Patent application title: HIV Antigens and Antibodies
Inventors:
M. Scott Killian (San Francisco, CA, US)
Evelin Szakal (San Francisco, CA, US)
Girish N. Vyas (San Francisco, CA, US)
IPC8 Class: AC07K1610FI
USPC Class:
4241351
Class name: Immunoglobulin, antiserum, antibody, or antibody fragment, except conjugate or complex of the same with nonimmunoglobulin material structurally-modified antibody, immunoglobulin, or fragment thereof (e.g., chimeric, humanized, cdr-grafted, mutated, etc.) single chain antibody
Publication date: 2016-01-07
Patent application number: 20160002319
Abstract:
The present invention relates to a method for reducing the occurance
and/or severity of viral infections. The method embodies procedures for
expanding HIV from the blood of HIV antibody negative donors and deriving
a non-infectious virus particle product that is antigenic. The procedures
for deriving the antigenic, non-infectious virus particle product are
optimally designed to maintain the integrity of the envelope proteins
while maximizing the depletion of capsid proteins and RNA. The resulting
virus particle product, when introduced into humans or non-human animals,
enables the production of antibodies that target the natural envelope
macromolecular structure that is required for infectivity. The present
invention can be applied to producing virus stocks from the blood of
HIV-seronegative donors, for deriving non-infectious virus particles that
retain intact envelope proteins, for producing anti-viral antibodies, and
for administering anti-virus antibodies to patients.Claims:
1. A composition of matter comprising isolated antigen binding proteins
(ABPs), wherein said isolated ABPs selectively bind to an epitope on an
HIV-1 trimeric envelope glycoprotein subunit (TEGS).
2. The composition of matter of claim 1, wherein said TEGS is prepared by a process comprising: obtaining infectious HIV-1 virus particles from human CD4+ cell culture grown in serum-free media; contacting said infectious HIV-1 virus particles with agents that selectively remove from said particle viral RNA and viral capsid protein while retaining viral envelope protein in a non-denatured conformation, wherein said agents do not chemically fix or cross-link said envelope protein; and isolating protein from said contacted infectious HIV-1 virus particles wherein said isolated protein comprises non-infectious complexes comprising a trimeric envelope glycoprotein subunit, said subunit comprising HIV-1 envelope, gp120, and gp41 proteins that are not chemically fixed or cross-linked and substantially free of HIV-1 capsid protein, reverse transcriptase and RNA.
3. The composition of matter of claim 2, wherein said infectious HIV-1 virus particles are Fiebig I/II isolates or founder virus.
4. The composition of matter of any of claims 2-3, wherein said agents comprise cyclodextrin.
5. The composition of matter of any of claims 1-4, wherein said ABPs neutralize infectious HIV-1 particles.
6. The composition of matter of any of claims 1-5, wherein said ABPs neutralize infectious HIV-1 particles from at least one HIV-1 R5 strain and at least one HIV-1 X4 strain.
7. The composition of matter of any of claims 1-6, wherein said ABPs compete in binding to TEGS with a reference antibody or antibody fragment comprising a heavy chain CDR selected from the group consisting of SEQ ID NO: 1 SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 21, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 41, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 49, SEQ ID NO: 51, SEQ ID NO: 53, SEQ ID NO: 55, SEQ ID NO: 57, SEQ ID NO: 59, SEQ ID NO: 61, SEQ ID NO: 63, SEQ ID NO: 65, SEQ ID NO: 67, SEQ ID NO: 69, SEQ ID NO: 71, and SEQ ID NO: 73, and a light chain CDR selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:44, SEQ ID NO:46, SEQ ID NO:48, SEQ ID NO:50, SEQ ID NO:52, SEQ ID NO:54, SEQ ID NO:56, SEQ ID NO:58, SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:64, SEQ ID NO:66, SEQ ID NO:68, SEQ ID NO:70, SEQ ID NO:72, and SEQ ID NO:74.
8. The composition of matter of any of claims 1-6, wherein said ABPs compete in binding to TEGS with a reference antibody or antibody fragment having a nucleotide sequence selected from the group consisting of: SEQ ID NO:75, SEQ ID NO:76, SEQ ID NO:77, SEQ ID NO:78, SEQ ID NO:79, SEQ ID NO:80, SEQ ID NO:81, SEQ ID NO:82, SEQ ID NO:83, SEQ ID NO:84, SEQ ID NO:85, SEQ ID NO:86, SEQ ID NO:87, SEQ ID NO:88, SEQ ID NO:89, SEQ ID NO:90, SEQ ID NO:91, SEQ ID NO:92, SEQ ID NO:93, SEQ ID NO:94, SEQ ID NO:95, SEQ ID NO:96, SEQ ID NO:97, SEQ ID NO:98, SEQ ID NO:99, SEQ ID NO:100, SEQ ID NO:101, SEQ ID NO:102, SEQ ID NO:103, SEQ ID NO:104, SEQ ID NO:105, SEQ ID NO:106, SEQ ID NO:107, SEQ ID NO:108, SEQ ID NO:109, SEQ ID NO:110, SEQ ID NO:111, and SEQ ID NO:112.
9. The composition of matter of any of claims 1-6, wherein said ABPs compete in binding to TEGS with a reference antibody or antibody fragment having a nucleotide sequence comprising at least a portion of one of the SEQ ID NOs in Table 2.
10. The composition of matter of claim 7, wherein said reference antibody or antibody fragment is selected from the group consisting of: recombinant antibody, chimeric antibody, humanized antibody, single-chain antibody, synthetic antibody, CF antibody and fragments thereof.
11. The composition of matter according to any of claims 1-10, wherein said ABPs are selected from the group consisting of: monoclonal antibody, antibody fragment, recombinant antibody, chimeric antibody, humanized antibody, single-chain antibody, synthetic antibody, CF antibody and fragments thereof.
12. The composition of matter according to any of claims 1-10, wherein said ABPs are polyclonal antibodies.
13. The composition of matter of claim 12, wherein said ABPs are human polyclonal antibodies.
14. The composition of matter of claim 1, wherein said ABPs are bispecific antibodies.
15. The composition of matter according to any of claims 1-14, wherein said ABPs are derived from a phage display.
16. An immunotherapeutic method comprising administering to a subject a therapeutic amount of said composition of matter of any of claims 1-12.
17. A method of producing said composition of matter of claim 1, said method comprising: obtaining a sequence of said ABPs; and synthesizing said ABPs based on said obtained sequence, said synthesis occurring in a cell-free protein expression system.
