450 455 460
Gly Phe Thr Ser Ala Lys Asp Pro Arg Tyr Leu Leu Arg Pro Glu Ala465
470 475 480 Ile Glu Ser Val Phe
Tyr Ser Tyr Arg Ile Thr Gly Arg Gln Glu Phe 485
490 495 Gln Thr Ala Ala Trp Asp Met Phe Thr Ala
Val Glu Lys Gly Thr Arg 500 505
510 Thr Gln Phe Ala Asn Ala Ala Val Leu Asp Val Thr Arg Ala Ala
Asp 515 520 525 Glu
Leu Pro Gln Glu Asp Tyr Met Glu Ser Phe Trp Leu Ala Glu Thr 530
535 540 Leu Lys Tyr Phe Tyr Leu
Met Phe Thr Thr Pro Asp Ile Ile Ser Leu545 550
555 560 Asp Asp Tyr Val Leu Asn Thr Glu Ala His Pro
Phe Lys Leu Val Gly 565 570
575 7817PRTTrichoderma reesei 78Met Val Met Leu Val Ala Ile Ala Leu
Ala Trp Leu Gly Cys Ser Leu 1 5 10
15 Leu791053PRTTrichoderma reesei 79Arg Pro Val Asp Ala Met
Arg Ala Asp Tyr Leu Ala Gln Leu Arg Gln 1 5
10 15 Glu Thr Val Asp Met Phe Tyr His Gly Tyr Ser
Asn Tyr Met Glu His 20 25 30
Ala Phe Pro Glu Asp Glu Leu Arg Pro Ile Ser Cys Thr Pro Leu Thr
35 40 45 Arg Asp Arg
Asp Asn Pro Gly Arg Ile Ser Leu Asn Asp Ala Leu Gly 50
55 60 Asn Tyr Ser Leu Thr Leu Ile Asp
Ser Leu Ser Thr Leu Ala Ile Leu65 70 75
80 Ala Gly Gly Pro Gln Asn Gly Pro Tyr Thr Gly Pro Gln
Ala Leu Ser 85 90 95
Asp Phe Gln Asp Gly Val Ala Glu Phe Val Arg His Tyr Gly Asp Gly
100 105 110 Arg Ser Gly Pro Ser
Gly Ala Gly Ile Arg Ala Arg Gly Phe Asp Leu 115
120 125 Asp Ser Lys Val Gln Val Phe Glu Thr
Val Ile Arg Gly Val Gly Gly 130 135
140 Leu Leu Ser Ala His Leu Phe Ala Ile Gly Glu Leu Pro
Ile Thr Gly145 150 155
160 Tyr Val Pro Arg Pro Glu Gly Val Ala Gly Asp Asp Pro Leu Glu Leu
165 170 175 Ala Pro Ile Pro
Trp Pro Asn Gly Phe Arg Tyr Asp Gly Gln Leu Leu 180
185 190 Arg Leu Ala Leu Asp Leu Ser Glu Arg
Leu Leu Pro Ala Phe Tyr Thr 195 200
205 Pro Thr Gly Ile Pro Tyr Pro Arg Val Asn Leu Arg Ser Gly
Ile Pro 210 215 220
Phe Tyr Val Asn Ser Pro Leu His Gln Asn Leu Gly Glu Ala Val Glu225
230 235 240 Glu Gln Ser Gly Arg
Pro Glu Ile Thr Glu Thr Cys Ser Ala Gly Ala 245
250 255 Gly Ser Leu Val Leu Glu Phe Thr Val Leu
Ser Arg Leu Thr Gly Asp 260 265
270 Ala Arg Phe Glu Gln Ala Ala Lys Arg Ala Phe Trp Glu Val Trp
His 275 280 285 Arg
Arg Ser Glu Ile Gly Leu Ile Gly Asn Gly Ile Asp Ala Glu Arg 290
295 300 Gly Leu Trp Ile Gly Pro
His Ala Gly Ile Gly Ala Gly Met Asp Ser305 310
315 320 Phe Phe Glu Tyr Ala Leu Lys Ser His Ile Leu
Leu Ser Gly Leu Gly 325 330
335 Met Pro Asn Ala Ser Thr Ser Arg Arg Gln Ser Thr Thr Ser Trp Leu
340 345 350 Asp Pro Asn
Ser Leu His Pro Pro Leu Pro Pro Glu Met His Thr Ser 355
360 365 Asp Ala Phe Leu Gln Ala Trp His
Gln Ala His Ala Ser Val Lys Arg 370 375
380 Tyr Leu Tyr Thr Asp Arg Ser His Phe Pro Tyr Tyr Ser
Asn Asn His385 390 395
400 Arg Ala Thr Gly Gln Pro Tyr Ala Met Trp Ile Asp Ser Leu Gly Ala
405 410 415 Phe Tyr Pro Gly
Leu Leu Ala Leu Ala Gly Glu Val Glu Glu Ala Ile 420
425 430 Glu Ala Asn Leu Val Tyr Thr Ala Leu
Trp Thr Arg Tyr Ser Ala Leu 435 440
445 Pro Glu Arg Trp Ser Val Arg Glu Gly Asn Val Glu Ala Gly
Ile Gly 450 455 460
Trp Trp Pro Gly Arg Pro Glu Phe Ile Glu Ser Thr Tyr His Ile Tyr465
470 475 480 Arg Ala Thr Arg Asp
Pro Trp Tyr Leu His Val Gly Glu Met Val Leu 485
490 495 Arg Asp Ile Arg Arg Arg Cys Tyr Ala Glu
Cys Gly Trp Ala Gly Leu 500 505
510 Gln Asp Val Gln Thr Gly Glu Lys Gln Asp Arg Met Glu Ser Phe
Phe 515 520 525 Leu
Gly Glu Thr Ala Lys Tyr Met Tyr Leu Leu Phe Asp Pro Asp His 530
535 540 Pro Leu Asn Lys Leu Asp
Ala Ala Tyr Val Phe Thr Thr Glu Gly His545 550
555 560 Pro Leu Ile Ile Pro Lys Ser Lys Arg Gly Ser
Gly Ser His Asn Arg 565 570
575 Gln Asp Arg Ala Arg Lys Ala Lys Lys Ser Arg Asp Val Ala Val Tyr
580 585 590 Thr Tyr Tyr
Asp Glu Ser Phe Thr Asn Ser Cys Pro Ala Pro Arg Pro 595
600 605 Pro Ser Glu His His Leu Ile Gly
Ser Ala Thr Ala Ala Arg Pro Asp 610 615
620 Leu Phe Ser Val Ser Arg Phe Thr Asp Leu Tyr Arg Thr
Pro Asn Val625 630 635
640 His Gly Pro Leu Glu Lys Val Glu Met Arg Asp Lys Lys Lys Gly Arg
645 650 655 Val Val Arg Tyr
Arg Ala Thr Ser Asn His Thr Ile Phe Pro Trp Thr 660
665 670 Leu Pro Pro Ala Met Leu Pro Glu Asn
Gly Thr Cys Ala Ala Pro Pro 675 680
685 Glu Arg Ile Ile Ser Leu Ile Glu Phe Pro Ala Asn Asp Ile
Thr Ser 690 695 700
Gly Ile Thr Ser Arg Phe Gly Asn His Leu Ser Trp Gln Thr His Leu705
710 715 720 Gly Pro Thr Val Asn
Ile Leu Glu Gly Leu Arg Leu Gln Leu Glu Gln 725
730 735 Val Ser Asp Pro Ala Thr Gly Glu Asp Lys
Trp Arg Ile Thr His Ile 740 745
750 Gly Asn Thr Gln Leu Gly Arg His Glu Thr Val Phe Phe His Ala
Glu 755 760 765 His
Val Arg His Leu Lys Asp Glu Val Phe Ser Cys Arg Arg Arg Arg 770
775 780 Asp Ala Val Glu Ile Glu
Leu Leu Val Asp Lys Pro Ser Asp Thr Asn785 790
795 800 Asn Asn Asn Thr Leu Ala Ser Ser Asp Asp Asp
Val Val Val Asp Ala 805 810
815 Lys Ala Glu Glu Gln Asp Gly Met Leu Ala Asp Asp Asp Gly Asp Thr
820 825 830 Leu Asn Ala
Glu Thr Leu Ser Ser Asn Ser Leu Phe Gln Ser Leu Leu 835
840 845 Arg Ala Val Ser Ser Val Phe Glu
Pro Val Tyr Thr Ala Ile Pro Glu 850 855
860 Ser Asp Pro Ser Ala Gly Thr Ala Lys Val Tyr Ser Phe
Asp Ala Tyr865 870 875
880 Thr Ser Thr Gly Pro Gly Ala Tyr Pro Met Pro Ser Ile Ser Asp Thr
885 890 895 Pro Ile Pro Gly
Asn Pro Phe Tyr Asn Phe Arg Asn Pro Ala Ser Asn 900
905 910 Phe Pro Trp Ser Thr Val Phe Leu Ala
Gly Gln Ala Cys Glu Gly Pro 915 920
925 Leu Pro Ala Ser Ala Pro Arg Glu His Gln Val Ile Val Met
Leu Arg 930 935 940
Gly Gly Cys Ser Phe Ser Arg Lys Leu Asp Asn Ile Pro Ser Phe Ser945
950 955 960 Pro His Asp Arg Ala
Leu Gln Leu Val Val Val Leu Asp Glu Pro Pro 965
970 975 Pro Pro Pro Pro Pro Pro Pro Ala Asn Asp
Arg Arg Asp Val Thr Arg 980 985
990 Pro Leu Leu Asp Thr Glu Gln Thr Thr Pro Lys Gly Met Lys Arg
Leu 995 1000 1005 His
Gly Ile Pro Met Val Leu Val Arg Ala Ala Arg Gly Asp Tyr Glu 1010
1015 1020 Leu Phe Gly His Ala Ile
Gly Val Gly Met Arg Arg Lys Tyr Arg Val1025 1030
1035 1040Glu Ser Gln Gly Leu Val Val Glu Asn Ala Val
Val Leu 1045 1050
8045PRTTrichoderma reesei 80Met Met Pro Arg His His Ser Ser Gly Phe Ser
Asn Gly Tyr Pro Arg 1 5 10
15 Ala Asp Thr Phe Glu Ile Ser Pro His Arg Phe Gln Pro Arg Ala Thr
20 25 30 Leu Pro Pro
His Arg Lys Arg Lys Arg Thr Ala Ile Arg 35 40
45 8116PRTTrichoderma reesei 81Val Gly Ile Ala Val Val Val
Ile Leu Val Leu Val Leu Trp Phe Gly 1 5 10
15 82407PRTTrichoderma reesei 82Gln Pro Arg Ser Val
Ala Ser Leu Ile Ser Leu Gly Ile Leu Ser Gly 1 5
10 15 Tyr Asp Asp Leu Lys Leu Glu Thr Val Arg
Tyr Tyr Asp Leu Ser Asn 20 25
30 Val Gln Gly Thr Ala Arg Gly Trp Glu Arg Glu Glu Arg Ile Leu
Leu 35 40 45 Cys
Val Pro Leu Arg Asp Ala Glu Gln His Leu Pro Met Phe Phe Ser 50
55 60 His Leu Lys Asn Phe Thr
Tyr Pro His Asn Leu Ile Asp Leu Ala Phe65 70
75 80 Leu Val Ser Asp Ser Lys Asp His Thr Leu Glu
Ser Leu Thr Glu His 85 90
95 Leu Glu Ala Ile Gln Ala Asp Pro Asp Pro Lys Gln Pro Tyr Gly Glu
100 105 110 Ile Ser Ile
Ile Glu Lys Asp Phe Gly Gln Lys Val Asn Gln Asp Val 115
120 125 Glu Ser Arg His Gly Phe Ala Ala
Gln Ala Ser Arg Arg Lys Leu Met 130 135
140 Ala Gln Ala Arg Asn Trp Leu Leu Ser Ala Ala Leu Arg
Pro Tyr His145 150 155
160 Ser Trp Val Tyr Trp Arg Asp Val Asp Val Glu Thr Ala Pro Phe Thr
165 170 175 Ile Leu Glu Asp
Leu Met Arg His Asn Lys Asp Val Ile Val Pro Asn 180
185 190 Val Trp Arg Pro Leu Pro Asp Trp Leu
Gly Gly Glu Gln Pro Tyr Asp 195 200
205 Leu Asn Ser Trp Gln Glu Ser Glu Thr Ala Leu Ala Leu Ala
Asp Thr 210 215 220
Leu Asp Glu Asp Ala Val Ile Val Glu Gly Tyr Ala Glu Tyr Ala Thr225
230 235 240 Trp Arg Pro His Leu
Ala Tyr Leu Arg Asp Pro Tyr Gly Asp Pro Asp 245
250 255 Met Glu Met Glu Ile Asp Gly Val Gly Gly
Val Ser Ile Leu Ala Lys 260 265
270 Ala Lys Val Phe Arg Ala Gly Val His Phe Pro Ala Phe Ser Phe
Glu 275 280 285 Lys
His Ala Glu Thr Glu Gly Phe Gly Lys Met Ala Lys Arg Met His 290
295 300 Phe Ser Val Val Gly Leu
Pro His Tyr Thr Ile Trp His Leu Tyr Glu305 310
315 320 Pro Ser Val Asp Asp Ile Lys His Met Glu Glu
Met Glu Arg Glu Arg 325 330
335 Ile Ala Arg Glu Lys Glu Glu Glu Glu Arg Lys Lys Lys Glu Ala Gln
340 345 350 Ile Lys Glu
Glu Phe Gly Asp Ala Asn Ser Gln Trp Glu Gln Asp Lys 355
360 365 Gln Gln Met Gln Asp Leu Lys Leu
Gln Asp Arg Gly Gly Asp Lys Glu 370 375
380 Ala Ala Ala Ala Gly Val Asn Gln Gly Ala Ala Ala Lys
Ala Ala Gly385 390 395
400 Ala Met Glu Gly Gln Lys Asn 405
8331PRTTrichoderma reesei 83Met Leu Leu Pro Lys Gly Gly Leu Asp Trp Arg
Ser Ala Arg Ala Gln 1 5 10
15 Ile Pro Pro Thr Arg Ala Leu Trp Asn Ala Val Thr Arg Thr Arg
20 25 30 8415PRTTrichoderma
reesei 84Phe Ile Leu Leu Val Gly Ile Thr Gly Leu Ile Leu Leu Leu Trp 1
5 10 15 85358PRTTrichoderma
reesei 85Arg Gly Val Ser Thr Ser Ala Ser Glu Met Gln Ser Phe Tyr Cys Trp
1 5 10 15 Gly Pro
Ala Lys Pro Pro Met Glu Met Ser Pro Asn Glu His Asn Arg 20
25 30 Trp Asn Gly His Leu Gln Thr
Pro Val Ile Phe Asn His His Ala Pro 35 40
45 Val Glu Val Asn Ser Ser Thr Ile Glu His Val Asp
Leu Asn Pro Ile 50 55 60
Asn Ser Thr Lys Gln Ala Val Thr Lys Glu Glu Arg Ile Leu Ile Leu65
70 75 80 Thr Pro Leu Lys
Asp Ala Ala Pro Tyr Leu Ser Lys Tyr Phe Glu Leu 85
90 95 Leu Ala Glu Leu Thr Tyr Pro His Arg
Leu Ile Asp Leu Ala Phe Leu 100 105
110 Val Ser Asp Ser Thr Asp Asp Thr Leu Ala Val Leu Ala Ser
Glu Leu 115 120 125
Asp Arg Ile Gln Lys Arg Pro Asp Gln Ile Pro Phe His Ser Ala Thr 130
135 140 Val Ile Glu Lys Asp
Phe Gly Phe Lys Leu Ser Gln Asn Val Glu Glu145 150
155 160 Arg His Ser Phe Glu Ala Gln Gly Pro Arg
Arg Lys Ala Met Gly Arg 165 170
175 Ala Arg Asn Tyr Leu Leu Tyr Thr Ala Leu Lys Pro Glu His Ser
Trp 180 185 190 Val
Tyr Trp Arg Asp Val Asp Ile Val Asp Ser Pro Thr Gly Ile Leu 195
200 205 Glu Asp Phe Ile Ala His
Asp Arg Asp Ile Leu Val Pro Asn Ile Trp 210 215
220 Phe His Arg Tyr Arg Asp Gly Val Asp Ile Glu
Gly Arg Phe Asp Tyr225 230 235
240 Asn Ser Trp Val Glu Ser Asp Lys Gly Arg Lys Leu Ala Asn Ser Leu
245 250 255 Asp Lys Asp
Val Val Leu Ala Glu Gly Tyr Lys Gln Tyr Asp Thr Gly 260
265 270 Arg Thr Tyr Met Ala Lys Met Gly
Asp Trp Arg Glu Asn Lys Asp Val 275 280
285 Glu Leu Glu Leu Asp Gly Ile Gly Gly Val Asn Ile Leu
Val Lys Ala 290 295 300
Asp Val His Arg Ser Gly Ile Asn Phe Pro Cys Tyr Ala Phe Glu Asn305
310 315 320 Gln Ala Glu Thr Glu
Gly Phe Ala Lys Met Ala Lys Arg Ala Gly Tyr 325
330 335 Glu Val Tyr Gly Leu Pro Asn Tyr Val Val
Trp His Ile Asp Thr Glu 340 345
350 Glu Lys Gly Gly Asn Ala 355
8617PRTTrichoderma reesei 86Met Ala Arg Pro Met Gly Ser Val Arg Leu Lys
Lys Ala Asn Pro Ser 1 5 10
15 Thr8716PRTTrichoderma reesei 87Leu Ile Leu Gly Ala Val Leu Cys
Ile Phe Ile Ile Ile Phe Leu Val 1 5 10
15 88339PRTTrichoderma reesei 88Ser Pro Ser Ser Pro Ala
Ser Ala Ser Arg Leu Ser Ile Val Ser Ala 1 5
10 15 Gln His His Leu Ser Pro Pro Thr Ser Pro Tyr
Gln Ser Pro Arg Ser 20 25 30
Gly Ala Val Gln Gly Pro Pro Pro Val Thr Arg Tyr Asn Leu Asn Lys
35 40 45 Val Thr Val
Thr Ser Asp Pro Val Arg Asn Gln Glu His Ile Leu Ile 50
55 60 Leu Thr Pro Met Ala Arg Phe Tyr
Gln Glu Tyr Trp Asp Asn Leu Leu65 70 75
80 Arg Leu Asn Tyr Pro His Glu Leu Ile Thr Leu Gly Phe
Ile Leu Pro 85 90 95
Lys Thr Lys Glu Gly Asn Gln Ala Thr Ser Met Leu Gln Lys Gln Ile
100 105 110 Gln Lys Thr Gln Asn
Tyr Gly Pro Glu Lys Asp Arg Phe Lys Ser Ile 115
120 125 Ile Ile Leu Arg Gln Asp Phe Asp Pro
Ala Val Val Ser Gln Asp Glu 130 135
140 Ser Glu Arg His Lys Leu Ala Asn Gln Lys Ala Arg Arg
Glu Val Met145 150 155
160 Ala Lys Ala Arg Asn Ser Leu Leu Phe Thr Thr Leu Gly Pro Ser Thr
165 170 175 Ser Trp Val Leu
Trp Leu Asp Ala Asp Ile Thr Glu Thr Ala Pro Thr 180
185 190 Leu Ile Gln Asp Leu Ala Ser His Asp
Lys Pro Ile Ile Val Ala Asn 195 200
205 Cys Phe Gln Lys Tyr Tyr Asp Pro Glu Ser Lys Lys Met Ala
Glu Arg 210 215 220
Pro Tyr Asp Phe Asn Ser Trp Gln Asp Ser Glu Thr Ala Leu Lys Met225
230 235 240 Ala Glu Gln Met Gly
Pro Asp Asp Ile Leu Leu Glu Gly Tyr Ala Glu 245
250 255 Met Ala Thr Tyr Arg Thr Leu Leu Ala Tyr
Met Ser Thr Pro Gly Gly 260 265
270 Ser Lys Asp Leu Val Val Pro Leu Asp Gly Val Gly Gly Thr Ala
Leu 275 280 285 Leu
Val Lys Ala Asp Val His Arg Asp Gly Ala Met Phe Pro Pro Phe 290
295 300 Ala Phe Tyr His Leu Ile
Glu Ser Glu Gly Phe Ala Lys Met Ala Lys305 310
315 320 Arg Leu Gly Trp Gln Pro Tyr Gly Leu Pro Asn
Tyr Lys Val Tyr His 325 330
335 Tyr Asn Glu8933PRTTrichoderma reesei 89Met His Phe Ala Tyr Pro
Ser Arg Lys Ser Ser Asn Pro Pro Pro Phe 1 5
10 15 Arg Pro Arg Ser Thr Arg Leu Pro Gly Leu Arg
Arg Ser Arg Ile Lys 20 25 30
Thr9015PRTTrichoderma reesei 90Ile Gly Ile Val Leu Phe Leu Val
Leu Ala Thr Leu Trp Phe Phe 1 5 10
15 91262PRTTrichoderma reesei 91Ser Asn Pro Arg Val Pro Arg Pro
Asp Pro Glu Arg Val Pro Ser Gly 1 5 10
15 Arg Pro Pro Val Val Leu Val Thr Val Ile Asp Pro Thr
Gln Tyr Pro 20 25 30
Asn Ala Tyr Leu Lys Thr Ile Lys Glu Asn Arg Glu Gln Tyr Ala Ala
35 40 45 Lys His Gly Tyr
Glu Ala Phe Ile Val Lys Ala Tyr Asp Tyr Asp Thr 50 55
60 Gln Gly Ala Pro Gln Ser Trp Ser Lys
Leu Met Ala Met Arg His Ala65 70 75
80 Leu Thr Lys Phe Pro Glu Cys Arg Phe Val Trp Tyr Leu Asp
Gln Asp 85 90 95
Ala Tyr Ile Met Asp Met Ser Lys Ser Leu Glu Glu Gln Leu Leu Asn
100 105 110 Arg Gln Lys Leu Glu
Ser Leu Met Ile Lys Asn Tyr Pro Val Val Pro 115
120 125 Pro Asp Ser Ile Ile Lys Thr Phe Ser
His Leu Arg Pro Asp Glu Val 130 135
140 Asp Leu Ile Val Ser Gln Asp Ser Ser Gly Leu Val Ala
Gly Ser Val145 150 155
160 Val Val Arg Asn Ser Gln Trp Ser Lys Phe Leu Leu Glu Thr Trp Met
165 170 175 Asp Pro Leu Tyr
Arg Ser Tyr Asn Phe Gln Lys Ala Glu Arg His Ala 180
185 190 Leu Glu His Ile Val Gln Trp His Pro
Thr Ile Leu Ser Lys Leu Ala 195 200
205 Leu Val Pro Gln Arg Thr Leu Gly Pro Tyr Thr Arg Thr Asp
Gln Gly 210 215 220
Asp Ala Tyr Gln Asp Gly Asp Phe Val Val Met Phe Thr Gly Cys Thr225
230 235 240 Lys Ser Gly Glu Gln
Ser Cys Glu Thr Val Ser Ala Ser Tyr Tyr Gln 245
250 255 Lys Trp Ser Ser Ser Leu 260
92119PRTTrichoderma reesei 92Met Ser Leu Ser Arg Ser Pro Ser Pro
Val Pro Gly Gly Gly Trp Ser 1 5 10
15 Ser Pro Gly Leu Asn Ile Asn Ser Gly Arg Ser Ser Pro Ser
Asn Ala 20 25 30
Ala Gly Ser Ser Val Ser Trp Glu Ser Ala Lys Met Arg Lys Gln Gly 35
40 45 Ala Asn Gly Tyr Pro
Ser Phe Ser Thr Gln Asn Gln Gly Phe Phe Thr 50 55
60 Arg His Met Arg Arg Ile Ser Ser Ser Leu
Pro Arg Phe Ala Ala Gly65 70 75
80 Pro Gly Asn Thr Tyr Ala Glu Arg Glu Lys Tyr Glu Arg Gly Gly
His 85 90 95 Ser
Pro His Ala Gly Gly Gly Arg Leu Arg Ala Phe Leu Ala Arg Ile
100 105 110 Gly Arg Arg Leu Lys
Trp Arg 115 9316PRTTrichoderma reesei 93Ile Leu
Leu Pro Leu Ile Ile Ile Cys Thr Ile Val Ala Tyr Tyr Gly 1 5
10 15 94324PRTTrichoderma reesei
94Thr His Glu Ala Pro Gly Phe Val His Trp Trp Arg Arg Ile Ser Met 1
5 10 15 Gly Gly Gly Gly
Glu Lys Phe Val Ile Ile Leu Gly Ala Asn Val Gly 20
25 30 Gly Gly Val Met Glu Trp Lys Gly Ala
Arg Glu Trp Ala Ile Glu Arg 35 40
45 Asp Ser Val Arg Asn Lys Arg Lys Tyr Ala Thr Arg Trp Gly
Tyr Asp 50 55 60
Leu Glu Ile Val Asp Met Lys Thr Lys Lys Arg Tyr Ala His Glu Trp65
70 75 80 Arg Glu Ser Trp Glu
Lys Val Asp Phe Ile Arg Ala Ala Met Arg Lys 85
90 95 Tyr Pro Lys Ala Glu Trp Phe Trp Trp Leu
Asp Leu Asn Thr Tyr Val 100 105
110 Met Glu Pro Ser Tyr Ser Leu Gln Arg His Leu Phe Asn His Leu
Asp 115 120 125 Arg
His Val Tyr Arg Asp Ile Asn Val Phe Asn Pro Leu Asn Ile Thr 130
135 140 His Pro Pro Thr Glu Glu
Tyr Leu Asp Ala Glu Ala Arg Ser Pro Val145 150
155 160 Gly Asp Gly Asn Ile Asn Ser Val Asn Leu Met
Leu Thr Gln Asp Cys 165 170
175 Ser Gly Phe Asn Leu Gly Ser Phe Phe Ile Arg Arg Ser Ala Trp Thr
180 185 190 Glu Gln Leu
Leu Asp Ile Trp Trp Asp Pro Val Leu Tyr Glu Gln Lys 195
200 205 His Met Glu Trp Glu His Lys Glu
Gln Asp Ala Leu Glu Gln Leu Tyr 210 215
220 Arg Thr Gln Pro Trp Ile Arg Gln His Thr Gly Phe Leu
Pro Gln Arg225 230 235
240 Leu Ile Asn Ser Phe Pro Pro Ala Ala Cys Ala Asp Glu Ser Gly Leu
245 250 255 Asn Asn Thr Arg
Ile His Tyr Asn Glu Lys Asp Arg Asp Phe Val Val 260
265 270 Asn Met Ala Gly Cys Glu Trp Gly Arg
Asp Cys Trp Gly Glu Met Tyr 275 280
285 His Tyr Arg Glu Phe Ser Tyr Trp Leu Asn Arg Asn Pro Trp
Glu Leu 290 295 300
Phe Lys Glu Glu Ile Val Ala Val Ile Trp Tyr Lys Leu Thr Gly Gln305
310 315 320 Arg Val Lys
Leu95863PRTHomo sapiens 95Met Arg Phe Arg Ile Tyr Lys Arg Lys Val Leu Ile
Leu Thr Leu Val 1 5 10 15
Val Ala Ala Cys Gly Phe Val Leu Trp Ser Ser Asn Gly Arg Gln Arg
20 25 30 Lys Asn Glu Ala
Leu Ala Pro Pro Leu Leu Asp Ala Glu Pro Ala Arg 35
40 45 Gly Ala Gly Gly Arg Gly Gly Asp His
Pro Ser Val Ala Val Gly Ile 50 55 60
Arg Arg Val Ser Asn Val Ser Ala Ala Ser Leu Val Pro Ala
Val Pro65 70 75 80
Gln Pro Glu Ala Asp Asn Leu Thr Leu Arg Tyr Arg Ser Leu Val Tyr
85 90 95 Gln Leu Asn Phe Asp
Gln Thr Leu Arg Asn Val Asp Lys Ala Gly Thr 100
105 110 Trp Ala Pro Arg Glu Leu Val Leu Val Val
Gln Val His Asn Arg Pro 115 120
125 Glu Tyr Leu Arg Leu Leu Leu Asp Ser Leu Arg Lys Ala Gln
Gly Ile 130 135 140
Asp Asn Val Leu Val Ile Phe Ser His Asp Phe Trp Ser Thr Glu Ile145
150 155 160 Asn Gln Leu Ile Ala
Gly Val Asn Phe Cys Pro Val Leu Gln Val Phe 165
170 175 Phe Pro Phe Ser Ile Gln Leu Tyr Pro Asn
Glu Phe Pro Gly Ser Asp 180 185
190 Pro Arg Asp Cys Pro Arg Asp Leu Pro Lys Asn Ala Ala Leu Lys
Leu 195 200 205 Gly
Cys Ile Asn Ala Glu Tyr Pro Asp Ser Phe Gly His Tyr Arg Glu 210
215 220 Ala Lys Phe Ser Gln Thr
Lys His His Trp Trp Trp Lys Leu His Phe225 230
235 240 Val Trp Glu Arg Val Lys Ile Leu Arg Asp Tyr
Ala Gly Leu Ile Leu 245 250
255 Phe Leu Glu Glu Asp His Tyr Leu Ala Pro Asp Phe Tyr His Val Phe
260 265 270 Lys Lys Met
Trp Lys Leu Lys Gln Gln Glu Cys Pro Glu Cys Asp Val 275
280 285 Leu Ser Leu Gly Thr Tyr Ser Ala
Ser Arg Ser Phe Tyr Gly Met Ala 290 295
300 Asp Lys Val Asp Val Lys Thr Trp Lys Ser Thr Glu His
Asn Met Gly305 310 315
320 Leu Ala Leu Thr Arg Asn Ala Tyr Gln Lys Leu Ile Glu Cys Thr Asp
325 330 335 Thr Phe Cys Thr
Tyr Asp Asp Tyr Asn Trp Asp Trp Thr Leu Gln Tyr 340
345 350 Leu Thr Val Ser Cys Leu Pro Lys Phe
Trp Lys Val Leu Val Pro Gln 355 360
365 Ile Pro Arg Ile Phe His Ala Gly Asp Cys Gly Met His His
Lys Lys 370 375 380
Thr Cys Arg Pro Ser Thr Gln Ser Ala Gln Ile Glu Ser Leu Leu Asn385
390 395 400 Asn Asn Lys Gln Tyr
Met Phe Pro Glu Thr Leu Thr Ile Ser Glu Lys 405
410 415 Phe Thr Val Val Ala Ile Ser Pro Pro Arg
Lys Asn Gly Gly Trp Gly 420 425
430 Asp Ile Arg Asp His Glu Leu Cys Lys Ser Tyr Arg Arg Leu Gln
Thr 435 440 445 Arg
Pro Ala Pro Gly Arg Pro Pro Ser Val Ser Ala Leu Asp Gly Asp 450
455 460 Pro Ala Ser Leu Thr Arg
Glu Val Ile Arg Leu Ala Gln Asp Ala Glu465 470
475 480 Val Glu Leu Glu Arg Gln Arg Gly Leu Leu Gln
Gln Ile Gly Asp Ala 485 490
495 Leu Ser Ser Gln Arg Gly Arg Val Pro Thr Ala Ala Pro Pro Ala Gln
500 505 510 Pro Arg Val
Pro Val Thr Pro Ala Pro Ala Val Ile Pro Ile Leu Val 515
520 525 Ile Ala Cys Asp Arg Ser Thr Val
Arg Arg Cys Leu Asp Lys Leu Leu 530 535
540 His Tyr Arg Pro Ser Ala Glu Leu Phe Pro Ile Ile Val
Ser Gln Asp545 550 555
560 Cys Gly His Glu Glu Thr Ala Gln Ala Ile Ala Ser Tyr Gly Ser Ala
565 570 575 Val Thr His Ile
Arg Gln Pro Asp Leu Ser Ser Ile Ala Val Pro Pro 580
585 590 Asp His Arg Lys Phe Gln Gly Tyr Tyr
Lys Ile Ala Arg His Tyr Arg 595 600
605 Trp Ala Leu Gly Gln Val Phe Arg Gln Phe Arg Phe Pro Ala
Ala Val 610 615 620
Val Val Glu Asp Asp Leu Glu Val Ala Pro Asp Phe Phe Glu Tyr Phe625
630 635 640 Arg Ala Thr Tyr Pro
Leu Leu Lys Ala Asp Pro Ser Leu Trp Cys Val 645
650 655 Ser Ala Trp Asn Asp Asn Gly Lys Glu Gln
Met Val Asp Ala Ser Arg 660 665
670 Pro Glu Leu Leu Tyr Arg Thr Asp Phe Phe Pro Gly Leu Gly Trp
Leu 675 680 685 Leu
Leu Ala Glu Leu Trp Ala Glu Leu Glu Pro Lys Trp Pro Lys Ala 690
695 700 Phe Trp Asp Asp Trp Met
Arg Arg Pro Glu Gln Arg Gln Gly Arg Ala705 710
715 720 Cys Ile Arg Pro Glu Ile Ser Arg Thr Met Thr
Phe Gly Arg Lys Gly 725 730
735 Val Ser His Gly Gln Phe Phe Asp Gln His Leu Lys Phe Ile Lys Leu
740 745 750 Asn Gln Gln
Phe Val His Phe Thr Gln Leu Asp Leu Ser Tyr Leu Gln 755
760 765 Arg Glu Ala Tyr Asp Arg Asp Phe
Leu Ala Arg Val Tyr Gly Ala Pro 770 775
780 Gln Leu Gln Val Glu Lys Val Arg Thr Asn Asp Arg Lys
Glu Leu Gly785 790 795
800 Glu Val Arg Val Gln Tyr Thr Gly Arg Asp Ser Phe Lys Ala Phe Ala
805 810 815 Lys Ala Leu Gly
Val Met Asp Asp Leu Lys Ser Gly Val Pro Arg Ala 820
825 830 Gly Tyr Arg Gly Ile Val Thr Phe Gln
Phe Arg Gly Arg Arg Val His 835 840
845 Leu Ala Pro Pro Pro Thr Trp Glu Gly Tyr Asp Pro Ser Trp
Asn 850 855 860
962592DNAHomo sapiens 96atgcgcttcc gaatctacaa gcggaaggtc ctcattctga
cccttgtcgt ggccgcttgc 60ggctttgttc tctggtccag caacggtcgc cagcgtaaga
acgaggccct ggcgcctccc 120ctcttggacg ccgaaccggc cagaggcgca ggtggcaggg
gaggggatca cccctcggtc 180gctgtcggca tccgccgcgt cagcaatgtg tccgccgcct
ctctggtccc ggcggttccg 240cagcctgagg cagacaacct cacgctgcgc taccgatcac
tcgtgtatca acttaacttc 300gaccagactc tgcggaacgt cgacaaggcc ggaacctggg
ctccgcgtga gttggtcctc 360gtcgttcagg tgcacaacag gcccgagtac ctccgcctcc
tgctggattc gcttcgaaag 420gcccagggca tcgacaacgt cctggtgatt ttcagccatg
acttttggtc cacagagatc 480aatcagctca ttgcgggtgt caacttttgc cccgtcttgc
aagttttctt ccctttctct 540atccaactct accccaacga gttcccgggc agtgaccccc
gcgactgtcc tcgggatctg 600ccaaaaaacg ccgctctcaa gctgggctgc atcaacgccg
aataccccga cagctttggc 660cactatcgcg aggccaagtt ctcgcagacg aagcaccact