18. A method for preparing a non-infectious antigenic composition capable of producing neutralizing HIV-1 antibodies comprising: obtaining infectious HIV-1 virus particles from human CD4+ cell-culture grown in serum-free media; contacting said infectious HIV-1 virus particles with agents that selectively remove from said particle viral RNA and viral capsid protein while retaining viral envelope protein in a non-denatured conformation, wherein said agents do not chemically fix or cross-link said envelope protein; and isolating protein from said contacted infectious HIV-1 virus particles wherein said isolated protein comprises non-infectious complexes comprising a trimeric envelope glycoprotein subunit, said subunit comprising HIV-1 envelope, gp120, and gp41 proteins that are not chemically fixed or cross-linked and substantially free of HIV-1 capsid protein, reverse transcriptase and RNA.
19. The method of claim 18, wherein said infectious HIV-1 virus particles are Fiebig I/II isolates or founder virus.
20. The method of any of claims 18-19, wherein said agents comprise cyclodextrin.
21. An antigenic composition produced according to said method of any one of claims 18-20.
22. An antigenic composition capable of producing neutralizing HIV-1 antibodies comprising a non-infectious HIV-1 trimeric envelope glycoprotein subunit, said subunit comprising HIV-1 envelope, gp120, and gp41 proteins that are not chemically fixed or cross-linked and substantially free of HIV-1 capsid protein, reverse transcriptase and RNA, wherein said composition is substantially free of serum proteins.
23. The antigenic composition of claim 22 that is capable of eliciting antibodies that neutralizes infectious HIV-1 particles.
24. The antigenic composition of claim 22 that is capable of eliciting antibodies that neutralizes infectious HIV-1 particles from at least one HIV-1 R5 strain and at least one HIV-1 X4 strain.
25. The antigenic composition of claim 22, wherein said antigenic composition is capable of detecting in an immunoassay anti-TEGS antibodies in serum from an animal immunized with said composition.
26. A method comprising administering an amount of said antigenic composition of any of claims 22-24 to a subject wherein a neutralizing HIV-1 antibody is produced.
27. The method of claim 26, wherein said subject is non-human.
28. The method of claim 26, wherein said subject is human.
29. The method of claim 28, wherein said human subject has a homozygous deletion of 32 base pairs in a gene encoding CCR5 coreceptor for HIV-1.
30. The method of any of claims 26-29, further comprising recovering polyclonal antibodies from said subject wherein said polyclonal antibodies neutralize HIV-1.
31. The method of any of claims 26-29, further comprising preparing a cell line comprising B cells isolated from said subject, and said cell line producing neutralizing HIV-1 antibody.
32. The method of claim 31, wherein said cell line is a hybridoma, and further comprising growing said hybridoma in cell culture, and recovering a neutralizing HIV-1 antibody from said cell culture.
33. The method of claim 31, wherein said cell line is a hybridoma, and further comprising isolating therefrom a nucleic acid encoding at least one CDR from a gene encoding a neutralizing HIV-1 antibody.
34. The method of claim 31, wherein said cell line comprises immortalized cells or transformed cells.
35. A method of producing ABPs that neutralize HIV-1, comprising culturing a cell comprising a gene encoding at least part of said ABPs under conditions wherein said gene is expressed and said ABPs are recovered.
36. The method of claim 35, wherein said gene comprises at least one CDR having a sequence obtained from a nucleic acid isolated according to claim 33.
37. The method of claim 35, wherein said ABP is selected from the group consisting of: chimeric antibody, humanized antibody, single-chain antibody, and fragments thereof.
38. In an immunoassay method for the detection of anti-HIV-1 antibodies, the improvement comprising using at least one antigen therein which is an HIV-1 trimeric envelope glycoprotein subunit isolated from an immunogenic composition according to any of claims 21-24.
39. An immunoassay method according to claim 38, wherein said antigen is bound to an immunoassay support.
40. An immunoassay method according to claim 38, wherein said antigen is in solution.
41. An immunoassay method according to claim 40, wherein said antigen comprises a detectable label.
42. A method for preparing an immunogenic, inactivated virus composition, comprising: obtaining an infectious virus particle, said particle comprising RNA, an envelope protein, a capsid protein, a reverse transcriptase, a gp120 protein, and a gp41 protein; and contacting said infectious virus particle with agents that selectively remove from said particle said RNA and said capsid protein and said reverse transcriptase, while retaining said envelope protein in a non-denatured conformation, wherein said agents do not chemically fix or cross-link said envelope protein, thereby producing an immunogenic, inactivated virus composition.
43. The method of claim 42, wherein said immunogenic, inactivated virus composition comprises a trimeric envelope glycoprotein subunit (TEGS), said subunit comprising said envelope, said gp120, and said gp41 proteins.
44. The method of claim 42, wherein said infectious virus particle is a Fiebig I/II isolate or transmitted founder virus.
45. The method of claim 42, wherein said infectious virus particle is obtained from a mammalian subject that lacks antibodies against said infectious virus particle.
46. The method of claim 45, wherein said infectious virus particle is selected from the group consisting of an HIV particle, an FIV particle, and an EIAV particle.
47. The method of claim 46, wherein said infectious virus particle is an HIV particle.
48. The method of claim 44, wherein said infectious virus particle comprises an HIV-1 or an HIV-2 particle.
49. The method of claim 42, wherein said agents comprise cyclodextrin
50. The method of claim 42, wherein said agents comprise Benzonase.
51. The method of any one of claims 42-49, wherein said infectious virus particle comprises a plurality of distinct HIV isolates.
52. The method of claim 51, wherein said distinct HIV isolates are selected from the group consisting of distinct HIV types, distinct HIV groups, and distinct HIV clades.
53. The method of claim 43, wherein said preparation of said TEGS further comprises: obtaining a DNA sequence of said TEGS; cloning said DNA sequence into an expression vector; and expressing said cloned DNA sequence to obtain TEGS proteins.
54. A product produced according to said method of any one of claims 42-52.
55. The product of claim 54, wherein said product is capable of eliciting antibodies against said trimeric envelope glycoproteins in a mammalian subject inoculated with said product.
56. The product of claim 55, wherein said antibodies are virus neutralizing antibodies
57. A method of quantifying antibodies present in a sample from a subject, comprising: contacting said sample with said product of claim 54, and determining said specific binding of antibodies in said sample to said product.
58. A method of generating an immune response in a subject, comprising: administering an immunogenic amount of said product of claim 54 to said subject.
59. The method of claim 58, wherein said subject is genetically resistant to viral infection.
60. The method of claim 58, wherein said subject is receiving antiretroviral therapy.
61. The method of claim 58, wherein said immune response comprises a neutralizing response against said infectious virus particle.
62. A method of generating an antibody, comprising: administering to a subject an immunogenic amount of said product of claim 54, and isolating said antibody, wherein said antibody specifically binds to said product of claim 54.