ggtggtggaa gctccatttt 720gtctgggagc gagtgaagat ccttcgtgat tacgcaggac
tcattctgtt cttggaagag 780gaccactacc tggccccgga cttctaccac gtctttaaga
agatgtggaa gctcaagcag 840caggaatgcc ccgagtgcga cgttctgtcc cttggcacct
atagcgcgtc ccgctcgttc 900tacggtatgg ctgacaaggt cgatgtgaaa acctggaagt
caactgagca caatatgggc 960ctcgccctga cgaggaacgc ctaccagaaa ctcatcgagt
gtaccgacac cttctgcacg 1020tacgacgact ataactggga ttggacactg cagtacttga
ctgtcagctg cctccctaag 1080ttttggaagg tccttgttcc ccagatcccg agaattttcc
atgctggcga ctgcgggatg 1140caccacaaga aaacctgtcg cccatccacg cagtctgccc
aaatcgagtc gctcctgaac 1200aacaacaagc agtacatgtt ccccgagaca ctgaccatta
gcgagaagtt tacggtcgtg 1260gcgatctccc cgcctcgaaa gaatggcggc tggggtgaca
tccgcgatca cgagctgtgc 1320aagtcttacc gccggctcca gacgcgccca gcacctggca
ggccaccctc agtcagcgct 1380ctcgatggcg accccgccag cctcacccgg gaagtgattc
gcctggccca agacgccgag 1440gtggagctgg agcggcagcg tgggctgctg cagcagatcg
gggatgccct gtcgagccag 1500cgggggaggg tgcccaccgc cgcccctccc gcccagccgc
gtgtgcctgt gacccccgcg 1560ccggcggtga ttcccatcct ggtcatcgcc tgtgaccgca
gcactgttcg gcgctgcctg 1620gacaagctgc tgcattatcg gccctcggct gagctcttcc
ccatcatcgt cagccaggac 1680tgcgggcacg aggagacggc ccaggccatc gcctcctacg
gcagcgcggt cacgcacatc 1740cggcagcccg acctgagcag cattgcggtg ccgccggacc
accgcaagtt ccagggctac 1800tacaagatcg cgcgccacta ccgctgggcg ctgggccagg
tcttccggca gtttcgcttc 1860cccgccgccg tggtggtgga ggatgacctg gaggtggccc
cggacttctt cgagtacttt 1920cgggccacct atccgctgct gaaggccgac ccctccctgt
ggtgcgtctc ggcctggaat 1980gacaacggca aggagcagat ggtggacgcc agcaggcctg
agctgctcta ccgcaccgac 2040tttttccctg gcctgggctg gctgctgttg gccgagctct
gggctgagct ggagcccaag 2100tggccaaagg ccttctggga cgactggatg cggcggccgg
agcagcggca ggggcgggcc 2160tgcatccgcc ctgagatctc aagaacgatg acctttggcc
gcaagggtgt gagccacggg 2220cagttctttg accagcacct caagttcatc aagctgaacc
agcagtttgt gcacttcacc 2280cagctggacc tgtcttacct gcagcgggag gcctatgacc
gagatttcct cgcccgcgtc 2340tacggtgctc cccagctgca ggtggagaaa gtgaggacca
atgaccggaa ggagctgggg 2400gaggtgcggg tgcagtacac gggcagggac agcttcaagg
ctttcgccaa ggctctgggt 2460gtcatggatg acctcaagtc gggggttccg agagctggct
accggggcat tgtcaccttc 2520cagttccggg gccgccgtgt ccacctggcg cccccaccga
cgtgggaggg ctatgatccc 2580agctggaatt ag
2592971263DNATrichoderma reesei 97atggcgtcac
tcatcaaaac tgccgtggac attgccaacg gccgccatgc gctgtccaga 60tatgtcatct
ttgggctctg gcttgcggat gcggtgctgt gcgggctgat tatctggaaa 120gtgccttata
cggaaatcga ctgggtcgcc tacatggagc aagtcaccca gttcgtccac 180ggagagcgag
actaccccaa gatggagggc ggcacagggc ccctggtgta tcccgcggcc 240catgtgtaca
tctacacagg gctctactac ctgacgaaca agggcaccga catcctgctg 300gcgcagcagc
tctttgccgt gctctacatg gctactctgg cggtcgtcat gacatgctac 360tccaaggcca
aggtcccgcc gtacatcttc ccgcttctca tcctctccaa aagacttcac 420agcgtcttcg
tcctgagatg cttcaacgac tgcttcgccg ccttcttcct ctggctctgc 480atcttcttct
tccagaggcg agagtggacc atcggagctc tcgcatacag catcggcctg 540ggcgtcaaaa
tgtcgctgct actggttctc cccgccgtgg tcatcgtcct ctacctcggc 600cgcggcttca
agggcgccct gcggctgctc tggctcatgg tgcaggtcca gctcctcctc 660gccataccct
tcatcacgac aaattggcgc ggctacctcg gccgtgcatt cgagctctcg 720aggcagttca
agtttgaatg gacagtcaat tggcgcatgc tgggcgagga tctgttcctc 780agccggggct
tctctatcac gctactggca tttcacgcca tcttcctcct cgcctttatc 840ctcggccggt
ggctgaagat tagggaacgg accgtactcg ggatgatccc ctatgtcatc 900cgattcagat
cgccctttac cgagcaggaa gagcgcgcca tctccaaccg cgtcgtcacg 960cccggctatg
tcatgtccac catcttgtcg gccaacgtgg tgggactgct gtttgcccgg 1020tctctgcact
accagttcta tgcatatctg gcgtgggcga ccccctatct cctgtggacg 1080gcctgcccca
atcttttggt ggtggccccc ctctgggcgg cgcaagaatg ggcctggaac 1140gtcttcccca
gcacgcctct tagctcgagc gtcgtggtga gcgtgctggc cgtgacggtg 1200gccatggcgt
ttgcaggttc aaatccgcag ccacgtgaaa catcgaagcc gaagcagcac 1260taa
126398420PRTTrichoderma reesei 98Met Ala Ser Leu Ile Lys Thr Ala Val Asp
Ile Ala Asn Gly Arg His 1 5 10
15 Ala Leu Ser Arg Tyr Val Ile Phe Gly Leu Trp Leu Ala Asp Ala
Val 20 25 30 Leu
Cys Gly Leu Ile Ile Trp Lys Val Pro Tyr Thr Glu Ile Asp Trp 35
40 45 Val Ala Tyr Met Glu Gln
Val Thr Gln Phe Val His Gly Glu Arg Asp 50 55
60 Tyr Pro Lys Met Glu Gly Gly Thr Gly Pro Leu
Val Tyr Pro Ala Ala65 70 75
80 His Val Tyr Ile Tyr Thr Gly Leu Tyr Tyr Leu Thr Asn Lys Gly Thr
85 90 95 Asp Ile Leu
Leu Ala Gln Gln Leu Phe Ala Val Leu Tyr Met Ala Thr 100
105 110 Leu Ala Val Val Met Thr Cys Tyr
Ser Lys Ala Lys Val Pro Pro Tyr 115 120
125 Ile Phe Pro Leu Leu Ile Leu Ser Lys Arg Leu His Ser
Val Phe Val 130 135 140
Leu Arg Cys Phe Asn Asp Cys Phe Ala Ala Phe Phe Leu Trp Leu Cys145
150 155 160 Ile Phe Phe Phe Gln
Arg Arg Glu Trp Thr Ile Gly Ala Leu Ala Tyr 165
170 175 Ser Ile Gly Leu Gly Val Lys Met Ser Leu
Leu Leu Val Leu Pro Ala 180 185
190 Val Val Ile Val Leu Tyr Leu Gly Arg Gly Phe Lys Gly Ala Leu
Arg 195 200 205 Leu
Leu Trp Leu Met Val Gln Val Gln Leu Leu Leu Ala Ile Pro Phe 210
215 220 Ile Thr Thr Asn Trp Arg
Gly Tyr Leu Gly Arg Ala Phe Glu Leu Ser225 230
235 240 Arg Gln Phe Lys Phe Glu Trp Thr Val Asn Trp
Arg Met Leu Gly Glu 245 250
255 Asp Leu Phe Leu Ser Arg Gly Phe Ser Ile Thr Leu Leu Ala Phe His
260 265 270 Ala Ile Phe
Leu Leu Ala Phe Ile Leu Gly Arg Trp Leu Lys Ile Arg 275
280 285 Glu Arg Thr Val Leu Gly Met Ile
Pro Tyr Val Ile Arg Phe Arg Ser 290 295
300 Pro Phe Thr Glu Gln Glu Glu Arg Ala Ile Ser Asn Arg
Val Val Thr305 310 315
320 Pro Gly Tyr Val Met Ser Thr Ile Leu Ser Ala Asn Val Val Gly Leu
325 330 335 Leu Phe Ala Arg
Ser Leu His Tyr Gln Phe Tyr Ala Tyr Leu Ala Trp 340
345 350 Ala Thr Pro Tyr Leu Leu Trp Thr Ala
Cys Pro Asn Leu Leu Val Val 355 360
365 Ala Pro Leu Trp Ala Ala Gln Glu Trp Ala Trp Asn Val Phe
Pro Ser 370 375 380
Thr Pro Leu Ser Ser Ser Val Val Val Ser Val Leu Ala Val Thr Val385
390 395 400 Ala Met Ala Phe Ala
Gly Ser Asn Pro Gln Pro Arg Glu Thr Ser Lys 405
410 415 Pro Lys Gln His 420
9921DNAArtificial SequenceSynthesized Construct 99gcaaatggca ttctgacatc c
2110021DNAArtificial
SequenceSynthesized Construct 100gactggttcc aattgacaag c
2110142DNAArtificial SequenceSynthesized
Construct 101cagtggtacc ctaattccag ctaggatcat agccctccca cg
4210218DNAArtificial SequenceSynthesized Construct 102cggaccaccg
caagttcc
1810354DNAArtificial SequenceSynthesized Construct 103atgcggaatt
ctgcatcatc atcatcatca tcgccagcgt aagaacgagg ccct
5410422DNAArtificial SequenceSynthesized Construct 104cctttctcta
tccaactcta cc
2210518DNAArtificial SequenceSynthesized Construct 105ggaacttgcg gtggtccg
1810666DNAArtificial
SequenceSynthesized Construct 106ccgccggctc cagggaggtg ggggcagtgg
aggtggcggc agtgggaggg tgcccaccgc 60cgcccc
6610766DNAArtificial
SequenceSynthesized Construct 107gcggtgggca ccctcccact gccgccacct
ccactgcccc cacctccctg gagccggcgg 60taagac
6610865DNAArtificial
SequenceSynthesized Construct 108aggtgggggc agtggaggtg gcggcagtgg
cggcggtgga agtgggaggg tgcccaccgc 60cgccc
6510964DNAArtificial
SequenceSynthesized Construct 109cggtgggcac cctcccactt ccaccgccgc
cactgccgcc acctccactg cccccacctc 60cctg
6411065DNAArtificial
SequenceSynthesized Construct 110gtttccgccg ggagggttgc cgccgctagg
gttgccggtg ctctggagcc ggcggtaaga 60cttgc
6511166DNAArtificial
SequenceSynthesized Construct 111gcaaccctcc cggcggaaac ccgcctggca
gcaccgggag ggtgcccacc gccgcccctc 60ccgccc
6611270DNAArtificial
SequenceSynthesized Construct 112ccgcctccag gaacagtggc gctggcggtg
gccgtcgcgg cggagctctg gagccggcgg 60taagacttgc
7011371DNAArtificial
SequenceSynthesized Construct 113cgccactgtt cctggaggcg gtagcggccc
caccagcggg agggtgccca ccgccgcccc 60tcccgcccag c
7111420DNAArtificial
SequenceSynthesized Construct 114cattagcgag aagtttacgg
20115106PRTTrichoderma reesei 115Met Ala Ser
Thr Asn Ala Arg Tyr Val Arg Tyr Leu Leu Ile Ala Phe 1 5
10 15 Phe Thr Ile Leu Val Phe Tyr Phe
Val Ser Asn Ser Lys Tyr Glu Gly 20 25
30 Val Asp Leu Asn Lys Gly Thr Phe Thr Ala Pro Asp Ser
Thr Lys Thr 35 40 45
Thr Pro Lys Pro Pro Ala Thr Gly Asp Ala Lys Asp Phe Pro Leu Ala 50
55 60 Leu Thr Pro Asn Asp
Pro Gly Phe Asn Asp Leu Val Gly Ile Ala Pro65 70
75 80 Gly Pro Arg Met Asn Ala Thr Phe Val Thr
Leu Ala Arg Asn Ser Asp 85 90
95 Val Trp Asp Ile Ala Arg Ser Ile Arg Gln 100
105 11683PRTTrichoderma reesei 116Met Ala Ser Thr Asn Ala
Arg Tyr Val Arg Tyr Leu Leu Ile Ala Phe 1 5
10 15 Phe Thr Ile Leu Val Phe Tyr Phe Val Ser Asn
Ser Lys Tyr Glu Gly 20 25 30
Val Asp Leu Asn Lys Gly Thr Phe Thr Ala Pro Asp Ser Thr Lys Thr
35 40 45 Thr Pro Lys
Pro Pro Ala Thr Gly Asp Ala Lys Asp Phe Pro Leu Ala 50
55 60 Leu Thr Pro Asn Asp Pro Gly Phe
Asn Asp Leu Val Gly Ile Ala Pro65 70 75
80 Gly Pro Arg1178PRTArtificial SequenceSynthesized
Construct 117Asp Tyr Lys Asp Asp Asp Asp Lys1 5
11815PRTArtificial SequenceSynthesized Construct 118Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser 1 5
10 15 119824PRTArtificial SequenceSynthesized
Construct 119Met Arg Phe Arg Ile Tyr Lys Arg Lys Val Leu Ile Leu Thr Leu
Val 1 5 10 15 Val
Ala Ala Cys Gly Phe Val Leu Trp Ser Ser Asn Gly Arg Gln Arg 20
25 30 Lys Asn Glu Ala Leu Ala
Pro Pro Leu Leu Asp Ala Glu Pro Ala Arg 35 40
45 Gly Ala Gly Gly Arg Gly Gly Asp His Pro Ser
Val Ala Val Gly Ile 50 55 60
Arg Arg Val Ser Asn Val Ser Ala Ala Ser Leu Val Pro Ala Val
Pro65 70 75 80 Gln
Pro Glu Ala Asp Asn Leu Thr Leu Arg Tyr Arg Ser Leu Val Tyr
85 90 95 Gln Leu Asn Phe Asp Gln
Thr Leu Arg Asn Val Asp Lys Ala Gly Thr 100
105 110 Trp Ala Pro Arg Glu Leu Val Leu Val Val
Gln Val His Asn Arg Pro 115 120
125 Glu Tyr Leu Arg Leu Leu Leu Asp Ser Leu Arg Lys Ala Gln
Gly Ile 130 135 140
Asp Asn Val Leu Val Ile Phe Ser His Asp Phe Trp Ser Thr Glu Ile145
150 155 160 Asn Gln Leu Ile Ala
Gly Val Asn Phe Cys Pro Val Leu Gln Val Phe 165
170 175 Phe Pro Phe Ser Ile Gln Leu Tyr Pro Asn
Glu Phe Pro Gly Ser Asp 180 185
190 Pro Arg Asp Cys Pro Arg Asp Leu Pro Lys Asn Ala Ala Leu Lys
Leu 195 200 205 Gly
Cys Ile Asn Ala Glu Tyr Pro Asp Ser Phe Gly His Tyr Arg Glu 210
215 220 Ala Lys Phe Ser Gln Thr
Lys His His Trp Trp Trp Lys Leu His Phe225 230
235 240 Val Trp Glu Arg Val Lys Ile Leu Arg Asp Tyr
Ala Gly Leu Ile Leu 245 250
255 Phe Leu Glu Glu Asp His Tyr Leu Ala Pro Asp Phe Tyr His Val Phe
260 265 270 Lys Lys Met
Trp Lys Leu Lys Gln Gln Glu Cys Pro Glu Cys Asp Val 275
280 285 Leu Ser Leu Gly Thr Tyr Ser Ala
Ser Arg Ser Phe Tyr Gly Met Ala 290 295
300 Asp Lys Val Asp Val Lys Thr Trp Lys Ser Thr Glu His
Asn Met Gly305 310 315
320 Leu Ala Leu Thr Arg Asn Ala Tyr Gln Lys Leu Ile Glu Cys Thr Asp
325 330 335 Thr Phe Cys Thr
Tyr Asp Asp Tyr Asn Trp Asp Trp Thr Leu Gln Tyr 340
345 350 Leu Thr Val Ser Cys Leu Pro Lys Phe
Trp Lys Val Leu Val Pro Gln 355 360
365 Ile Pro Arg Ile Phe His Ala Gly Asp Cys Gly Met His His
Lys Lys 370 375 380
Thr Cys Arg Pro Ser Thr Gln Ser Ala Gln Ile Glu Ser Leu Leu Asn385
390 395 400 Asn Asn Lys Gln Tyr
Met Phe Pro Glu Thr Leu Thr Ile Ser Glu Lys 405
410 415 Phe Thr Val Val Ala Ile Ser Pro Pro Arg
Lys Asn Gly Gly Trp Gly 420 425
430 Asp Ile Arg Asp His Glu Leu Cys Lys Ser Tyr Arg Arg Leu Gln
Gly 435 440 445 Gly
Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Arg 450
455 460 Val Pro Thr Ala Ala Pro
Pro Ala Gln Pro Arg Val Pro Val Thr Pro465 470
475 480 Ala Pro Ala Val Ile Pro Ile Leu Val Ile Ala
Cys Asp Arg Ser Thr 485 490
495 Val Arg Arg Cys Leu Asp Lys Leu Leu His Tyr Arg Pro Ser Ala Glu
500 505 510 Leu Phe Pro
Ile Ile Val Ser Gln Asp Cys Gly His Glu Glu Thr Ala 515
520 525 Gln Ala Ile Ala Ser Tyr Gly Ser
Ala Val Thr His Ile Arg Gln Pro 530 535
540 Asp Leu Ser Ser Ile Ala Val Pro Pro Asp His Arg Lys
Phe Gln Gly545 550 555
560 Tyr Tyr Lys Ile Ala Arg His Tyr Arg Trp Ala Leu Gly Gln Val Phe
565 570 575 Arg Gln Phe Arg
Phe Pro Ala Ala Val Val Val Glu Asp Asp Leu Glu 580
585 590 Val Ala Pro Asp Phe Phe Glu Tyr Phe
Arg Ala Thr Tyr Pro Leu Leu 595 600
605 Lys Ala Asp Pro Ser Leu Trp Cys Val Ser Ala Trp Asn Asp
Asn Gly 610 615 620
Lys Glu Gln Met Val Asp Ala Ser Arg Pro Glu Leu Leu Tyr Arg Thr625
630 635 640 Asp Phe Phe Pro Gly
Leu Gly Trp Leu Leu Leu Ala Glu Leu Trp Ala 645
650 655 Glu Leu Glu Pro Lys Trp Pro Lys Ala Phe
Trp Asp Asp Trp Met Arg 660 665
670 Arg Pro Glu Gln Arg Gln Gly Arg Ala Cys Ile Arg Pro Glu Ile
Ser 675 680 685 Arg
Thr Met Thr Phe Gly Arg Lys Gly Val Ser His Gly Gln Phe Phe 690
695 700 Asp Gln His Leu Lys Phe
Ile Lys Leu Asn Gln Gln Phe Val His Phe705 710
715 720 Thr Gln Leu Asp Leu Ser Tyr Leu Gln Arg Glu
Ala Tyr Asp Arg Asp 725 730
735 Phe Leu Ala Arg Val Tyr Gly Ala Pro Gln Leu Gln Val Glu Lys Val
740 745 750 Arg Thr Asn
Asp Arg Lys Glu Leu Gly Glu Val Arg Val Gln Tyr Thr 755
760 765 Gly Arg Asp Ser Phe Lys Ala Phe
Ala Lys Ala Leu Gly Val Met Asp 770 775
780 Asp Leu Lys Ser Gly Val Pro Arg Ala Gly Tyr Arg Gly
Ile Val Thr785 790 795
800 Phe Gln Phe Arg Gly Arg Arg Val His Leu Ala Pro Pro Pro Thr Trp
805 810 815 Glu Gly Tyr Asp
Pro Ser Trp Asn 820 12010PRTArtificial
SequenceSynthesized Construct 120Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
1 5 10 121819PRTArtificial
SequenceSynthesized Construct 121Met Arg Phe Arg Ile Tyr Lys Arg Lys Val
Leu Ile Leu Thr Leu Val 1 5 10
15 Val Ala Ala Cys Gly Phe Val Leu Trp Ser Ser Asn Gly Arg Gln
Arg 20 25 30 Lys
Asn Glu Ala Leu Ala Pro Pro Leu Leu Asp Ala Glu Pro Ala Arg 35
40 45 Gly Ala Gly Gly Arg Gly
Gly Asp His Pro Ser Val Ala Val Gly Ile 50 55
60 Arg Arg Val Ser Asn Val Ser Ala Ala Ser Leu
Val Pro Ala Val Pro65 70 75
80 Gln Pro Glu Ala Asp Asn Leu Thr Leu Arg Tyr Arg Ser Leu Val Tyr
85 90 95 Gln Leu Asn
Phe Asp Gln Thr Leu Arg Asn Val Asp Lys Ala Gly Thr 100
105 110 Trp Ala Pro Arg Glu Leu Val Leu
Val Val Gln Val His Asn Arg Pro 115 120
125 Glu Tyr Leu Arg Leu Leu Leu Asp Ser Leu Arg Lys Ala
Gln Gly Ile 130 135 140
Asp Asn Val Leu Val Ile Phe Ser His Asp Phe Trp Ser Thr Glu Ile145
150 155 160 Asn Gln Leu Ile Ala
Gly Val Asn Phe Cys Pro Val Leu Gln Val Phe 165
170 175 Phe Pro Phe Ser Ile Gln Leu Tyr Pro Asn
Glu Phe Pro Gly Ser Asp 180 185
190 Pro Arg Asp Cys Pro Arg Asp Leu Pro Lys Asn Ala Ala Leu Lys
Leu 195 200 205 Gly
Cys Ile Asn Ala Glu Tyr Pro Asp Ser Phe Gly His Tyr Arg Glu 210
215 220 Ala Lys Phe Ser Gln Thr
Lys His His Trp Trp Trp Lys Leu His Phe225 230
235 240 Val Trp Glu Arg Val Lys Ile Leu Arg Asp Tyr
Ala Gly Leu Ile Leu 245 250
255 Phe Leu Glu Glu Asp His Tyr Leu Ala Pro Asp Phe Tyr His Val Phe
260 265 270 Lys Lys Met
Trp Lys Leu Lys Gln Gln Glu Cys Pro Glu Cys Asp Val 275
280 285 Leu Ser Leu Gly Thr Tyr Ser Ala
Ser Arg Ser Phe Tyr Gly Met Ala 290 295
300 Asp Lys Val Asp Val Lys Thr Trp Lys Ser Thr Glu His
Asn Met Gly305 310 315
320 Leu Ala Leu Thr Arg Asn Ala Tyr Gln Lys Leu Ile Glu Cys Thr Asp
325 330 335 Thr Phe Cys Thr
Tyr Asp Asp Tyr Asn Trp Asp Trp Thr Leu Gln Tyr 340
345 350 Leu Thr Val Ser Cys Leu Pro Lys Phe
Trp Lys Val Leu Val Pro Gln 355 360
365 Ile Pro Arg Ile Phe His Ala Gly Asp Cys Gly Met His His
Lys Lys 370 375 380
Thr Cys Arg Pro Ser Thr Gln Ser Ala Gln Ile Glu Ser Leu Leu Asn385
390 395 400 Asn Asn Lys Gln Tyr
Met Phe Pro Glu Thr Leu Thr Ile Ser Glu Lys 405
410 415 Phe Thr Val Val Ala Ile Ser Pro Pro Arg
Lys Asn Gly Gly Trp Gly 420 425
430 Asp Ile Arg Asp His Glu Leu Cys Lys Ser Tyr Arg Arg Leu Gln
Gly 435 440 445 Gly
Gly Gly Ser Gly Gly Gly Gly Ser Gly Arg Val Pro Thr Ala Ala 450
455 460 Pro Pro Ala Gln Pro Arg
Val Pro Val Thr Pro Ala Pro Ala Val Ile465 470
475 480 Pro Ile Leu Val Ile Ala Cys Asp Arg Ser Thr
Val Arg Arg Cys Leu 485 490
495 Asp Lys Leu Leu His Tyr Arg Pro Ser Ala Glu Leu Phe Pro Ile Ile
500 505 510 Val Ser Gln
Asp Cys Gly His Glu Glu Thr Ala Gln Ala Ile Ala Ser 515
520 525 Tyr Gly Ser Ala Val Thr His Ile
Arg Gln Pro Asp Leu Ser Ser Ile 530 535
540 Ala Val Pro Pro Asp His Arg Lys Phe Gln Gly Tyr Tyr
Lys Ile Ala545 550 555
560 Arg His Tyr Arg Trp Ala Leu Gly Gln Val Phe Arg Gln Phe Arg Phe
565 570 575 Pro Ala Ala Val
Val Val Glu Asp Asp Leu Glu Val Ala Pro Asp Phe 580
585 590 Phe Glu Tyr Phe Arg Ala Thr Tyr Pro
Leu Leu Lys Ala Asp Pro Ser 595 600
605 Leu Trp Cys Val Ser Ala Trp Asn Asp Asn Gly Lys Glu Gln
Met Val 610 615 620
Asp Ala Ser Arg Pro Glu Leu Leu Tyr Arg Thr Asp Phe Phe Pro Gly625
630 635 640 Leu Gly Trp Leu Leu
Leu Ala Glu Leu Trp Ala Glu Leu Glu Pro Lys 645
650 655 Trp Pro Lys Ala Phe Trp Asp Asp Trp Met
Arg Arg Pro Glu Gln Arg 660 665
670 Gln Gly Arg Ala Cys Ile Arg Pro Glu Ile Ser Arg Thr Met Thr
Phe 675 680 685 Gly
Arg Lys Gly Val Ser His Gly Gln Phe Phe Asp Gln His Leu Lys 690
695 700 Phe Ile Lys Leu Asn Gln
Gln Phe Val His Phe Thr Gln Leu Asp Leu705 710
715 720 Ser Tyr Leu Gln Arg Glu Ala Tyr Asp Arg Asp
Phe Leu Ala Arg Val 725 730
735 Tyr Gly Ala Pro Gln Leu Gln Val Glu Lys Val Arg Thr Asn Asp Arg
740 745 750 Lys Glu Leu
Gly Glu Val Arg Val Gln Tyr Thr Gly Arg Asp Ser Phe 755
760 765 Lys Ala Phe Ala Lys Ala Leu Gly
Val Met Asp Asp Leu Lys Ser Gly 770 775
780 Val Pro Arg Ala Gly Tyr Arg Gly Ile Val Thr Phe Gln
Phe Arg Gly785 790 795
800 Arg Arg Val His Leu Ala Pro Pro Pro Thr Trp Glu Gly Tyr Asp Pro
805 810 815 Ser Trp Asn
12219PRTTrichoderma reesei 122Ser Thr Gly Asn Pro Ser Gly Gly Asn Pro Pro
Gly Gly Asn Pro Pro 1 5 10
15 Gly Ser Thr123828PRTTrichoderma reesei 123Met Arg Phe Arg Ile
Tyr Lys Arg Lys Val Leu Ile Leu Thr Leu Val 1 5
10 15 Val Ala Ala Cys Gly Phe Val Leu Trp Ser
Ser Asn Gly Arg Gln Arg 20 25
30 Lys Asn Glu Ala Leu Ala Pro Pro Leu Leu Asp Ala Glu Pro Ala
Arg 35 40 45 Gly
Ala Gly Gly Arg Gly Gly Asp His Pro Ser Val Ala Val Gly Ile 50
55 60 Arg Arg Val Ser Asn Val
Ser Ala Ala Ser Leu Val Pro Ala Val Pro65 70
75 80 Gln Pro Glu Ala Asp Asn Leu Thr Leu Arg Tyr
Arg Ser Leu Val Tyr 85 90
95 Gln Leu Asn Phe Asp Gln Thr Leu Arg Asn Val Asp Lys Ala Gly Thr
100 105 110 Trp Ala Pro
Arg Glu Leu Val Leu Val Val Gln Val His Asn Arg Pro 115
120 125 Glu Tyr Leu Arg Leu Leu Leu Asp
Ser Leu Arg Lys Ala Gln Gly Ile 130 135
140 Asp Asn Val Leu Val Ile Phe Ser His Asp Phe Trp Ser
Thr Glu Ile145 150 155
160 Asn Gln Leu Ile Ala Gly Val Asn Phe Cys Pro Val Leu Gln Val Phe
165 170 175 Phe Pro Phe Ser
Ile Gln Leu Tyr Pro Asn Glu Phe Pro Gly Ser Asp 180
185 190 Pro Arg Asp Cys Pro Arg Asp Leu Pro
Lys Asn Ala Ala Leu Lys Leu 195 200
205 Gly Cys Ile Asn Ala Glu Tyr Pro Asp Ser Phe Gly His Tyr
Arg Glu 210 215 220
Ala Lys Phe Ser Gln Thr Lys His His Trp Trp Trp Lys Leu His Phe225
230 235 240 Val Trp Glu Arg Val
Lys Ile Leu Arg Asp Tyr Ala Gly Leu Ile Leu 245
250 255 Phe Leu Glu Glu Asp His Tyr Leu Ala Pro
Asp Phe Tyr His Val Phe 260 265
270 Lys Lys Met Trp Lys Leu Lys Gln Gln Glu Cys Pro Glu Cys Asp
Val 275 280 285 Leu
Ser Leu Gly Thr Tyr Ser Ala Ser Arg Ser Phe Tyr Gly Met Ala 290
295 300 Asp Lys Val Asp Val Lys
Thr Trp Lys Ser Thr Glu His Asn Met Gly305 310
315 320 Leu Ala Leu Thr Arg Asn Ala Tyr Gln Lys Leu
Ile Glu Cys Thr Asp 325 330
335 Thr Phe Cys Thr Tyr Asp Asp Tyr Asn Trp Asp Trp Thr Leu Gln Tyr
340 345 350 Leu Thr Val
Ser Cys Leu Pro Lys Phe Trp Lys Val Leu Val Pro Gln 355
360 365 Ile Pro Arg Ile Phe His Ala Gly
Asp Cys Gly Met His His Lys Lys 370 375
380 Thr Cys Arg Pro Ser Thr Gln Ser Ala Gln Ile Glu Ser
Leu Leu Asn385 390 395
400 Asn Asn Lys Gln Tyr Met Phe Pro Glu Thr Leu Thr Ile Ser Glu Lys
405 410 415 Phe Thr Val Val
Ala Ile Ser Pro Pro Arg Lys Asn Gly Gly Trp Gly 420
425 430 Asp Ile Arg Asp His Glu Leu Cys Lys
Ser Tyr Arg Arg Leu Gln Ser 435 440
445 Thr Gly Asn Pro Ser Gly Gly Asn Pro Pro Gly Gly Asn Pro
Pro Gly 450 455 460
Ser Thr Gly Arg Val Pro Thr Ala Ala Pro Pro Ala Gln Pro Arg Val465
470 475 480 Pro Val Thr Pro Ala
Pro Ala Val Ile Pro Ile Leu Val Ile Ala Cys 485
490 495 Asp Arg Ser Thr Val Arg Arg Cys Leu Asp
Lys Leu Leu His Tyr Arg 500 505
510 Pro Ser Ala Glu Leu Phe Pro Ile Ile Val Ser Gln Asp Cys Gly
His 515 520 525 Glu
Glu Thr Ala Gln Ala Ile Ala Ser Tyr Gly Ser Ala Val Thr His 530
535 540 Ile Arg Gln Pro Asp Leu
Ser Ser Ile Ala Val Pro Pro Asp His Arg545 550
555 560 Lys Phe Gln Gly Tyr Tyr Lys Ile Ala Arg His
Tyr Arg Trp Ala Leu 565 570
575 Gly Gln Val Phe Arg Gln Phe Arg Phe Pro Ala Ala Val Val Val Glu
580 585 590 Asp Asp Leu
Glu Val Ala Pro Asp Phe Phe Glu Tyr Phe Arg Ala Thr 595
600 605 Tyr Pro Leu Leu Lys Ala Asp Pro
Ser Leu Trp Cys Val Ser Ala Trp 610 615
620 Asn Asp Asn Gly Lys Glu Gln Met Val Asp Ala Ser Arg
Pro Glu Leu625 630 635
640 Leu Tyr Arg Thr Asp Phe Phe Pro Gly Leu Gly Trp Leu Leu Leu Ala
645 650 655 Glu Leu Trp Ala
Glu Leu Glu Pro Lys Trp Pro Lys Ala Phe Trp Asp 660
665 670 Asp Trp Met Arg Arg Pro Glu Gln Arg
Gln Gly Arg Ala Cys Ile Arg 675 680
685 Pro Glu Ile Ser Arg Thr Met Thr Phe Gly Arg Lys Gly Val
Ser His 690 695 700
Gly Gln Phe Phe Asp Gln His Leu Lys Phe Ile Lys Leu Asn Gln Gln705
710 715 720 Phe Val His Phe Thr
Gln Leu Asp Leu Ser Tyr Leu Gln Arg Glu Ala 725
730 735 Tyr Asp Arg Asp Phe Leu Ala Arg Val Tyr
Gly Ala Pro Gln Leu Gln 740 745
750 Val Glu Lys Val Arg Thr Asn Asp Arg Lys Glu Leu Gly Glu Val
Arg 755 760 765 Val
Gln Tyr Thr Gly Arg Asp Ser Phe Lys Ala Phe Ala Lys Ala Leu 770
775 780 Gly Val Met Asp Asp Leu
Lys Ser Gly Val Pro Arg Ala Gly Tyr Arg785 790
795 800 Gly Ile Val Thr Phe Gln Phe Arg Gly Arg Arg
Val His Leu Ala Pro 805 810