63. A method of generating a monoclonal antibody, comprising: administering to a subject an immunogenic amount of said product of claim 54; producing a hybridoma using B cells isolated from said immunized subject, wherein said hybridoma produces a monoclonal antibody that specifically binds to said product of claim 54; and isolating said monoclonal antibody.
64. A monoclonal antibody that specifically binds to said product of claim 54.
65. The monoclonal antibody of claim 64, wherein said antibody is capable of neutralizing in vivo said infectious virus particle.
66. A polyclonal antibody preparation that specifically binds to said product of claim 54.
67. The polyclonal antibody preparation of claim 66, wherein said antibody preparation is capable of neutralizing in vivo said infectious virus particle.
68. An immunotherapeutic method, comprising administering to a subject a therapeutic amount of said monoclonal antibody of any of claims 64-67.
Description:
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of U.S. Provisional Application No. 61/770,974, filed Feb. 28, 2013. The entire teachings of these applications are incorporated herein by reference for all purposes.
BACKGROUND OF THE INVENTION
[0002] 1. Field of the Invention
[0003] The present invention relates to novel HIV-1 antigenic compositions that can be used to produce antibodies that neutralize multiple strains of HIV-1, the use of such antigenic compositions to induce an immune response in a subject, and the use of such antibodies in prophylactic and therapeutic methods.
[0004] 2. Description of the Related Art
[0005] Acquired immune deficiency syndrome (AIDS) is a life-threatening clinical condition caused by infection with the Human Immunodeficiency Virus 1 (HIV-1) (Killian M S, Levy J A, European Journal of Immunology 2011, 41: 3401-3411). AIDS was first described in a set of unusual clinical cases the early 1980s and its causative agent was identified shortly thereafter. Since then, major efforts have been made to develop therapies and vaccines for HIV/AIDS. To date, clinically beneficial antiretroviral drugs have been developed that delay the onset of AIDS, but an effective vaccine remains elusive, as do immune-based therapies and a cure for the infection.
[0006] Importantly, the current standard treatment of care for HIV-infected individuals has significant limitations (Reust C E, American Family Physician 2011, 83: 1443-1451). The clinically approved antiretroviral drugs require daily life-long application; non-adherence is common. They do not cure HIV-1 infection. Drug-resistant HIV-1 strains can emerge in the presence of antiretroviral drugs. Numerous toxicities caused by the long-term usage of antiretroviral drugs have been reported. HIV-1-infected individuals can progress to AIDS while receiving antiretroviral medication. Antiretroviral drugs are expensive and their monitored administration poses a difficult challenge in many parts of the world.
[0007] HIV-1 infection creates significant challenges for the development of a vaccine and immune-based therapies (Q Yu et al., Cellular and Molecular Immunology 2010, 7: 334-340). Unlike many other viruses that infect humans, HIV permanently integrates its viral nucleic acid genome into host cell chromosomes. Following the initial (acute) infection, HIV-1 spreads throughout the host while its genetic composition mutates at a high rate. Thus, vaccines and other immune-based clinical interventions must be effective against a variety of HIV-1 strains or genetic variants. Therefore, a necessary feature of an effective vaccine for HIV/AIDS is the ability to elicit broadly neutralizing antibodies (BNAb), or antibodies that target genetically distinct HIV-1 strains.
[0008] Among the proteins expressed by HIV-1, the envelope (Env) proteins are displayed on the surface of the virus, enable the virus to attach to host cells, and are indispensible for infectivity (Q Yu et al., Cellular and Molecular Immunology 2010, 7: 334-340). The HIV-1 genome encodes a single envelope nucleic acid sequence that is transcribed and translated as two glycoproteins: a transmembrane gp41 (˜41 kDa) and an external gp120 (˜120 kDa). Both proteins assemble as trimeric subunits, with the gp120 subunits being noncovalently attached to the membrane-bound gp41 subunits. Together, these gp41 and gp120 subunits constitute an envelope `spike`.
[0009] Several features of the envelope spike make it particularly challenging for vaccine and antibody development (Q Yu et al., Cellular and Molecular Immunology 2010, 7: 334-340). First, the amino acid sequence of the envelope spike is highly variable, due to the high mutation rate of HIV-1. Second, HIV-1 displays a relatively low number of envelope spikes (˜10) per virion. Third, its noncovalent assembly renders the envelope spike physically unstable. Fourth, its dual-trimeric assembly creates a complex protein structure. And fifth, the envelope proteins are heavily glycosylated, masking potential antibody binding sites.
[0010] A variety of methods are currently being used to generate antibodies specific for HIV. Because it is difficult to produce large amounts of natural HIV-1 in primary cell culture and because the envelope proteins on the virus are "low-abundance" proteins, the field is largely using recombinant proteins, recombinant viruses and/or long-term cell lines to elicit and to screen for anti-HIV-1 proteins. Recombinant proteins are unproven to possess the native conformational determinant(s) that can be targeted by highly effective antibodies or used for effective vaccination. Another approach used in the field is to isolate antibodies directly from the blood of persistently HIV-1-infected individuals. The limitation of such antibodies is implied in the nature of their source. Screening for anti-HIV-1 envelope antibodies is frequently performed using recombinant viruses, virus lysates, and/or recombinant proteins and peptides. These viruses and virus products are unproven to contain the native conformational determinant(s) that can be targeted by highly effective antibodies.
SUMMARY OF THE INVENTION
[0011] Embodiments of the present disclosure include methods (and corresponding products) of reducing HIV-1 transmission and disease progression by providing a system for producing a retroviral particle depleted of capsid proteins and RNA, using said retroviral particles to elicit antibodies in a subject, and administering said antibodies and/or said retroviral particles to a subject.
[0012] Accordingly one aspect of the invention is a composition of matter including isolated antigen binding proteins (ABPs). The isolated ABPs selectively bind to an epitope on an HIV-1 trimeric envelope glycoprotein subunit (TEGS). In an embodiment, the TEGS is prepared by obtaining infectious HIV-1 virus particles from human CD4+ cell culture grown in serum-free media. In an embodiment, the infectious particles are Fiebig I/II isolates or founder virus. The TEGS is further prepared by contacting the infectious HIV-1 virus particles with agents that selectively remove viral RNA and viral capsid protein while retaining viral envelope protein in a non-denatured conformation, such that the agents do not chemically fix or cross-link the envelope protein. In one embodiment, the agents include cyclodextrin. The TEGS is further prepared by isolating protein from the HIV-1 virus particles such that the isolated protein includes non-infectious complexes comprising TEGS, which includes HIV-1 envelope, gp120, and gp41 proteins that are not chemically fixed or cross-linked and substantially free of HIV-1 capsid protein, reverse transcriptase and RNA.