815 Pro Pro Thr Trp Glu Gly Tyr Asp Pro Ser Trp Asn 820
825 12421PRTTrichoderma reesei 124Ser Ser Ala
Ala Thr Ala Thr Ala Ser Ala Thr Val Pro Gly Gly Gly 1 5
10 15 Ser Gly Pro Thr Ser
20 125830PRTTrichoderma reesei 125Met Arg Phe Arg Ile Tyr Lys Arg
Lys Val Leu Ile Leu Thr Leu Val 1 5 10
15 Val Ala Ala Cys Gly Phe Val Leu Trp Ser Ser Asn Gly
Arg Gln Arg 20 25 30
Lys Asn Glu Ala Leu Ala Pro Pro Leu Leu Asp Ala Glu Pro Ala Arg
35 40 45 Gly Ala Gly Gly
Arg Gly Gly Asp His Pro Ser Val Ala Val Gly Ile 50 55
60 Arg Arg Val Ser Asn Val Ser Ala Ala
Ser Leu Val Pro Ala Val Pro65 70 75
80 Gln Pro Glu Ala Asp Asn Leu Thr Leu Arg Tyr Arg Ser Leu
Val Tyr 85 90 95
Gln Leu Asn Phe Asp Gln Thr Leu Arg Asn Val Asp Lys Ala Gly Thr
100 105 110 Trp Ala Pro Arg Glu
Leu Val Leu Val Val Gln Val His Asn Arg Pro 115
120 125 Glu Tyr Leu Arg Leu Leu Leu Asp Ser
Leu Arg Lys Ala Gln Gly Ile 130 135
140 Asp Asn Val Leu Val Ile Phe Ser His Asp Phe Trp Ser
Thr Glu Ile145 150 155
160 Asn Gln Leu Ile Ala Gly Val Asn Phe Cys Pro Val Leu Gln Val Phe
165 170 175 Phe Pro Phe Ser
Ile Gln Leu Tyr Pro Asn Glu Phe Pro Gly Ser Asp 180
185 190 Pro Arg Asp Cys Pro Arg Asp Leu Pro
Lys Asn Ala Ala Leu Lys Leu 195 200
205 Gly Cys Ile Asn Ala Glu Tyr Pro Asp Ser Phe Gly His Tyr
Arg Glu 210 215 220
Ala Lys Phe Ser Gln Thr Lys His His Trp Trp Trp Lys Leu His Phe225
230 235 240 Val Trp Glu Arg Val
Lys Ile Leu Arg Asp Tyr Ala Gly Leu Ile Leu 245
250 255 Phe Leu Glu Glu Asp His Tyr Leu Ala Pro
Asp Phe Tyr His Val Phe 260 265
270 Lys Lys Met Trp Lys Leu Lys Gln Gln Glu Cys Pro Glu Cys Asp
Val 275 280 285 Leu
Ser Leu Gly Thr Tyr Ser Ala Ser Arg Ser Phe Tyr Gly Met Ala 290
295 300 Asp Lys Val Asp Val Lys
Thr Trp Lys Ser Thr Glu His Asn Met Gly305 310
315 320 Leu Ala Leu Thr Arg Asn Ala Tyr Gln Lys Leu
Ile Glu Cys Thr Asp 325 330
335 Thr Phe Cys Thr Tyr Asp Asp Tyr Asn Trp Asp Trp Thr Leu Gln Tyr
340 345 350 Leu Thr Val
Ser Cys Leu Pro Lys Phe Trp Lys Val Leu Val Pro Gln 355
360 365 Ile Pro Arg Ile Phe His Ala Gly
Asp Cys Gly Met His His Lys Lys 370 375
380 Thr Cys Arg Pro Ser Thr Gln Ser Ala Gln Ile Glu Ser
Leu Leu Asn385 390 395
400 Asn Asn Lys Gln Tyr Met Phe Pro Glu Thr Leu Thr Ile Ser Glu Lys
405 410 415 Phe Thr Val Val
Ala Ile Ser Pro Pro Arg Lys Asn Gly Gly Trp Gly 420
425 430 Asp Ile Arg Asp His Glu Leu Cys Lys
Ser Tyr Arg Arg Leu Gln Ser 435 440
445 Ser Ala Ala Thr Ala Thr Ala Ser Ala Thr Val Pro Gly Gly
Gly Ser 450 455 460
Gly Pro Thr Ser Gly Arg Val Pro Thr Ala Ala Pro Pro Ala Gln Pro465
470 475 480 Arg Val Pro Val Thr
Pro Ala Pro Ala Val Ile Pro Ile Leu Val Ile 485
490 495 Ala Cys Asp Arg Ser Thr Val Arg Arg Cys
Leu Asp Lys Leu Leu His 500 505
510 Tyr Arg Pro Ser Ala Glu Leu Phe Pro Ile Ile Val Ser Gln Asp
Cys 515 520 525 Gly
His Glu Glu Thr Ala Gln Ala Ile Ala Ser Tyr Gly Ser Ala Val 530
535 540 Thr His Ile Arg Gln Pro
Asp Leu Ser Ser Ile Ala Val Pro Pro Asp545 550
555 560 His Arg Lys Phe Gln Gly Tyr Tyr Lys Ile Ala
Arg His Tyr Arg Trp 565 570
575 Ala Leu Gly Gln Val Phe Arg Gln Phe Arg Phe Pro Ala Ala Val Val
580 585 590 Val Glu Asp
Asp Leu Glu Val Ala Pro Asp Phe Phe Glu Tyr Phe Arg 595
600 605 Ala Thr Tyr Pro Leu Leu Lys Ala
Asp Pro Ser Leu Trp Cys Val Ser 610 615
620 Ala Trp Asn Asp Asn Gly Lys Glu Gln Met Val Asp Ala
Ser Arg Pro625 630 635
640 Glu Leu Leu Tyr Arg Thr Asp Phe Phe Pro Gly Leu Gly Trp Leu Leu
645 650 655 Leu Ala Glu Leu
Trp Ala Glu Leu Glu Pro Lys Trp Pro Lys Ala Phe 660
665 670 Trp Asp Asp Trp Met Arg Arg Pro Glu
Gln Arg Gln Gly Arg Ala Cys 675 680
685 Ile Arg Pro Glu Ile Ser Arg Thr Met Thr Phe Gly Arg Lys
Gly Val 690 695 700
Ser His Gly Gln Phe Phe Asp Gln His Leu Lys Phe Ile Lys Leu Asn705
710 715 720 Gln Gln Phe Val His
Phe Thr Gln Leu Asp Leu Ser Tyr Leu Gln Arg 725
730 735 Glu Ala Tyr Asp Arg Asp Phe Leu Ala Arg
Val Tyr Gly Ala Pro Gln 740 745
750 Leu Gln Val Glu Lys Val Arg Thr Asn Asp Arg Lys Glu Leu Gly
Glu 755 760 765 Val
Arg Val Gln Tyr Thr Gly Arg Asp Ser Phe Lys Ala Phe Ala Lys 770
775 780 Ala Leu Gly Val Met Asp
Asp Leu Lys Ser Gly Val Pro Arg Ala Gly785 790
795 800 Tyr Arg Gly Ile Val Thr Phe Gln Phe Arg Gly
Arg Arg Val His Leu 805 810
815 Ala Pro Pro Pro Thr Trp Glu Gly Tyr Asp Pro Ser Trp Asn
820 825 830 126420PRTTrichoderma reesei
126Met Ala Ser Leu Ile Lys Thr Ala Val Asp Ile Ala Asn Gly Arg His 1
5 10 15 Ala Leu Ser Arg
Tyr Val Ile Phe Gly Leu Trp Leu Ala Asp Ala Val 20
25 30 Leu Cys Gly Leu Ile Ile Trp Lys Val
Pro Tyr Thr Glu Ile Asp Trp 35 40
45 Val Ala Tyr Met Glu Gln Val Thr Gln Phe Val His Gly Glu
Arg Asp 50 55 60
Tyr Pro Lys Met Glu Gly Gly Thr Gly Pro Leu Val Tyr Pro Ala Ala65
70 75 80 His Val Tyr Ile Tyr
Thr Gly Leu Tyr Tyr Leu Thr Asn Lys Gly Thr 85
90 95 Asp Ile Leu Leu Ala Gln Gln Leu Phe Ala
Val Leu Tyr Met Ala Thr 100 105
110 Leu Ala Val Val Met Thr Cys Tyr Ser Lys Ala Lys Val Pro Pro
Tyr 115 120 125 Ile
Phe Pro Leu Leu Ile Leu Ser Lys Arg Leu His Ser Val Phe Val 130
135 140 Leu Arg Cys Phe Asn Asp
Cys Phe Ala Ala Phe Phe Leu Trp Leu Cys145 150
155 160 Ile Phe Phe Phe Gln Arg Arg Glu Trp Thr Ile
Gly Ala Leu Ala Tyr 165 170
175 Ser Ile Gly Leu Gly Val Lys Met Ser Leu Leu Leu Val Leu Pro Ala
180 185 190 Val Val Ile
Val Leu Tyr Leu Gly Arg Gly Phe Lys Gly Ala Leu Arg 195
200 205 Leu Leu Trp Leu Met Val Gln Val
Gln Leu Leu Leu Ala Ile Pro Phe 210 215
220 Ile Thr Thr Asn Trp Arg Gly Tyr Leu Gly Arg Ala Phe
Glu Leu Ser225 230 235
240 Arg Gln Phe Lys Phe Glu Trp Thr Val Asn Trp Arg Met Leu Gly Glu
245 250 255 Asp Leu Phe Leu
Ser Arg Gly Phe Ser Ile Thr Leu Leu Ala Phe His 260
265 270 Ala Ile Phe Leu Leu Ala Phe Ile Leu
Gly Arg Trp Leu Lys Ile Arg 275 280
285 Glu Arg Thr Val Leu Gly Met Ile Pro Tyr Val Ile Arg Phe
Arg Ser 290 295 300
Pro Phe Thr Glu Gln Glu Glu Arg Ala Ile Ser Asn Arg Val Val Thr305
310 315 320 Pro Gly Tyr Val Met
Ser Thr Ile Leu Ser Ala Asn Val Val Gly Leu 325
330 335 Leu Phe Ala Arg Ser Leu His Tyr Gln Phe
Tyr Ala Tyr Leu Ala Trp 340 345
350 Ala Thr Pro Tyr Leu Leu Trp Thr Ala Cys Pro Asn Leu Leu Val
Val 355 360 365 Ala
Pro Leu Trp Ala Ala Gln Glu Trp Ala Trp Asn Val Phe Pro Ser 370
375 380 Thr Pro Leu Ser Ser Ser
Val Val Val Ser Val Leu Ala Val Thr Val385 390
395 400 Ala Met Ala Phe Ala Gly Ser Asn Pro Gln Pro
Arg Glu Thr Ser Lys 405 410
415 Pro Lys Gln His 420 127525PRTTrichoderma atroviride
127Met Ala Ser Leu Ile Lys Phe Ala Ser Asp Val Ala Thr Gly Arg His 1
5 10 15 Ala Leu Ser Lys
Leu Ile Pro Val Gly Leu Phe Leu Ala Asp Ala Ile 20
25 30 Leu Cys Gly Leu Val Ile Trp Lys Val
Pro Tyr Thr Glu Ile Asp Trp 35 40
45 Thr Ala Tyr Met Glu Gln Val Thr Gln Phe Val Asn Gly Glu
Arg Asp 50 55 60
Tyr Pro Lys Met Glu Gly Gly Thr Gly Pro Leu Val Tyr Pro Ala Ala65
70 75 80 His Val Tyr Ile Tyr
Thr Gly Leu Tyr Tyr Leu Thr Asn Arg Gly Thr 85
90 95 Asp Ile Leu Leu Ala Gln Gln Leu Phe Ala
Val Leu Tyr Met Ala Thr 100 105
110 Leu Gly Val Val Met Leu Ser Tyr Trp Lys Ala Arg Val Pro Pro
Tyr 115 120 125 Ile
Phe Pro Leu Leu Ile Leu Ser Lys Arg Leu His Ser Val Phe Val 130
135 140 Leu Arg Cys Phe Asn Asp
Cys Phe Ala Ala Phe Phe Leu Trp Leu Cys145 150
155 160 Ile Tyr Ser Phe Gln Asn Arg Ala Trp Thr Phe
Gly Ala Leu Ala Tyr 165 170
175 Thr Leu Gly Leu Gly Val Lys Met Ser Leu Leu Leu Val Leu Pro Ala
180 185 190 Val Val Ile
Ile Leu Phe Leu Gly Arg Gly Phe Lys Gly Ala Leu Arg 195
200 205 Leu Val Trp Leu Met Ala Gln Val
Gln Leu Val Leu Ala Ile Pro Phe 210 215
220 Ile Thr Thr Asn Trp Ala Gly Tyr Leu Gly Arg Ala Phe
Glu Leu Ser225 230 235
240 Arg Gln Phe Lys Phe Glu Trp Thr Val Asn Trp Arg Met Met Gly Glu
245 250 255 Glu Thr Phe Leu
Ser Arg Gly Phe Ser Ile Thr Leu Leu Thr Phe His 260
265 270 Val Val Thr Leu Leu Val Phe Ile Ala
Ala Arg Trp Leu Lys Leu Gln 275 280
285 Glu Arg Ser Leu Leu Gly Ile Ile Thr Tyr Ala Val Arg Phe
Gln Ser 290 295 300
Pro Phe Thr Glu Gln Glu Glu Ala Lys Val Ser Lys Lys Val Val Thr305
310 315 320 Pro Arg Tyr Val Leu
Ala Thr Ile Leu Ser Ala Asn Val Ile Gly Leu 325
330 335 Leu Phe Ala Arg Ser Leu His Tyr Gln Phe
Tyr Ala Tyr Leu Ala Trp 340 345
350 Ala Thr Pro Phe Leu Leu Trp Thr Ala Tyr Pro Asn Leu Leu Val
Val 355 360 365 Val
Pro Leu Trp Leu Ala Gln Glu Trp Ala Trp Asn Val Phe Pro Ser 370
375 380 Thr Pro Leu Ser Ser Ser
Val Val Ile Ser Leu Val Pro Val Cys Leu385 390
395 400 Leu Ser Pro Gln Leu Leu Val Ser His Asp Ile
Tyr Asn Phe Ala Asn 405 410
415 Cys Ser Ala Ile Leu Arg Pro Arg Gly Ile Ala Phe Gly Gln Asp Ile
420 425 430 Ser Ala Thr
Leu Asn Pro Asp Gly Val Ala Lys Pro Leu Gly Glu Leu 435
440 445 Glu Asn Asp Gly Leu Arg Val Trp
His Leu Ala Ser Val Gln Val Val 450 455
460 Ser Phe Gly Leu His His Ala His Asn Glu Leu Gly Gly
Leu Gln Phe465 470 475
480 Gly Trp Trp Arg Glu Arg Phe Leu Arg Gly Gly Glu Asp Val Ala Leu
485 490 495 Trp Phe Ala His
Gly Gly Phe Glu Phe Arg Phe Phe Ser Glu Leu Leu 500
505 510 Val Arg Leu Ala Asp Thr Ser Asp Ile
Lys Lys Ser Phe 515 520 525
128419PRTTrichoderma virens 128Met Ala Ser Leu Ile Lys Phe Ala Ser Asp
Val Ala Asn Gly Arg His 1 5 10
15 Ala Leu Ser Lys Phe Ile Pro Met Gly Leu Trp Leu Ala Asp Ala
Val 20 25 30 Leu
Cys Gly Leu Ile Ile Trp Lys Val Pro Tyr Thr Glu Ile Asp Trp 35
40 45 Val Ala Tyr Met Glu Gln
Ile Thr Gln Phe Val His Gly Glu Arg Asp 50 55
60 Tyr Pro Lys Met Glu Gly Gly Thr Gly Pro Leu
Val Tyr Pro Ala Ala65 70 75
80 His Val Tyr Ile Tyr Thr Gly Leu Tyr Tyr Leu Thr Asn Lys Gly Thr
85 90 95 Asp Ile Leu
Leu Ala Gln Gln Leu Phe Ala Val Leu Tyr Met Ala Thr 100
105 110 Leu Gly Val Val Met Leu Cys Tyr
Trp Lys Ala Lys Val Pro Pro Tyr 115 120
125 Ile Phe Pro Leu Leu Ile Leu Ser Lys Arg Leu His Ser
Val Phe Val 130 135 140
Leu Arg Cys Phe Asn Asp Cys Phe Ala Ala Phe Phe Leu Trp Leu Ser145
150 155 160 Ile Phe Phe Phe Gln
Arg Arg Val Trp Thr Leu Gly Ala Ile Ala Tyr 165
170 175 Thr Ile Gly Leu Gly Val Lys Met Ser Leu
Leu Leu Val Leu Pro Ala 180 185
190 Val Val Ile Val Leu Phe Leu Gly Arg Gly Phe Lys Gly Ala Leu
Arg 195 200 205 Leu
Leu Trp Leu Met Val Gln Val Gln Leu Leu Leu Ala Ile Pro Phe 210
215 220 Ile Thr Thr Asn Trp Lys
Gly Tyr Leu Gly Arg Ala Phe Glu Leu Ser225 230
235 240 Arg Gln Phe Lys Phe Glu Trp Thr Val Asn Trp
Arg Met Leu Gly Glu 245 250
255 Glu Leu Phe Leu Ser Arg Gly Phe Ser Ile Thr Leu Leu Ala Phe His
260 265 270 Ala Leu Phe
Leu Leu Ile Phe Ile Leu Gly Arg Trp Leu Arg Ile Lys 275
280 285 Glu Arg Ser Phe Leu Gly Met Ile
Pro Tyr Val Leu Arg Phe Thr Ser 290 295
300 Pro Phe Thr Glu His Glu Glu Ala Ser Ile Ser His Arg
Val Val Thr305 310 315
320 Pro Glu Tyr Ile Met Ser Ala Met Leu Ser Ala Asn Val Val Gly Leu