1. In some embodiments, the ABPs neutralize infectious HIV-1 particles, such as particles from an HIV R5 strain and an HIV X4 strain. In another embodiment, the ABPs compete in binding to TEGS with a reference antibody or antibody fragment comprising a heavy chain CDR selected from the group consisting of SEQ ID NO: 1 SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 21, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 41, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 47, SEQ ID NO: 49, SEQ ID NO: 51, SEQ ID NO: 53, SEQ ID NO: 55, SEQ ID NO: 57, SEQ ID NO: 59, SEQ ID NO: 61, SEQ ID NO: 63, SEQ ID NO: 65, SEQ ID NO: 67, SEQ ID NO: 69, SEQ ID NO: 71, and SEQ ID NO: 73, and a light chain CDR selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:44, SEQ ID NO:46, SEQ ID NO:48, SEQ ID NO:50, SEQ ID NO:52, SEQ ID NO:54, SEQ ID NO:56, SEQ ID NO:58, SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:64, SEQ ID NO:66, SEQ ID NO:68, SEQ ID NO:70, SEQ ID NO:72, and SEQ ID NO:74.
[0013] In another embodiment, the ABPs compete in binding to TEGS with a reference antibody or antibody fragment having a nucleotide sequence selected from the group consisting of: SEQ ID NO:75, SEQ ID NO:76, SEQ ID NO:77, SEQ ID NO:78, SEQ ID NO:79, SEQ ID NO:80, SEQ ID NO:81, SEQ ID NO:82, SEQ ID NO:83, SEQ ID NO:84, SEQ ID NO:85, SEQ ID NO:86, SEQ ID NO:87, SEQ ID NO:88, SEQ ID NO:89, SEQ ID NO:90, SEQ ID NO:91, SEQ ID NO:92, SEQ ID NO:93, SEQ ID NO:94, SEQ ID NO:95, SEQ ID NO:96, SEQ ID NO:97, SEQ ID NO:98, SEQ ID NO:99, SEQ ID NO:100, SEQ ID NO:101, SEQ ID NO:102, SEQ ID NO:103, SEQ ID NO:104, SEQ ID NO:105, SEQ ID NO:106, SEQ ID NO:107, SEQ ID NO:108, SEQ ID NO:109, SEQ ID NO:110, SEQ ID NO:111, and SEQ ID NO:112.
[0014] The reference antibody or ABPs may be recombinant antibodies, chimeric antibodies, humanized antibodies, single-chain antibodies, synthetic antibodies, CF antibodies, polyclonal antibodies, human polyclonal antibodies, bispecific antibodies, or fragments thereof. In a further embodiment, the ABPs are administered to a subject at a therapeutic amount. In yet another embodiment, the ABPs are derived from a phage display.
[0015] Another aspect of the invention is an antigenic composition capable of producing neutralizing HIV-1 antibodies including non-infectious complexes. The composition includes a TEGS that comprises HIV-1 envelope, gp120, and gp41 proteins that are not chemically fixed or cross-linked and substantially free of HIV-1 capsid protein, reverse transcriptase and RNA, such that the composition is non-infectious and substantially free of serum proteins. In a further embodiment, the composition is capable of eliciting antibodies that neutralize infectious HIV-1 particles, such as particles from an HIV-1 R5 strain and an HIV-1 X4 strain. In another embodiment, the composition is administered to a subject such that a neutralizing HIV-1 antibody is produced. The subject can be human or non-human. In a further embodiment, a human subject has a homozygous deletion of 32 base pairs in the gene encoding CCR5 coreceptor for HIV-1. In some embodiments, polyclonal antibodies that neutralize HIV-1 are recovered from the subject.
[0016] In an embodiment, a cell line that produces neutralizing HIV-1 antibody is prepared, and the cell line includes splenocytes or B cells isolated from the subject. In some embodiments, the cell line includes immortalized cells or transformed cells. In a further embodiment, the cell line is a hybridoma that is grown in cell culture, and neutralizing HIV-1 antibody is recovered from the cell culture. In a further embodiment, a nucleic acid encoding at least one CDR from a gene encoding a neutralizing HIV-1 antibody is isolated from the hybridoma. Another aspect of the invention is a method of producing ABPs that neutralize HIV-1, by culturing a cell comprising a gene encoding at least part of the ABPs under conditions such that the gene is expressed and the ABPs are recovered.
[0017] Another aspect of the invention is an improvement of an immunoassay method for the detection of anti-HIV-1 antibodies. The improvement includes using at least one antigen that is an HIV-1 TEGS isolated from an immunogenic composition as described above. In an embodiment, the antigen is bound to an immunoassay support. In another embodiment, the antigen is in solution. In a further embodiment, the antigen includes a detectable label.
[0018] Another aspect of the invention is a method for preparing an immunogenic, inactivated virus composition, by obtaining an infectious virus particle that includes RNA, an envelope protein, a capsid protein, a reverse transcriptase, a gp120 protein, and a gp41 protein. In some embodiments, the virus composition includes TEGS, which includes the envelope, the gp120 protein, and the gp41 protein. In other embodiments, the virus particle is a Fiebig I/II isolate or transmitted founder virus, or the virus particle is obtained from a mammalian subject that lacks antibodies against the virus particle, or the virus particle is an HIV particle, an FIV particle, or an EIAV particle. In some embodiments, the virus particle comprises an HIV-1 or an HIV-2 particle. The method for preparing the immunogenic, inactivated virus composition further involves contacting the infectious virus particle with agents that selectively remove the RNA, the capsid protein and the reverse transcriptase, while retaining the envelope protein in a non-denatured conformation, such that the agents do not chemically fix or cross-link the envelope protein, thus producing an immunogenic, inactivated virus composition. In an embodiment, the agents include cyclodextrin and/or Benzonase.
[0019] In one embodiment, the infectious virus particle includes multiple distinct HIV isolates. In a further embodiment, the distinct HIV isolates are distinct HIV types, distinct HIV groups, or distinct HIV clades. In another embodiment, preparation of the TEGS comprises obtaining a DNA sequence of the TEGS, cloning the DNA sequence into an expression vector, and expressing the cloned DNA sequence to obtain TEGS proteins. In another embodiment, a product is produced by one of the above methods, such that the product is capable of eliciting antibodies against the trimeric envelope glycoproteins in a mammalian subject inoculated with the product. In a separate embodiment, the antibodies are virus neutralizing antibodies. In one embodiment, the antibodies present in a sample from a subject are quantified by contacting the sample with the product, and determining the specific binding of antibodies in the sample to the product. In another embodiment, an immune eresponse is generated in a subject by administering an immunogenic amount of the product to the subject. In a further embodiment, the subject is genetically resistant to viral infection. In a further embodiment, the subject is receiving antiretroviral therapy. In a further embodiment, the immune response includes a neutralizing response against the infectious virus particle.
[0020] In another embodiment, an antibody is generated by administering to a subject an immunogenic amount of the above product, and isolating the antibody, such that the antibody specifically binds to the product. In a separate embodiment, an antibody is generated by administering to a subject an immunogenic amount of the above product, producing a hybridoma using splenocytes or B cells isolated from the immunized subject, such that the hybridoma produces a monoclonal antibody that specifically binds to the product, and isolating the monoclonal antibody. In another embodiment, a monoclonal antibody specifically binds to the above product. In a further embodiment, the antibody is capable of neutralizing in vivo the infectious virus particle. In another embodiment, a polyclonal antibody preparation specifically binds to the above product. In a further embodiment, the antibody preparation is capable of neutralizing in vivo the infectious virus particle.
BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWINGS
[0021] These and other features, aspects, and advantages of the present invention will become better understood with regard to the following description, and accompanying drawings, where:
[0022] FIG. 1 illustrates a flowchart that summarizes a method for producing TEGS for generating neutralizing antibodies, in accordance with an embodiment of the invention.
[0023] FIG. 1A illustrates a method for producing virus stocks for use in preparing a virus particle product, in accordance with an embodiment of the invention.
[0024] FIG. 2 illustrates results of an RT-PCR assay for validation and optimization for measuring virus, in accordance with an embodiment of the invention.
[0025] FIG. 3 illustrates a diagram of a particle that features multiple virus particle products, in accordance with an embodiment of the invention.
[0026] FIG. 4 illustrate (left) RT-PCR data and (right) a bar graph that demonstrate that a virus particle product can be sued to capture, detect, and measure anti-virus particle product ABPs, in accordance with an embodiment of the invention.
[0027] FIG. 5 shows SDS-PAGE gels demonstrating that rabbits immunized with TEGS produce TEGS-specific antibodies, in accordance with an embodiment of the invention.
[0028] FIG. 6 is a graph demonstrating that the antibody response elicited by immunizing rabbits with TEGS is dose dependent, in accordance with an embodiment of the invention.
[0029] FIG. 7 illustrates (left) a representative amplification profile, and (right) neutralization results, that illustrate that TEGS anti-serum neutralizes HIV-1, in accordance with an embodiment of the invention.
[0030] FIG. 8 is a chart demonstrating that select recombinant HIV-1 envelope proteins do not block neutralizing activity of TEGS antiserum from a rabbit, in accordance with an embodiment of the invention.
[0031] FIG. 9 shows (left) a gel, and (right) Western blot results, which illustrate refinement of a virus particle product, in accordance with an embodiment of the invention.
[0032] FIG. 10 shows a plasmid in which an envelope gene from a virus particle product was cloned and sequenced, in accordance with an embodiment of the invention.
[0033] FIG. 11 illustrates results of (left) an ELISA and (right) a Western blot, showing that supernatants from mouse hybridoma cells produce virus particle produce-specific antibodies, in accordance with an embodiment of the invention.
[0034] FIG. 12 illustrates an antibody-phage display approach used with splenocytes and bone marrow derived from rabbits immunized with TEGS, in accordance with an embodiment of the invention.
[0035] FIG. 13 illustrates (left) a TEGS-specific ABP and (right) Western blot results, showing that the TEGS-specific ABP was produced and validated, in accordance with an embodiment of the invention.
[0036] FIG. 14 shows a compilation of a similarity matrix between heavy chain variable region amino acid sequences, and a similarity matrix between light chain variable region amino acid sequences, in accordance with an embodiment of the invention.
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0037] Terms used in the claims and specification are defined as set forth below unless otherwise specified.
[0038] The term "sufficient amount" means an amount sufficient to produce a desired effect, e.g., an amount sufficient to modulate protein aggregation in a cell.
[0039] The term "therapeutically effective amount" is an amount that is effective to ameliorate a symptom of a disease. A therapeutically effective amount can be a "prophylactically effective amount" as prophylaxis can be considered therapy.
[0040] It must be noted that, as used in the specification and the appended claims, the singular forms "a," "an" and "the" include plural referents unless the context clearly dictates otherwise.
[0041] The term "vector" means any molecule or entity (e.g., nucleic acid, plasmid, bacteriophage or virus) used to transfer protein coding information into a host cell.
[0042] The term "expression vector" or "expression construct" refers to a vector that is suitable for transformation of a host cell and contains nucleic acid sequences that direct and/or control (in conjunction with the host cell) expression of one or more heterologous coding regions operatively linked thereto. An expression construct can include, but is not limited to, sequences that affect or control transcription, translation, and, if introns are present, affect RNA splicing of a coding region operably linked thereto.
[0043] The term "host cell" means a cell that has been transformed, or is capable of being transformed, with a nucleic acid sequence and thereby expresses a gene of interest. The term includes the progeny of the parent cell, whether or not the progeny is identical in morphology or in genetic make-up to the original parent cell, so long as the gene of interest is present.
[0044] The term "transformation" refers to a change in a cell's genetic characteristics, and a cell has been transformed when it has been modified to contain new DNA or RNA. For example, a cell is transformed where it is genetically modified from its native state by introducing new genetic material via transfection, transduction, or other techniques. Following transfection or transduction, the transforming DNA can recombine with that of the cell by physically integrating into a chromosome of the cell, or can be maintained transiently as an episomal element without being replicated, or can replicate independently as a plasmid. A cell is considered to have been "stably transformed" when the transforming DNA is replicated with the division of the cell.
[0045] The terms "polypeptide" or "protein" means a macromolecule having the amino acid sequence of a native protein, that is, a protein produced by a naturally-occurring and non-recombinant cell; or it is produced by a genetically-engineered or recombinant cell, and comprise molecules having the amino acid sequence of the native protein, or molecules having deletions from, additions to, and/or substitutions of one or more amino acids of the native sequence. The term also includes amino acid polymers in which one or more amino acids are chemical analogs of a corresponding naturally-occurring amino acid and polymers. The term "polypeptide fragment" refers to a polypeptide that has an amino-terminal deletion, a carboxyl-terminal deletion, and/or an internal deletion as compared with the full-length native protein. Such fragments can also contain modified amino acids as compared with the native protein.
[0046] The term "isolated protein" means that a subject protein (1) is free of at least some other proteins with which it would normally be found, (2) is essentially free of other proteins from the same source, e.g., from the same species, (3) is expressed by a cell from a different species, (4) has been separated from at least about 50 percent of polynucleotides, lipids, carbohydrates, or other materials with which it is associated in nature, (5) is operably associated (by covalent or noncovalent interaction) with a polypeptide with which it is not associated in nature, or (6) does not occur in nature. Typically, an "isolated protein" constitutes at least about 5%, at least about 10%, at least about 25%, or at least about 50% of a given sample. Genomic DNA, cDNA, mRNA or other RNA, of synthetic origin, or any combination thereof can encode such an isolated protein. Preferably, the isolated protein is substantially free from proteins or polypeptides or other contaminants that are found in its natural environment that would interfere with its therapeutic, diagnostic, prophylactic, research or other use. In some embodiments, an isolated protein has undergone post-translational modifications and is glycosylated.