325 330 335 Leu Phe Ala Arg
Ser Leu His Tyr Gln Phe Tyr Ala Tyr Leu Ala Trp 340
345 350 Ala Thr Pro Phe Leu Leu Trp Thr Ala
Ser Pro Asn Leu Leu Val Val 355 360
365 Val Pro Leu Trp Ala Ala Gln Glu Trp Ala Trp Asn Val Phe
Pro Ser 370 375 380
Thr Pro Leu Ser Ser Asn Val Val Val Ser Val Leu Ala Val Thr Val385
390 395 400 Ala Met Ala Phe Val
Gly Ser Asn Pro Gln Arg Gly Ala Pro Lys Pro 405
410 415 Lys Gln Leu129434PRTFusarium oxysporum
129Met Pro Glu Ser Ala Ser Gly Thr Leu Ser Gln Gly Val Arg Phe Leu 1
5 10 15 Arg Asn Val Leu
Asn Gly Arg His Ala Leu Ser Lys Leu Ile Pro Ile 20
25 30 Ala Leu Trp Leu Val Asp Ala Leu Gly
Cys Gly Leu Ile Ile Trp Lys 35 40
45 Ile Pro Tyr Thr Glu Ile Asp Trp Val Ala Tyr Met Gln Gln
Ile Ser 50 55 60
Gln Phe Val Ser Gly Glu Arg Asp Tyr Thr Lys Met Glu Gly Asp Thr65
70 75 80 Gly Pro Leu Val Tyr
Pro Ala Ala His Val Tyr Thr Tyr Thr Gly Leu 85
90 95 Tyr Tyr Ile Thr Asp Lys Gly Thr Asn Ile
Leu Leu Ala Gln Gln Ile 100 105
110 Phe Ala Val Leu Tyr Met Ala Thr Leu Ala Val Val Met Leu Cys
Tyr 115 120 125 Trp
Lys Ala Lys Val Pro Pro Tyr Met Phe Ile Phe Leu Ile Ala Ser 130
135 140 Lys Arg Leu His Ser Leu
Phe Val Leu Arg Cys Phe Asn Asp Cys Phe145 150
155 160 Ala Val Phe Phe Leu Trp Leu Thr Ile Phe Leu
Phe Gln Arg Arg Gln 165 170
175 Trp Thr Val Gly Ser Leu Val Tyr Ser Trp Gly Leu Gly Ile Lys Met
180 185 190 Ser Leu Leu
Leu Val Leu Pro Ala Ile Gly Val Ile Leu Phe Leu Gly 195
200 205 Arg Gly Leu Trp Pro Ser Leu Arg
Leu Ala Trp Leu Met Ala Gln Ile 210 215
220 Gln Phe Ala Ile Gly Leu Pro Phe Ile Thr Lys Asn Pro
Arg Gly Tyr225 230 235
240 Ala Ala Arg Ala Phe Glu Leu Ser Arg Gln Phe Gln Phe Lys Trp Thr
245 250 255 Val Asn Trp Arg
Met Leu Gly Glu Glu Val Phe Leu Ser Lys Tyr Phe 260
265 270 Ala Leu Ser Leu Leu Ala Cys His Ile
Leu Val Leu Leu Ile Phe Ile 275 280
285 Ser Lys Arg Trp Ile Gln Pro Thr Gly Arg Ser Leu Tyr Asp
Leu Ile 290 295 300
Pro Ser Phe Leu Arg Leu Lys Ser Pro Phe Thr Met Gln Glu Gln Leu305
310 315 320 Arg Ile Ser His Tyr
Val Thr Pro Glu Tyr Ala Met Thr Thr Met Leu 325
330 335 Thr Ala Asn Leu Ile Gly Leu Leu Phe Ala
Arg Ser Leu His Tyr Gln 340 345
350 Phe Tyr Ala Tyr Leu Ala Trp Ala Thr Pro Tyr Leu Leu Trp Arg
Ala 355 360 365 Thr
Glu Asp Pro Val Ile Val Ala Ile Ile Trp Ala Ala Gln Glu Trp 370
375 380 Ala Trp Asn Val Tyr Pro
Ser Thr Asp Leu Ser Ser Thr Ile Ala Val385 390
395 400 Asn Thr Met Leu Ala Thr Val Val Leu Val Tyr
Leu Gly Thr Ala Arg 405 410
415 Arg Ala Val Pro Ala Pro Ala Ala Gln Val Gly Asn Val Asp Asp Lys
420 425 430 Asn
Lys130432PRTGibberella zeae 130Met Ala Asp Pro Ala Pro Gly Ala Leu Ala
Arg Gly Thr Arg Phe Val 1 5 10
15 Arg Asn Val Leu Thr Gly Gln His Ala Leu Ser Lys Leu Ile Pro
Val 20 25 30 Ala
Leu Trp Leu Ala Asp Ala Val Gly Thr Ser Leu Ile Ile Trp Lys 35
40 45 Val Pro Tyr Thr Glu Ile
Asp Trp Glu Ala Tyr Met Gln Gln Val Ser 50 55
60 Gln Phe Ile Ser Gly Glu Arg Asp Tyr Thr Lys
Ile Glu Gly Gly Thr65 70 75
80 Gly Pro Leu Val Tyr Pro Ala Ala His Val Tyr Thr Phe Thr Gly Leu
85 90 95 Tyr His Ile
Thr Asn Glu Gly Glu Asn Ile Phe Leu Ala Gln Gln Ile 100
105 110 Phe Gly Val Leu Tyr Met Ala Thr
Leu Ala Val Val Met Leu Cys Tyr 115 120
125 Trp Lys Ala Lys Val Pro Pro Tyr Met Phe Val Phe Leu
Ile Ala Ser 130 135 140
Lys Arg Leu His Ser Leu Phe Val Leu Arg Cys Phe Asn Asp Cys Phe145
150 155 160 Ala Val Phe Phe Leu
Trp Leu Ser Ile Tyr Phe Phe Gln Arg Arg Asn 165
170 175 Trp Thr Phe Gly Ser Leu Ala Tyr Thr Trp
Gly Leu Gly Ile Lys Met 180 185
190 Ser Leu Leu Leu Val Leu Pro Ala Ile Gly Val Ile Leu Leu Leu
Gly 195 200 205 Arg
Gly Phe Trp Pro Gly Leu Arg Leu Ala Trp Leu Met Ala Gln Val 210
215 220 Gln Phe Ala Ile Gly Ile
Pro Phe Ile Met Lys Asn Ser Arg Gly Tyr225 230
235 240 Ala Ala Arg Ala Phe Glu Leu Ser Arg Glu Phe
Lys Phe Glu Trp Thr 245 250
255 Val Asn Trp Arg Met Leu Gly Glu Glu Val Phe Leu Ser Lys Ser Phe
260 265 270 Ala Ile Phe
Leu Leu Ala Cys His Val Thr Ala Leu Leu Val Phe Ile 275
280 285 Ser Gln Arg Trp Leu Gln Pro Thr
Gly Arg Pro Leu Ser Ala Met Ile 290 295
300 Pro Ser Phe Leu Gln Leu Lys Ser Pro Phe Thr Leu Gln
Glu Gln Leu305 310 315
320 Arg Ile Ser His Tyr Val Thr Pro Glu Tyr Val Met Thr Thr Met Leu
325 330 335 Ser Ala Asn Val
Ile Gly Leu Leu Phe Ala Arg Ser Leu His Tyr Gln 340
345 350 Phe Tyr Ala Tyr Leu Ala Trp Ala Ser
Pro Tyr Leu Ile Trp Arg Ala 355 360
365 Thr Glu Asp Pro Phe Ile Val Leu Leu Ile Trp Ala Ala Gln
Glu Trp 370 375 380
Ala Trp Asn Val Phe Pro Ser Thr Asp Leu Ser Ser Arg Val Thr Val385
390 395 400 Gly Ala Met Leu Ala
Thr Val Val Leu Ala Tyr Arg Gly Thr Ala Arg 405
410 415 Leu Ala Val Pro Pro Ser Gln Ala Arg Lys
Ile Glu Ala Lys Asn Lys 420 425
430 131446PRTMyceliophthora thermophila 131Met Thr Arg Met Arg
Ser Ser Pro Lys Thr Pro Thr Ala Thr Met Ala 1 5
10 15 Asp Gln Asn Arg Pro Ile His Ile Arg Ala
Thr Arg Leu Val Phe Asp 20 25
30 Ile Leu Asn Gly Arg His Val Leu Ser Lys Leu Ile Pro Pro Leu
Val 35 40 45 Phe
Leu Ala Asp Ala Leu Leu Cys Ala Leu Ile Ile Trp Lys Val Pro 50
55 60 Tyr Thr Glu Ile Asp Trp
Asn Ala Tyr Met Glu Gln Val Ala Gln Ile65 70
75 80 Leu Ser Gly Glu Arg Asp Tyr Thr Lys Ile Arg
Gly Asn Thr Gly Pro 85 90
95 Leu Val Tyr Pro Ala Ala His Val Tyr Ile Tyr Thr Gly Leu Tyr His
100 105 110 Leu Thr Asp
Glu Gly Arg Asn Ile Leu Thr Ala Gln Lys Leu Phe Gly 115
120 125 Phe Leu Tyr Met Val Thr Leu Ala
Val Val Met Ala Cys Tyr Trp Gln 130 135
140 Ala Lys Val Pro Pro Tyr Val Phe Pro Leu Leu Ile Leu
Ser Lys Arg145 150 155
160 Leu His Ser Ile Phe Val Leu Arg Cys Phe Asn Asp Cys Phe Ala Thr
165 170 175 Leu Phe Leu Trp
Leu Ala Ile Phe Ala Leu Gln Arg Arg Ala Trp Arg 180
185 190 Thr Gly Ala Leu Met Tyr Thr Leu Gly
Leu Gly Val Lys Met Ser Leu 195 200
205 Leu Leu Val Leu Pro Ala Val Gly Val Val Leu Leu Leu Gly
Ala Gly 210 215 220
Phe Ala Thr Ser Leu Arg Leu Ala Ala Val Ile Gly Leu Val Gln Val225
230 235 240 Leu Ile Ala Val Pro
Phe Leu Ser Asn Asn Pro Trp Gly Tyr Leu Gly 245
250 255 Arg Ala Phe Glu Leu Ser Arg Gln Phe Phe
Phe Lys Trp Thr Val Asn 260 265
270 Trp Arg Phe Val Gly Glu Glu Val Phe Leu Ser Lys Glu Phe Ser
Leu 275 280 285 Ala
Leu Leu Gly Leu His Val Ala Val Leu Ala Ile Phe Val Thr Thr 290
295 300 Arg Trp Leu Lys Pro Ala
Arg Lys Pro Val Ser Gln Leu Ile Val Pro305 310
315 320 Ile Leu Leu Gly Lys Ser Pro Phe Thr Glu Glu
Glu Gln Arg Ala Val 325 330
335 Ser Arg Asp Val Thr Pro Arg Phe Ile Leu Thr Ser Ile Leu Ser Ala
340 345 350 Asn Val Val
Gly Leu Leu Phe Ala Arg Ser Leu His Tyr Gln Phe Tyr 355
360 365 Ser Tyr Leu Ala Trp Met Thr Pro
Tyr Leu Leu Trp Arg Ser Gly Val 370 375
380 His Pro Ile Leu Gln Tyr Ala Ile Trp Thr Ala Gln Glu
Trp Ala Trp385 390 395
400 Asn Val Tyr Pro Ser Thr Pro Ile Ser Ser Gly Val Val Val Gly Val
405 410 415 Leu Ala Leu Thr
Ala Ala Leu Val Trp Leu Gly Ala Arg Glu Asp Trp 420
425 430 Glu Pro Arg Arg Val Leu Leu Lys Gly
Glu Ala Ala Lys Arg 435 440 445
132442PRTNeurospora crassa 132Met Ala Ala Pro Ser Ser Arg Pro Glu Ser
Asn Pro Pro Leu Tyr Lys 1 5 10
15 Gln Ala Leu Asp Phe Ala Leu Asp Val Ala Asn Gly Arg His Ala
Leu 20 25 30 Ser
Lys Leu Ile Pro Pro Ala Leu Phe Leu Val Asp Ala Leu Leu Cys 35
40 45 Gly Leu Ile Ile Trp Lys
Val Pro Tyr Thr Glu Ile Asp Trp Ala Ala 50 55
60 Tyr Met Glu Gln Val Ser Gln Ile Leu Ser Gly
Glu Arg Asp Tyr Thr65 70 75
80 Lys Val Arg Gly Gly Thr Gly Pro Leu Val Tyr Pro Ala Ala His Val
85 90 95 Tyr Ile Tyr
Thr Gly Leu Tyr His Leu Thr Asp Glu Gly Arg Asn Ile 100
105 110 Leu Leu Ala Gln Gln Leu Phe Ala
Gly Leu Tyr Met Val Thr Leu Ala 115 120
125 Val Val Met Gly Cys Tyr Trp Gln Ala Lys Ala Pro Pro
Tyr Leu Phe 130 135 140
Pro Leu Leu Thr Leu Ser Lys Arg Leu His Ser Ile Phe Val Leu Arg145
150 155 160 Cys Phe Asn Asp Cys
Phe Ala Val Leu Phe Leu Trp Leu Ala Ile Phe 165
170 175 Phe Phe Gln Arg Arg Asn Trp Gln Ala Gly
Ala Leu Leu Tyr Thr Leu 180 185
190 Gly Leu Gly Val Lys Met Thr Leu Leu Leu Ser Leu Pro Ala Val
Gly 195 200 205 Ile
Val Leu Phe Leu Gly Ser Gly Ser Phe Val Thr Thr Leu Gln Leu 210
215 220 Val Ala Thr Met Gly Leu
Val Gln Ile Leu Ile Gly Val Pro Phe Leu225 230
235 240 Ala His Tyr Pro Thr Glu Tyr Leu Ser Arg Ala
Phe Glu Leu Ser Arg 245 250
255 Gln Phe Phe Phe Lys Trp Thr Val Asn Trp Arg Phe Val Gly Glu Glu
260 265 270 Ile Phe Leu
Ser Lys Gly Phe Ala Leu Thr Leu Leu Ala Leu His Val 275
280 285 Leu Val Leu Gly Ile Phe Ile Thr
Thr Arg Trp Ile Lys Pro Ala Arg 290 295
300 Lys Ser Leu Val Gln Leu Ile Ser Pro Val Leu Leu Ala
Gly Lys Pro305 310 315
320 Pro Leu Thr Val Pro Glu His Arg Ala Ala Ala Arg Asp Val Thr Pro
325 330 335 Arg Tyr Ile Met
Thr Thr Ile Leu Ser Ala Asn Ala Val Gly Leu Leu 340
345 350 Phe Ala Arg Ser Leu His Tyr Gln Phe
Tyr Ala Tyr Val Ala Trp Ser 355 360
365 Thr Pro Phe Leu Leu Trp Arg Ala Gly Leu His Pro Val Leu
Val Tyr 370 375 380
Leu Leu Trp Ala Val His Glu Trp Ala Trp Asn Val Phe Pro Ser Thr385
390 395 400 Pro Ala Ser Ser Ala
Val Val Val Gly Val Leu Gly Val Thr Val Ala 405
410 415 Gly Val Trp Phe Gly Ala Arg Glu Glu Trp
Glu Pro Gly Met Lys Ser 420 425
430 Ser Ser Lys Lys Glu Glu Ala Ala Met Arg 435
440 133413PRTAspergillus oryzae 133Met Glu Leu Lys His Phe
Ile His Glu Leu Cys Leu Asn Pro Arg His 1 5
10 15 Thr Lys Trp Ile Ala Pro Leu Leu Val Ile Gly
Asp Ala Phe Leu Cys 20 25 30
Ala Leu Ile Ile Trp Lys Ile Pro Tyr Thr Glu Ile Asp Trp Thr Thr
35 40 45 Tyr Met Gln
Gln Ile Ala Leu Tyr Ile Ser Gly Glu Arg Asp Tyr Thr 50
55 60 Leu Ile Lys Gly Ser Thr Gly Pro
Leu Val Tyr Pro Ala Ala His Val65 70 75
80 Tyr Ser Tyr Met Ala Leu Tyr His Leu Thr Asp Glu Gly
Arg Asp Ile 85 90 95
Leu Phe Gly Gln Ile Leu Phe Ala Val Leu Tyr Leu Val Thr Leu Ala
100 105 110 Val Val Met Val Cys
Tyr Arg Gln Ser Gly Ala Pro Pro Tyr Leu Phe 115
120 125 Pro Leu Leu Val Leu Ser Lys Arg Leu
His Ser Val Phe Val Leu Arg 130 135
140 Leu Phe Asn Asp Gly Leu Ala Val Cys Ala Met Trp Ile
Ala Ile Leu145 150 155
160 Leu Phe Gln Asn Lys Lys Trp Thr Ala Gly Val Thr Ala Trp Thr Val
165 170 175 Gly Val Gly Ile
Lys Met Thr Leu Leu Leu Leu Ala Pro Ala Ile Ala 180
185 190 Val Val Thr Val Leu Ser Leu Ser Leu
Val Pro Ser Ile Arg Leu Gly 195 200
205 Ile Leu Ala Leu Leu Ile Gln Val Leu Leu Ala Ile Pro Phe
Leu Gln 210 215 220
Gly Asn Pro Ile Gly Tyr Val Ala Arg Ala Phe Glu Leu Thr Arg Gln225
230 235 240 Phe Met Phe Lys Trp
Thr Val Asn Trp Arg Phe Val Gly Glu Asp Leu 245
250 255 Phe Leu Ser Lys Gln Phe Ser Leu Ala Leu
Leu Gly Leu His Ile Phe 260 265
270 Leu Leu Gly Leu Phe Val Thr Thr Gly Trp Leu Arg Pro Ser Gly
Ser 275 280 285 Asn
Val Pro Asp Phe Leu Arg Ser Leu Leu Gln Gly Arg Gln Arg Thr 290
295 300 Val Val Leu Ser Lys Ser
Phe Ile Met Thr Val Met Leu Thr Ser Leu305 310
315 320 Ala Ile Gly Leu Leu Cys Ala Arg Ser Leu His
Tyr Gln Phe Phe Ala 325 330
335 Tyr Leu Ser Trp Ala Thr Pro Cys Leu Leu Trp Arg Ala Arg Leu His
340 345 350 Pro Ile Leu
Ile Tyr Ala Ile Trp Ala Leu Gln Glu Trp Ala Trp Asn 355
360 365 Val Tyr Pro Ser Thr Asn Ala Ser
Ser Ser Val Val Val Phe Ser Leu 370 375
380 Ala Val Gln Val Phe Gly Val Leu Leu Asn Ser Arg Asn
Ala Leu Ser385 390 395
400 Asp Ala Pro Pro Arg Arg Lys Gly Lys Glu His Ile Gln
405 410 134411PRTNeosartorya fischeri 134Met
Asp Leu Lys His Thr Leu Arg Asp Leu Cys Met Asn Pro Arg His 1
5 10 15 Thr Arg Trp Val Ala Pro
Leu Leu Ile Leu Gly Asp Ala Val Leu Cys 20 25
30 Ala Leu Ile Ile Trp Lys Val Pro Tyr Thr Glu
Ile Asp Trp Thr Thr 35 40 45
Tyr Met Gln Gln Ile Ser Leu Tyr Ile Ser Gly Glu Arg Asp Tyr Thr
50 55 60 Leu Ile Lys
Gly Ser Thr Gly Pro Leu Val Tyr Pro Ala Ala His Val65 70
75 80 Tyr Ile Phe Asn Ile Leu Tyr His
Leu Thr Asp Glu Gly Arg Asp Ile 85 90
95 Phe Leu Gly Gln Ile Leu Phe Ala Ile Leu Tyr Leu Ala
Thr Leu Thr 100 105 110
Val Ala Met Thr Cys Tyr Arg Gln Ala Gly Ala Pro Pro Tyr Leu Leu
115 120 125 Val Pro Leu Val
Leu Ser Lys Arg Leu His Ser Val Phe Met Leu Arg 130
135 140 Leu Phe Asn Asp Gly Phe Ala Ala
Tyr Ala Met Trp Val Ser Ile Leu145 150
155 160 Leu Phe Met Asn Lys Lys Trp Thr Ala Gly Ala Ile
Val Trp Ser Thr 165 170
175 Gly Val Gly Ile Lys Met Thr Leu Leu Leu Leu Ala Pro Ala Ile Ala
180 185 190 Val Val Leu
Val Leu Ser Leu Ser Leu Gly Pro Ser Met Gln Leu Gly 195
200 205 Phe Leu Ala Val Leu Ile Gln Val
Leu Phe Gly Ile Pro Phe Leu Gln 210 215
220 Asn Asn Pro Ala Gly Tyr Val Ser Arg Ala Phe Glu Leu
Thr Arg Gln225 230 235
240 Phe Met Phe Lys Trp Thr Val Asn Trp Arg Phe Val Gly Glu Glu Leu
245 250 255 Phe Leu Ser Arg
Lys Phe Ser Leu Ala Leu Leu Ala Leu His Ile Leu 260
265 270 Leu Leu Gly Leu Phe Val Ala Thr Val
Trp Leu Lys Pro Ser Gly Ser 275 280
285 Asp Leu Pro Ser Phe Leu Gln Arg Leu Ile Gln Arg Arg Tyr
Arg Thr 290 295 300
Ala Ser Leu Ser Lys Ser Phe Ile Met Thr Ala Met Leu Ser Ser Leu305
310 315 320 Ala Ile Gly Leu Leu
Cys Ala Arg Ser Leu His Tyr Gln Phe Phe Ala 325
330 335 Tyr Leu Ala Cys Ala Thr Pro Phe Leu Leu
Trp Gln Ala Gly Phe His 340 345
350 Pro Ile Leu Val Tyr Val Val Trp Val Ala Gln Glu Trp Ala Trp
Asn 355 360 365 Thr
Tyr Pro Ser Thr Asn Ala Ser Ser Leu Val Val Ile Leu Ser Leu 370
375 380 Ala Ala Gln Val Phe Gly
Val Leu Gly Asn Ser Phe Ser Arg Lys His385 390
395 400 Leu Asp Gln Ser Ser Gln Lys Glu His Leu Gln
405 410 135413PRTAspergillus niger
135Met Asp Trp Met Arg Leu Ile Arg Asp Leu Cys Phe Asn Pro Arg His 1
5 10 15 Thr Lys Trp Met
Ala Pro Leu Leu Val Leu Gly Asp Ala Phe Leu Cys 20
25 30 Ala Leu Ile Ile Trp Lys Val Pro Tyr
Thr Glu Ile Asp Trp Ala Thr 35 40
45 Tyr Met Gln Gln Ile Ser Leu Tyr Leu Ser Gly Glu Arg Asp
Tyr Thr 50 55 60
Leu Ile Arg Gly Ser Thr Gly Pro Leu Val Tyr Pro Ala Ala His Val65
70 75 80 Tyr Ser Tyr Thr Ala
Leu Tyr His Leu Thr Asp Glu Gly Arg Asp Ile 85
90 95 Phe Phe Gly Gln Ile Leu Phe Ala Val Leu
Tyr Leu Ile Thr Leu Val 100 105
110 Val Val Leu Cys Cys Tyr Arg Gln Ser Gly Ala Pro Pro Tyr Leu
Leu 115 120 125 Pro
Leu Leu Val Leu Ser Lys Arg Leu His Ser Val Tyr Val Leu Arg 130
135 140 Leu Phe Asn Asp Gly Leu
Ala Ala Leu Ala Met Trp Val Ala Ile Leu145 150
155 160 Leu Phe Met Asn Arg Lys Trp Thr Ala Ala Val
Ala Val Trp Ser Thr 165 170
175 Gly Val Ala Ile Lys Met Thr Leu Leu Leu Leu Ala Pro Ala Ile Ala
180 185 190 Val Val Thr
Val Leu Ser Leu Ser Leu Gly Pro Ser Val Gly Leu Gly 195
200 205 Val Leu Ala Val Leu Val Gln Val
Leu Leu Ala Ile Pro Phe Leu Gln 210 215
220 Asn Asn Pro Ala Gly Tyr Leu Ser Arg Ala Phe Glu Leu
Thr Arg Gln225 230 235
240 Phe Met Phe Lys Trp Thr Val Asn Trp Arg Phe Val Gly Glu Glu Val
245 250 255 Phe Leu Ser Lys
Ser Phe Ser Leu Ala Leu Leu Ala Val His Ile Val 260
265 270 Leu Leu Gly Ala Phe Ala Val Thr Gly
Trp Leu Arg Tyr Ser Arg Ser 275 280
285 Ser Leu Pro Ala Phe Ile Arg Asn Leu Leu Ala Gly Arg His
Arg Thr 290 295 300
Val Ser Leu Pro Lys Pro Tyr Ile Met Ser Val Met Leu Ser Ser Leu305
310 315 320 Thr Val Gly Leu Leu
Cys Ala Arg Ser Leu His Tyr Gln Phe Phe Ala 325
330 335 Tyr Leu Ser Trp Ala Thr Pro Phe Leu Leu
Trp Arg Ala Gly Phe His 340 345
350 Pro Ile Leu Leu Tyr Leu Ile Trp Ala Met Gln Glu Trp Ala Trp
Asn 355 360 365 Thr
Phe Pro Ser Thr Asn Leu Ser Ser Ile Ile Val Val Leu Ser Leu 370
375 380 Ala Thr Gln Ser Phe Gly
Val Leu Ala Asn Ser Ala Ser Ala Phe Tyr385 390
395 400 Thr Met Arg Ser Asn Pro Ser Gly Lys Glu His
Asn Gln 405 410
136357PRTMagnaporthe oryzae 136Met Ala Ala Glu Arg Pro Ser Thr Leu Gly
Lys Pro Val Gln Phe Val 1 5 10
15 Phe Asp Val Ala Asn Gly Arg His Pro Leu Ser Arg Ala Ile Pro
Pro 20 25 30 Met
Leu Leu Ala Phe Asp Gly Leu Leu Cys Gly Leu Ile Ile Lys Lys 35
40 45 Val Pro Ser Cys Tyr Arg
Lys Ala Lys Val Pro Pro Tyr Val Leu Pro 50 55
60 Leu Leu Val Leu Ser Lys Arg Leu His Ser Ile
Phe Val Leu Arg Cys65 70 75
80 Phe Asn Asp Cys Phe Ala Val Leu Phe Phe Trp Leu Ala Ile Tyr Cys
85 90 95 Phe Gln Arg
Arg Ala Trp Ser Leu Gly Gly Val Phe Tyr Ser Phe Gly 100
105 110 Leu Gly Ile Lys Met Thr Val Leu
Leu Ser Leu Pro Ala Val Gly Val 115 120
125 Ile Leu Leu Leu Gly Arg Gly Phe Gly Gly Ala Leu Asn
Val Ala Ser 130 135 140
Ile Met Gly Gln Leu Gln Val Ala Ile Gly Leu Pro Phe Leu Ser Lys145
150 155 160 Asn Ala Trp Gly Tyr
Leu Ser Arg Ala Phe Glu Leu Ser Arg Gln Phe 165
170 175 Met Phe Lys Trp Thr Val Asn Trp Arg Phe
Val Gly Glu Glu Thr Phe 180 185
190 Leu Ser Lys Pro Phe Ala Ile Thr Leu Leu Ala Leu His Ala Ser
Val 195 200 205 Leu
Leu Ala Phe Val Thr Lys Arg Trp Leu Lys Pro Ala Ser Lys Ser 210
215 220 Ile Gly Gly Leu Ile Ala
Pro Leu Leu Ser Gly Arg Pro Ile Phe Thr225 230
235 240 Ala Glu Glu Ala Gln Thr Ala Ala Arg Ala Val
Thr Pro Glu Tyr Val 245 250
255 Met Thr Thr Met Leu Thr Ala Asn Ile Val Gly Met Leu Phe Ala Arg
260 265 270 Ser Leu His
Tyr Gln Phe Tyr Ala Tyr Leu Ala Trp Ser Thr Pro Tyr 275
280 285 Leu Leu Trp Arg Ser Gly Ile His
Pro Leu Leu Gln Trp Gly Leu Trp 290 295
300 Ala Leu Gln Glu Trp Ala Trp Asn Val Tyr Pro Ser Thr
Pro Val Ser305 310 315
320 Ser Gly Val Val Val Gly Val Met Ala Ile Thr Val Gly Ala Val Met
325 330 335 Val Gly Ala Lys
Ala Glu Phe Arg Pro Gln Val Pro Val Ala Lys Lys 340
345 350 Val Glu Ala Lys Arg 355
137406PRTSchizosaccharomyces pombe 137Met Ser Ser Val Glu Thr Arg Asn
Ser Phe Asn Pro Phe Arg Val Leu 1 5 10
15 Phe Asp Leu Gly Ser Tyr Gly Trp Leu His Pro Ser Arg
Leu Leu Leu 20 25 30
Leu Glu Ile Pro Phe Val Phe Ala Ile Ile Ser Lys Val Pro Tyr Thr
35 40 45 Glu Ile Asp Trp
Ile Ala Tyr Met Glu Gln Val Asn Ser Phe Leu Leu 50 55
60 Gly Glu Arg Asp Tyr Lys Ser Leu Val
Gly Cys Thr Gly Pro Leu Val65 70 75
80 Tyr Pro Gly Gly His Val Phe Leu Tyr Thr Leu Leu Tyr Tyr
Leu Thr 85 90 95
Asp Gly Gly Thr Asn Ile Val Arg Ala Gln Tyr Ile Phe Ala Phe Val
100 105 110 Tyr Trp Ile Thr Thr
Ala Ile Val Gly Tyr Leu Phe Lys Ile Val Arg 115
120 125 Ala Pro Phe Tyr Ile Tyr Val Leu Leu
Ile Leu Ser Lys Arg Leu His 130 135
140 Ser Ile Phe Ile Leu Arg Leu Phe Asn Asp Gly Phe Asn
Ser Leu Phe145 150 155
160 Ser Ser Leu Phe Ile Leu Ser Ser Cys Lys Lys Lys Trp Val Arg Ala
165 170 175 Ser Ile Leu Leu
Ser Val Ala Cys Ser Val Lys Met Ser Ser Leu Leu 180
185 190 Tyr Val Pro Ala Tyr Leu Val Leu Leu
Leu Gln Ile Leu Gly Pro Lys 195 200
205 Lys Thr Trp Met His Ile Phe Val Ile Ile Ile Val Gln Ile
Leu Phe 210 215 220
Ser Ile Pro Phe Leu Ala Tyr Phe Trp Ser Tyr Trp Thr Gln Ala Phe225
230 235 240 Asp Phe Gly Arg Ala
Phe Asp Tyr Lys Trp Thr Val Asn Trp Arg Phe 245
250 255 Ile Pro Arg Ser Ile Phe Glu Ser Thr Ser
Phe Ser Thr Ser Ile Leu 260 265
270 Phe Leu His Val Ala Leu Leu Val Ala Phe Thr Cys Lys His Trp
Asn 275 280 285 Lys
Leu Ser Arg Ala Thr Pro Phe Ala Met Val Asn Ser Met Leu Thr 290
295 300 Leu Lys Pro Leu Pro Lys
Leu Gln Leu Ala Thr Pro Asn Phe Ile Phe305 310
315 320 Thr Ala Leu Ala Thr Ser Asn Leu Ile Gly Ile
Leu Cys Ala Arg Ser 325 330
335 Leu His Tyr Gln Phe Tyr Ala Trp Phe Ala Trp Tyr Ser Pro Tyr Leu
340 345 350 Cys Tyr Gln
Ala Ser Phe Pro Ala Pro Ile Val Ile Gly Leu Trp Met 355
360 365 Leu Gln Glu Tyr Ala Trp Asn Val
Phe Pro Ser Thr Lys Leu Ser Ser 370 375
380 Leu Ile Ala Val Cys Val Pro Leu Ile Thr Ile Leu Lys
Leu Tyr Thr385 390 395
400 Ser Asp Tyr Arg Lys Pro 405 13830DNAArtificial
SequenceSynthesized Construct 138ggaggtgggg gcagtggagg tggcggcagt
301392460DNAArtificial SequenceSynthesized
Construct 139atgcgcttcc gaatctacaa gcggaaggtc ctcattctga cccttgtcgt
ggccgcttgc 60ggctttgttc tctggtccag caacggtcgc cagcgtaaga acgaggccct
ggcgcctccc 120ctcttggacg ccgaaccggc cagaggcgca ggtggcaggg gaggggatca
cccctcggtc 180gctgtcggca tccgccgcgt cagcaatgtg tccgccgcct ctctggtccc
ggcggttccg 240cagcctgagg cagacaacct cacgctgcgc taccgatcac tcgtgtatca
acttaacttc 300gaccagactc tgcggaacgt cgacaaggcc ggaacctggg ctccgcgtga
gttggtcctc 360gtcgttcagg tgcacaacag gcccgagtac ctccgcctcc tgctggattc
gcttcgaaag 420gcccagggca tcgacaacgt cctggtgatt ttcagccatg acttttggtc
cacagagatc 480aatcagctca ttgcgggtgt caacttttgc cccgtcttgc aagttttctt
ccctttctct 540atccaactct accccaacga gttcccgggc agtgaccccc gcgactgtcc
tcgggatctg 600ccaaaaaacg ccgctctcaa gctgggctgc atcaacgccg aataccccga
cagctttggc 660cactatcgcg aggccaagtt ctcgcagacg aagcaccact ggtggtggaa
gctccatttt 720gtctgggagc gagtgaagat ccttcgtgat tacgcaggac tcattctgtt
cttggaagag 780gaccactacc tggccccgga cttctaccac gtctttaaga agatgtggaa
gctcaagcag 840caggaatgcc ccgagtgcga cgttctgtcc cttggcacct atagcgcgtc
ccgctcgttc 900tacggtatgg ctgacaaggt cgatgtgaaa acctggaagt caactgagca
caatatgggc 960ctcgccctga cgaggaacgc ctaccagaaa ctcatcgagt gtaccgacac
cttctgcacg 1020tacgacgact ataactggga ttggacactg cagtacttga ctgtcagctg
cctccctaag 1080ttttggaagg tccttgttcc ccagatcccg agaattttcc atgctggcga
ctgcgggatg 1140caccacaaga aaacctgtcg cccatccacg cagtctgccc aaatcgagtc
gctcctgaac 1200aacaacaagc agtacatgtt ccccgagaca ctgaccatta gcgagaagtt
tacggtcgtg 1260gcgatctccc cgcctcgaaa gaatggcggc tggggtgaca tccgcgatca
cgagctgtgc 1320aagtcttacc gccggctcca gggaggtggg ggcagtggag gtggcggcag
tgggagggtg 1380cccaccgccg cccctcccgc ccagccgcgt gtgcctgtga cccccgcgcc
ggcggtgatt 1440cccatcctgg tcatcgcctg tgaccgcagc actgttcggc gctgcctgga
caagctgctg 1500cattatcggc cctcggctga gctcttcccc atcatcgtca gccaggactg
cgggcacgag 1560gagacggccc aggccatcgc ctcctacggc agcgcggtca cgcacatccg
gcagcccgac 1620ctgagcagca ttgcggtgcc gccggaccac cgcaagttcc agggctacta