[0047] A "variant" of a polypeptide (e.g., an antigen binding protein, or an antibody) comprises an amino acid sequence wherein one or more amino acid residues are inserted into, deleted from and/or substituted into the amino acid sequence relative to another polypeptide sequence. Variants include fusion proteins.
[0048] The term "naturally occurring" as used throughout the specification in connection with biological materials such as polypeptides, nucleic acids, host cells, and the like, refers to materials which are found in nature or a form of the materials that is found in nature.
[0049] The term "antibody" refers to an intact immunoglobulin of any isotype, or a fragment thereof that can compete with the intact antibody for specific binding to the target antigen, and includes, for instance, chimeric, humanized, fully human, and bispecific antibodies. An "antibody" is a species of an antigen binding protein. An intact antibody will generally comprise at least two full-length heavy chains and two full-length light chains, but in some instances can include fewer chains such as antibodies naturally occurring in camelids which can comprise only heavy chains. Antibodies can be derived solely from a single source, or can be "chimeric," that is, different portions of the antibody can be derived from two different antibodies as described further below. The antigen binding proteins, antibodies, or binding fragments can be produced in hybridomas, by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact antibodies. Unless otherwise indicated, the term "antibody" includes, in addition to antibodies comprising two full-length heavy chains and two full-length light chains, derivatives, variants, fragments, and muteins thereof, examples of which are described below. Furthermore, unless explicitly excluded, antibodies include monoclonal antibodies, bispecific antibodies, minibodies, domain antibodies, synthetic antibodies (sometimes referred to herein as "antibody mimetics"), chimeric antibodies, humanized antibodies, human antibodies, antibody fusions (sometimes referred to herein as "antibody conjugates"), and fragments thereof, respectively. In some embodiments, the term also encompasses peptibodies.
[0050] Naturally occurring antibody structural units typically comprise a tetramer. Each such tetramer typically is composed of two identical pairs of polypeptide chains, each pair having one full-length "light" (in certain embodiments, about 25 kDa) and one full-length "heavy" chain (in certain embodiments, about 50-70 kDa). The amino-terminal portion of each chain typically includes a variable region of about 100 to 10 or more amino acids that typically is responsible for antigen recognition. The carboxy-terminal portion of each chain typically defines a constant region that can be responsible for effector function. Human light chains are typically classified as kappa and lambda light chains. Heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively. IgG has several subclasses, including, but not limited to, IgG1, IgG2, IgG3, and IgG4. IgM has subclasses including, but not limited to, IgM1 and IgM2. IgA is similarly subdivided into subclasses including, but not limited to, IgA1 and IgA2. Within full-length light and heavy chains, typically, the variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D" region of about 10 more amino acids. See, e.g., Fundamental Immunology, Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989)) (incorporated by reference in its entirety for all purposes). The variable regions of each light/heavy chain pair typically form the antigen binding site.
[0051] The variable regions typically exhibit the same general structure of relatively conserved framework regions (FR) joined by three hyper variable regions, also called complementarity determining regions or CDRs. The CDRs from the two chains of each pair typically are aligned by the framework regions, which can enable binding to a specific epitope. From N-terminal to C-terminal, both light and heavy chain variable regions typically comprise the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The assignment of amino acids to each domain is typically in accordance with the definitions of Kabat Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987 and 1991)), Chothia & Lesk, J. Mol. Biol., 196:901-917 (1987); Chothia et al., Nature, 342:878-883 (1989), or International Immunogenetics Information System (IMGT; Lefranc et al., Nucleic Acids Research 2009 37: D1006-D1012; doi:10.1093/nar/gkn838).
[0052] In certain embodiments, an antibody heavy chain binds to an antigen in the absence of an antibody light chain. In certain embodiments, an antibody light chain binds to an antigen in the absence of an antibody heavy chain. In certain embodiments, an antibody binding region binds to an antigen in the absence of an antibody light chain. In certain embodiments, an antibody binding region binds to an antigen in the absence of an antibody heavy chain. In certain embodiments, an individual variable region specifically binds to an antigen in the absence of other variable regions.
[0053] In certain embodiments, definitive delineation of a CDR and identification of residues comprising the binding site of an antibody is accomplished by solving the structure of the antibody and/or solving the structure of the antibody-ligand complex. In certain embodiments, that can be accomplished by any of a variety of techniques known to those skilled in the art, such as X-ray crystallography. In certain embodiments, various methods of analysis can be employed to identify or approximate the CDR regions. Examples of such methods include, but are not limited to, the Kabat definition, the Chothia definition, the AbM definition, the IMGT definition, and the contact definition.
[0054] The Kabat definition is a standard for numbering the residues in an antibody and is typically used to identify CDR regions. See, e.g., Johnson & Wu, Nucleic Acids Res., 28: 214-8 (2000). The Chothia definition is similar to the Kabat definition, but the Chothia definition takes into account positions of certain structural loop regions. See, e.g., Chothia et al., J. Mol. Biol., 196: 901-17 (1986); Chothia et al., Nature, 342: 877-83 (1989). The AbM definition uses an integrated suite of computer programs produced by Oxford Molecular Group that model antibody structure. See, e.g., Martin et al., Proc Natl Acad Sci (USA), 86:9268-9272 (1989); "AbM®, A Computer Program for Modeling Variable Regions of Antibodies," Oxford, UK; Oxford Molecular, Ltd. The AbM definition models the tertiary structure of an antibody from primary sequence using a combination of knowledge databases and ab initio methods, such as those described by Samudrala et al., "Ab Initio Protein Structure Prediction Using a Combined Hierarchical Approach," in PROTEINS, Structure, Function and Genetics Suppl., 3:194-198 (1999). The contact definition is based on an analysis of the available complex crystal structures. See, e.g., MacCallum et al., J. Mol. Biol., 5:732-45 (1996).
[0055] IMGT®, the international ImMunoGeneTics information System® (http://www.imgt.org), is a global reference in immunogenetics and immunoinformatics, created in 1989 by Marie-Paule Lefranc (Universite Montpellier 2 and CNRS). IMGT® is a high-quality integrated knowledge resource specialized in the immunoglobulins (IG) or antibodies, T cell receptors (TR), major histocompatibility (MH) of human and other vertebrate species, and in the immunoglobulin superfamily (IgSF), MH superfamily (MhSF) and related proteins of the immune system (RPI) of vertebrates and invertebrates. IMGT® provides a common access to sequence, genome and structure Immunogenetics data, based on the concepts of IMGT-ONTOLOGY and on the IMGT Scientific chart rules. IMGT® works in close collaboration with EBI (Europe), DDBJ (Japan) and NCBI (USA). IMGT® consists of sequence databases, genome database, structure database, and monoclonal antibodies database, Web resources and interactive tools.
[0056] By convention, the CDR regions in the heavy chain are typically referred to as H1, H2, and H3 and are numbered sequentially in the direction from the amino terminus to the carboxy terminus. The CDR regions in the light chain are typically referred to as L1, L2, and L3 and are numbered sequentially in the direction from the amino terminus to the carboxy terminus.
[0057] The term "light chain" includes a full-length light chain and fragments thereof having sufficient variable region sequence to confer binding specificity. A full-length light chain includes a variable region domain, VL, and a constant region domain, CL. The variable region domain of the light chain is at the amino-terminus of the polypeptide. Light chains include kappa chains and lambda chains.
[0058] The term "heavy chain" includes a full-length heavy chain and fragments thereof having sufficient variable region sequence to confer binding specificity. A full-length heavy chain includes a variable region domain, VH, and three constant region domains, CH1, CH2, and CH3. The VH domain is at the amino-terminus of the polypeptide, and the CH domains are at the carboxyl-terminus, with the CH3 being closest to the carboxy-terminus of the polypeptide. Heavy chains can be of any isotype, including IgG (including IgG1, IgG2, IgG3 and IgG4 subtypes), IgA (including IgA1 and IgA2 subtypes), IgM and IgE.
[0059] A bispecific or bifunctional antibody typically is an artificial hybrid antibody having two different heavy/light chain pairs and two different binding sites. Bispecific antibodies can be produced by a variety of methods including, but not limited to, fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsivilai et al., Clin. Exp. Immunol., 79: 315-321 (1990); Kostelny et al., J. Immunol., 148:1547-1553 (1992).
[0060] Some species of mammals also produce antibodies having only a single heavy chain.
[0061] Each individual immunoglobulin chain is typically composed of several "immunoglobulin domains," each consisting of roughly 90 to 110 amino acids and having a characteristic folding pattern. These domains are the basic units of which antibody polypeptides are composed. In humans, the IgA and IgD isotypes contain four heavy chains and four light chains; the IgG and IgE isotypes contain two heavy chains and two light chains; and the IgM isotype contains five heavy chains and five light chains. The heavy chain C region typically comprises one or more domains that can be responsible for effector function. The number of heavy chain constant region domains will depend on the isotype. IgG heavy chains, for example, contain three C region domains known as CH1, CH2 and CH3. The antibodies that are provided can have any of these isotypes and subtypes.
[0062] The term "variable region" or "variable domain" refers to a portion of the light and/or heavy chains of an antibody, typically including approximately the amino-terminal 120 to 130 amino acids in the heavy chain and about 100 to 110 amino terminal amino acids in the light chain. In certain embodiments, variable regions of different antibodies differ extensively in amino acid sequence even among antibodies of the same species. The variable region of an antibody typically determines specificity of a particular antibody for its target.
[0063] The term "antigen" refers to a molecule or a portion of a molecule capable of being bound by a selective binding agent, such as an antigen binding protein (including, e.g., an antibody or immunological functional fragment thereof). In some embodiments, the antigen is capable of being used in an animal to produce antibodies capable of binding to that antigen.
[0064] The term "epitope" includes any determinant capable being bound by an antigen binding protein, such as an antibody or to a T-cell receptor. An epitope is a region of an antigen that is bound by an antigen binding protein that targets that antigen. Epitope determinants can include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl or sulfonyl groups, and can have specific three dimensional structural characteristics, and/or specific charge characteristics. Generally, antibodies specific for a particular target antigen will preferentially recognize an epitope on the target antigen in a complex mixture of proteins and/or macromolecules.
[0065] An "antigen binding protein" ("ABP") as used herein means any protein that binds a specified target antigen. "Antigen binding protein" includes but is not limited to antibodies and binding parts thereof, such as immunologically functional fragments. Peptibodies are another example of antigen binding proteins. The term "immunologically functional fragment" (or simply "fragment") of an antibody or immunoglobulin chain (heavy or light chain) antigen binding protein, as used herein, is a species of antigen binding protein comprising a portion (regardless of how that portion is obtained or synthesized) of an antibody that lacks at least some of the amino acids present in a full-length chain but which is still capable of specifically binding to an antigen. Such fragments are biologically active in that they bind to the target antigen and can compete with other antigen binding proteins, including intact antibodies, for binding to a given epitope. In some embodiments, the fragments are neutralizing fragments. These biologically active fragments can be produced by recombinant DNA techniques, or can be produced by enzymatic or chemical cleavage of antigen binding proteins, including intact antibodies Immunologically functional immunoglobulin fragments include, but are not limited to, Fab, a diabody (heavy chain variable domain on the same polypeptide as a light chain variable domain, connected via a short peptide linker that is too short to permit pairing between the two domains on the same chain), Fab', F(ab')2, Fv, domain antibodies and single-chain antibodies, and can be derived from any mammalian source, including but not limited to human, mouse, rat, camelid or rabbit. It is further contemplated that a functional portion of the antigen binding proteins disclosed herein, for example, one or more CDRs, could be covalently bound to a second protein or to a small molecule to create a therapeutic agent directed to a particular target in the body, possessing bifunctional therapeutic properties, or having a prolonged serum half-life. In some embodiments, antibody fragments are produced by treatment of an immunoglobulin with a protease such as pepsin or papain. The immunoglobulin may be digested before and after a disulfide bond between two H chains in a hinge region. As will be appreciated by one of skill in the art, an antigen binding protein can include nonprotein components.
[0066] Certain antigen binding proteins are antibodies or are derived from antibodies. In certain embodiments, the polypeptide structure of the antigen binding proteins is based on antibodies, including, but not limited to, monoclonal antibodies, bispecific antibodies, minibodies, domain antibodies, synthetic antibodies (sometimes referred to herein as "antibody mimetics"), chimeric antibodies, humanized antibodies, human antibodies, antibody fusions (sometimes referred to herein as "antibody conjugates"), and fragments thereof, respectively. These various antigen binding proteins are further described herein.
[0067] An "Fc" region comprises two heavy chain fragments comprising the CH1 and CH2 domains of an antibody. The two heavy chain fragments are held together by two or more disulfide bonds and by hydrophobic interactions of the CH3 domains.
[0068] A "Fab fragment" comprises one light chain and the CH1 and variable regions of one heavy chain. The heavy chain of a Fab molecule cannot form a disulfide bond with another heavy chain molecule.
[0069] A "Fab' fragment" comprises one light chain and a portion of one heavy chain that contains the VH domain and the CH1 domain and also the region between the CH1 and CH2 domains, such that an interchain disulfide bond can be formed between the two heavy chains of two Fab' fragments to form an F(ab')2 molecule.
[0070] A "F(ab')2 fragment" contains two light chains and two heavy chains containing a portion of the constant region between the CH1 and CH2 domains, such that an interchain disulfide bond is formed between the two heavy chains. A F(ab')2 fragment thus is composed of two Fab' fragments that are held together by a disulfide bond between the two heavy chains.
[0071] The "Fv region" comprises the variable regions from both the heavy and light chains, but lacks the constant regions.
[0072] "Single-chain antibodies" are Fv molecules in which the heavy and light chain variable regions have been connected by a flexible linker to form a single polypeptide chain, which forms an antigen binding region.
[0073] A "domain antibody" is an immunologically functional immunoglobulin fragment containing only the variable region of a heavy chain or the variable region of a light chain. In some instances, two or more VH regions are covalently joined with a peptide linker to create a bivalent domain antibody. The two VH regions of a bivalent domain antibody can target the same or different antigens.
[0074] A "bivalent antigen binding protein" or "bivalent antibody" comprises two antigen binding sites. In some instances, the two binding sites have the same antigen specificities. Bivalent antigen binding proteins and bivalent antibodies can be bispecific, see, infra. A bivalent antibody other than a "multispecific" or "multifunctional" antibody, in certain embodiments, typically is understood to have each of its binding sites identical.
[0075] A "multispecific antigen binding protein" or "multispecific antibody" is one that targets more than one antigen or epitope.
[0076] A "bispecific," "dual-specific" or "bifunctional" antigen binding protein or antibody is a hybrid antigen binding protein or antibody, respectively, having two different antigen binding sites. Bispecific antigen binding proteins and antibodies are a species of multispecific antigen binding protein antibody and can be produced by a variety of methods including, but not limited to, fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsivilai and Lachmann, 1990, Clin. Exp. Immunol. 79:315-321; Kostelny et al., 1992, J. Immunol. 148:1547-1553. The two binding sites of a bispecific antigen binding protein or antibody will bind to two different epitopes, which can reside on the same or different protein targets.
[0077] An "immobilized antibody" is an antibody supported on an insoluble carrier via physical adsorption, chemical bond, or some other method. An immobilized antibody can be used to detect, quantify, separate, or purify an antigen contained in a sample (for example, a body fluid sample such as plasma, a culture supernatant, or a centrifuged supernatant.). In one embodiment, an insoluble carrier used to immobilize the antibody includes a plastic consisting of a polystyrene resin, a polycarbonate resin, a silicon resin, or a nylon resin; a plate consisting of a substance insoluble in water, such as glass; a product having an inner volume, such as a test tube; and either beads, a ball, a filter, or a membrane. In another embodiment, an insoluble carrier used to immobilize the antibody includes insoluble carriers used in affinity chromatography, such as a cellulose carrier, an agarose carrier, a polyacrylamide carrier, a dextran carrier, a polystyrene carrier, a polyvinyl alcohol carrier, a polyamino acid carrier, or a porous silica carrier. An immobilized antibody can be sensitized to an insoluble carrier such as a solid phase carrier, or as a labeled antibody that is labeled with some labeling substance.
[0078] The term "labeled antibody" is an antibody that is labeled with a labeling substance. A labeled antibody can be used to detect or quantify an antigen contained in a sample (for example, a body fluid sample such as plasma, a culture supernatant, or a centrifuged supernatant). The labeling substance is not particularly limited, as long as it is able to bind to an antibody via a physical bond, such as a chemical bond. The labeling substance can be an enzyme, a fluorescent substance, a chemoluminescent substance, biotin, avidin, or a radioisotope, for example. More specifically, the labeling substance can be an enzyme such as peroxidase, alkaline phosphatase, β-D-galactosidase, glucose oxidase, glucose-6-phosphate dehydrogenase, alcohol dehydrogenase, malate dehydrogenase, penicillinase, catalase, apoglucose oxidase, urease, luciferase or acetylcholine esterase; a fluorescent substance such as fluorescein isothiocyanate, phycobiliprotein, rare earth metal chelate, dansyl chloride or tetramethylrhodamine isothiocyanate; a radioisotope such as 3H, 14C, 125I or 131I; or biotin, avidin or chemoluminescent substances. Methods for binding a labeling substance to an antibody include a glutaraldehyde method, a maleimide method, a pyridyl disulfide method or a periodic acid method.
[0079] A labeling substance such as a radioisotope or a fluorescent substance generates detectable signals on its own. Other labeling substances such as enzymes, chemoluminescent substances, biotin, and avidin are not able to generate detectable signals on their own, but generate detectable signals by reacting with one or more types of other substances via a colorimetric method, a fluorescence method, a bioluminescence method, or a chemoluminescence method, for example. In an embodiment, biotin is used as a labeling substance, and reacts with at least avidin or enzyme-modified avidin.
[0080] An antigen binding protein is "selective" when it binds to one target more tightly than it binds to a second target. Methods of determining ABP selectivity or binding specificity are well-known in the art.
[0081] The term "recombinant antibody" refers to an antibody engineered by recombinant DNA technology in a cell line, without involving the use of animals. The term "complement-fixing (CF) antibody" refers to an antibody that is combined with an antigen, leading to opsonization or cell lysis.
[0082] The term "neutralizing antigen binding protein" or "neutralizing antibody" refers to an antigen binding protein or antibody, respectively, that binds to a ligand and prevents or reduces the biological effect of that ligand. This can be done, for example, by directly blocking a binding site on the ligand or by binding to the ligand and altering the ligand's ability to bind through indirect means (such as structural or energetic alterations in the ligand). In some embodiments, the term can also denote an antigen binding protein that prevents the protein to which it is bound from performing a biological function. In assessing the binding and/or specificity of an antigen binding protein, e.g., an antibody or immunologically functional fragment thereof, an antibody or fragment can substantially inhibit binding of a ligand to its binding partner when an excess of antibody reduces the quantity of binding partner bound to the ligand by at least about 1-20, 20-30%, 30-40%, 40-50%, 50-60%, 60-70%, 70-80%, 80-85%, 85-90%, 90-95%, 95-97%, 97-98%, 98-99% or more (as measured in an in vitro competitive binding assay). In some embodiments, the neutralizing ability is characterized and/or described via a competition assay. In some embodiments, the neutralizing ability is described in terms of an IC50 or EC50 value. The term "broadly neutralizing HIV-1 antibody" refers to a neutralizing antibody that neutralizes more than one HIV-1 strain.
[0083] Preferably, the neutralizing antigen binding proteins or neutralizing antibodies of the present invention neutralize infectivity; i.e., the antigen binding protein or antibody reduces or eliminates viral infectivity