caagatcgcg 1680cgccactacc gctgggcgct gggccaggtc ttccggcagt ttcgcttccc
cgccgccgtg 1740gtggtggagg atgacctgga ggtggccccg gacttcttcg agtactttcg
ggccacctat 1800ccgctgctga aggccgaccc ctccctgtgg tgcgtctcgg cctggaatga
caacggcaag 1860gagcagatgg tggacgccag caggcctgag ctgctctacc gcaccgactt
tttccctggc 1920ctgggctggc tgctgttggc cgagctctgg gctgagctgg agcccaagtg
gccaaaggcc 1980ttctgggacg actggatgcg gcggccggag cagcggcagg ggcgggcctg
catccgccct 2040gagatctcaa gaacgatgac ctttggccgc aagggtgtga gccacgggca
gttctttgac 2100cagcacctca agttcatcaa gctgaaccag cagtttgtgc acttcaccca
gctggacctg 2160tcttacctgc agcgggaggc ctatgaccga gatttcctcg cccgcgtcta
cggtgctccc 2220cagctgcagg tggagaaagt gaggaccaat gaccggaagg agctggggga
ggtgcgggtg 2280cagtacacgg gcagggacag cttcaaggct ttcgccaagg ctctgggtgt
catggatgac 2340ctcaagtcgg gggttccgag agctggctac cggggcattg tcaccttcca
gttccggggc 2400cgccgtgtcc acctggcgcc cccaccgacg tgggagggct atgatcccag
ctggaattag 246014045DNAArtificial SequenceSynthesized Construct
140ggaggtgggg gcagtggagg tggcggcagt ggcggcggtg gaagt
451412475DNAArtificial SequenceSynthesized Construct 141atgcgcttcc
gaatctacaa gcggaaggtc ctcattctga cccttgtcgt ggccgcttgc 60ggctttgttc
tctggtccag caacggtcgc cagcgtaaga acgaggccct ggcgcctccc 120ctcttggacg
ccgaaccggc cagaggcgca ggtggcaggg gaggggatca cccctcggtc 180gctgtcggca
tccgccgcgt cagcaatgtg tccgccgcct ctctggtccc ggcggttccg 240cagcctgagg
cagacaacct cacgctgcgc taccgatcac tcgtgtatca acttaacttc 300gaccagactc
tgcggaacgt cgacaaggcc ggaacctggg ctccgcgtga gttggtcctc 360gtcgttcagg
tgcacaacag gcccgagtac ctccgcctcc tgctggattc gcttcgaaag 420gcccagggca
tcgacaacgt cctggtgatt ttcagccatg acttttggtc cacagagatc 480aatcagctca
ttgcgggtgt caacttttgc cccgtcttgc aagttttctt ccctttctct 540atccaactct
accccaacga gttcccgggc agtgaccccc gcgactgtcc tcgggatctg 600ccaaaaaacg
ccgctctcaa gctgggctgc atcaacgccg aataccccga cagctttggc 660cactatcgcg
aggccaagtt ctcgcagacg aagcaccact ggtggtggaa gctccatttt 720gtctgggagc
gagtgaagat ccttcgtgat tacgcaggac tcattctgtt cttggaagag 780gaccactacc
tggccccgga cttctaccac gtctttaaga agatgtggaa gctcaagcag 840caggaatgcc
ccgagtgcga cgttctgtcc cttggcacct atagcgcgtc ccgctcgttc 900tacggtatgg
ctgacaaggt cgatgtgaaa acctggaagt caactgagca caatatgggc 960ctcgccctga
cgaggaacgc ctaccagaaa ctcatcgagt gtaccgacac cttctgcacg 1020tacgacgact
ataactggga ttggacactg cagtacttga ctgtcagctg cctccctaag 1080ttttggaagg
tccttgttcc ccagatcccg agaattttcc atgctggcga ctgcgggatg 1140caccacaaga
aaacctgtcg cccatccacg cagtctgccc aaatcgagtc gctcctgaac 1200aacaacaagc
agtacatgtt ccccgagaca ctgaccatta gcgagaagtt tacggtcgtg 1260gcgatctccc
cgcctcgaaa gaatggcggc tggggtgaca tccgcgatca cgagctgtgc 1320aagtcttacc
gccggctcca gggaggtggg ggcagtggag gtggcggcag tggaggtggc 1380ggcagtggga
gggtgcccac cgccgcccct cccgcccagc cgcgtgtgcc tgtgaccccc 1440gcgccggcgg
tgattcccat cctggtcatc gcctgtgacc gcagcactgt tcggcgctgc 1500ctggacaagc
tgctgcatta tcggccctcg gctgagctct tccccatcat cgtcagccag 1560gactgcgggc
acgaggagac ggcccaggcc atcgcctcct acggcagcgc ggtcacgcac 1620atccggcagc
ccgacctgag cagcattgcg gtgccgccgg accaccgcaa gttccagggc 1680tactacaaga
tcgcgcgcca ctaccgctgg gcgctgggcc aggtcttccg gcagtttcgc 1740ttccccgccg
ccgtggtggt ggaggatgac ctggaggtgg ccccggactt cttcgagtac 1800tttcgggcca
cctatccgct gctgaaggcc gacccctccc tgtggtgcgt ctcggcctgg 1860aatgacaacg
gcaaggagca gatggtggac gccagcaggc ctgagctgct ctaccgcacc 1920gactttttcc
ctggcctggg ctggctgctg ttggccgagc tctgggctga gctggagccc 1980aagtggccaa
aggccttctg ggacgactgg atgcggcggc cggagcagcg gcaggggcgg 2040gcctgcatcc
gccctgagat ctcaagaacg atgacctttg gccgcaaggg tgtgagccac 2100gggcagttct
ttgaccagca cctcaagttc atcaagctga accagcagtt tgtgcacttc 2160acccagctgg
acctgtctta cctgcagcgg gaggcctatg accgagattt cctcgcccgc 2220gtctacggtg
ctccccagct gcaggtggag aaagtgagga ccaatgaccg gaaggagctg 2280ggggaggtgc
gggtgcagta cacgggcagg gacagcttca aggctttcgc caaggctctg 2340ggtgtcatgg
atgacctcaa gtcgggggtt ccgagagctg gctaccgggg cattgtcacc 2400ttccagttcc
ggggccgccg tgtccacctg gcgcccccac cgacgtggga gggctatgat 2460cccagctgga
attag
247514257DNATrichoderma reesei 142agcaccggca accctagcgg cggcaaccct
cccggcggaa acccgcctgg cagcacc 571432487DNAArtificial
SequenceSynthesized Construct 143atgcgcttcc gaatctacaa gcggaaggtc
ctcattctga cccttgtcgt ggccgcttgc 60ggctttgttc tctggtccag caacggtcgc
cagcgtaaga acgaggccct ggcgcctccc 120ctcttggacg ccgaaccggc cagaggcgca
ggtggcaggg gaggggatca cccctcggtc 180gctgtcggca tccgccgcgt cagcaatgtg
tccgccgcct ctctggtccc ggcggttccg 240cagcctgagg cagacaacct cacgctgcgc
taccgatcac tcgtgtatca acttaacttc 300gaccagactc tgcggaacgt cgacaaggcc
ggaacctggg ctccgcgtga gttggtcctc 360gtcgttcagg tgcacaacag gcccgagtac
ctccgcctcc tgctggattc gcttcgaaag 420gcccagggca tcgacaacgt cctggtgatt
ttcagccatg acttttggtc cacagagatc 480aatcagctca ttgcgggtgt caacttttgc
cccgtcttgc aagttttctt ccctttctct 540atccaactct accccaacga gttcccgggc
agtgaccccc gcgactgtcc tcgggatctg 600ccaaaaaacg ccgctctcaa gctgggctgc
atcaacgccg aataccccga cagctttggc 660cactatcgcg aggccaagtt ctcgcagacg
aagcaccact ggtggtggaa gctccatttt 720gtctgggagc gagtgaagat ccttcgtgat
tacgcaggac tcattctgtt cttggaagag 780gaccactacc tggccccgga cttctaccac
gtctttaaga agatgtggaa gctcaagcag 840caggaatgcc ccgagtgcga cgttctgtcc
cttggcacct atagcgcgtc ccgctcgttc 900tacggtatgg ctgacaaggt cgatgtgaaa
acctggaagt caactgagca caatatgggc 960ctcgccctga cgaggaacgc ctaccagaaa
ctcatcgagt gtaccgacac cttctgcacg 1020tacgacgact ataactggga ttggacactg
cagtacttga ctgtcagctg cctccctaag 1080ttttggaagg tccttgttcc ccagatcccg
agaattttcc atgctggcga ctgcgggatg 1140caccacaaga aaacctgtcg cccatccacg
cagtctgccc aaatcgagtc gctcctgaac 1200aacaacaagc agtacatgtt ccccgagaca
ctgaccatta gcgagaagtt tacggtcgtg 1260gcgatctccc cgcctcgaaa gaatggcggc
tggggtgaca tccgcgatca cgagctgtgc 1320aagtcttacc gccggctcca gagcaccggc
aaccctagcg gcggcaaccc tcccggcgga 1380aacccgcctg gcagcaccgg gagggtgccc
accgccgccc ctcccgccca gccgcgtgtg 1440cctgtgaccc ccgcgccggc ggtgattccc
atcctggtca tcgcctgtga ccgcagcact 1500gttcggcgct gcctggacaa gctgctgcat
tatcggccct cggctgagct cttccccatc 1560atcgtcagcc aggactgcgg gcacgaggag
acggcccagg ccatcgcctc ctacggcagc 1620gcggtcacgc acatccggca gcccgacctg
agcagcattg cggtgccgcc ggaccaccgc 1680aagttccagg gctactacaa gatcgcgcgc
cactaccgct gggcgctggg ccaggtcttc 1740cggcagtttc gcttccccgc cgccgtggtg
gtggaggatg acctggaggt ggccccggac 1800ttcttcgagt actttcgggc cacctatccg
ctgctgaagg ccgacccctc cctgtggtgc 1860gtctcggcct ggaatgacaa cggcaaggag
cagatggtgg acgccagcag gcctgagctg 1920ctctaccgca ccgacttttt ccctggcctg
ggctggctgc tgttggccga gctctgggct 1980gagctggagc ccaagtggcc aaaggccttc
tgggacgact ggatgcggcg gccggagcag 2040cggcaggggc gggcctgcat ccgccctgag
atctcaagaa cgatgacctt tggccgcaag 2100ggtgtgagcc acgggcagtt ctttgaccag
cacctcaagt tcatcaagct gaaccagcag 2160tttgtgcact tcacccagct ggacctgtct
tacctgcagc gggaggccta tgaccgagat 2220ttcctcgccc gcgtctacgg tgctccccag
ctgcaggtgg agaaagtgag gaccaatgac 2280cggaaggagc tgggggaggt gcgggtgcag
tacacgggca gggacagctt caaggctttc 2340gccaaggctc tgggtgtcat ggatgacctc
aagtcggggg ttccgagagc tggctaccgg 2400ggcattgtca ccttccagtt ccggggccgc
cgtgtccacc tggcgccccc accgacgtgg 2460gagggctatg atcccagctg gaattag
248714465DNATrichoderma reesei
144agctccgccg cgacggccac cgccagcgcc actgttcctg gaggcggtag cggccccacc
60agcgg
651452493DNAArtificial SequenceSynthesized Construct 145atgcgcttcc
gaatctacaa gcggaaggtc ctcattctga cccttgtcgt ggccgcttgc 60ggctttgttc
tctggtccag caacggtcgc cagcgtaaga acgaggccct ggcgcctccc 120ctcttggacg
ccgaaccggc cagaggcgca ggtggcaggg gaggggatca cccctcggtc 180gctgtcggca
tccgccgcgt cagcaatgtg tccgccgcct ctctggtccc ggcggttccg 240cagcctgagg
cagacaacct cacgctgcgc taccgatcac tcgtgtatca acttaacttc 300gaccagactc
tgcggaacgt cgacaaggcc ggaacctggg ctccgcgtga gttggtcctc 360gtcgttcagg
tgcacaacag gcccgagtac ctccgcctcc tgctggattc gcttcgaaag 420gcccagggca
tcgacaacgt cctggtgatt ttcagccatg acttttggtc cacagagatc 480aatcagctca
ttgcgggtgt caacttttgc cccgtcttgc aagttttctt ccctttctct 540atccaactct
accccaacga gttcccgggc agtgaccccc gcgactgtcc tcgggatctg 600ccaaaaaacg
ccgctctcaa gctgggctgc atcaacgccg aataccccga cagctttggc 660cactatcgcg
aggccaagtt ctcgcagacg aagcaccact ggtggtggaa gctccatttt 720gtctgggagc
gagtgaagat ccttcgtgat tacgcaggac tcattctgtt cttggaagag 780gaccactacc
tggccccgga cttctaccac gtctttaaga agatgtggaa gctcaagcag 840caggaatgcc
ccgagtgcga cgttctgtcc cttggcacct atagcgcgtc ccgctcgttc 900tacggtatgg
ctgacaaggt cgatgtgaaa acctggaagt caactgagca caatatgggc 960ctcgccctga
cgaggaacgc ctaccagaaa ctcatcgagt gtaccgacac cttctgcacg 1020tacgacgact
ataactggga ttggacactg cagtacttga ctgtcagctg cctccctaag 1080ttttggaagg
tccttgttcc ccagatcccg agaattttcc atgctggcga ctgcgggatg 1140caccacaaga
aaacctgtcg cccatccacg cagtctgccc aaatcgagtc gctcctgaac 1200aacaacaagc
agtacatgtt ccccgagaca ctgaccatta gcgagaagtt tacggtcgtg 1260gcgatctccc
cgcctcgaaa gaatggcggc tggggtgaca tccgcgatca cgagctgtgc 1320aagtcttacc
gccggctcca gagctccgcc gcgacggcca ccgccagcgc cactgttcct 1380ggaggcggta
gcggcccgac cagcgggagg gtgcccaccg ccgcccctcc cgcccagccg 1440cgtgtgcctg
tgacccccgc gccggcggtg attcccatcc tggtcatcgc ctgtgaccgc 1500agcactgttc
ggcgctgcct ggacaagctg ctgcattatc ggccctcggc tgagctcttc 1560cccatcatcg
tcagccagga ctgcgggcac gaggagacgg cccaggccat cgcctcctac 1620ggcagcgcgg
tcacgcacat ccggcagccc gacctgagca gcattgcggt gccgccggac 1680caccgcaagt
tccagggcta ctacaagatc gcgcgccact accgctgggc gctgggccag 1740gtcttccggc
agtttcgctt ccccgccgcc gtggtggtgg aggatgacct ggaggtggcc 1800ccggacttct
tcgagtactt tcgggccacc tatccgctgc tgaaggccga cccctccctg 1860tggtgcgtct
cggcctggaa tgacaacggc aaggagcaga tggtggacgc cagcaggcct 1920gagctgctct
accgcaccga ctttttccct ggcctgggct ggctgctgtt ggccgagctc 1980tgggctgagc
tggagcccaa gtggccaaag gccttctggg acgactggat gcggcggccg 2040gagcagcggc
aggggcgggc ctgcatccgc cctgagatct caagaacgat gacctttggc 2100cgcaagggtg
tgagccacgg gcagttcttt gaccagcacc tcaagttcat caagctgaac 2160cagcagtttg
tgcacttcac ccagctggac ctgtcttacc tgcagcggga ggcctatgac 2220cgagatttcc
tcgcccgcgt ctacggtgct ccccagctgc aggtggagaa agtgaggacc 2280aatgaccgga
aggagctggg ggaggtgcgg gtgcagtaca cgggcaggga cagcttcaag 2340gctttcgcca
aggctctggg tgtcatggat gacctcaagt cgggggttcc gagagctggc 2400taccggggca
ttgtcacctt ccagttccgg ggccgccgtg tccacctggc gcccccaccg 2460acgtgggagg
gctatgatcc cagctggaat tag
249314645DNAArtificial SequenceSynthesized Construct 146ggtaccgggc
ccactgcgca tcatgcgctt ccgaatctac aagcg
4514738DNAArtificial SequenceSynthesized Construct 147ggcgcgccac
tagtctaatt ccagctggga tcatagcc 38
User Contributions:
Comment about this patent or add new information about this topic: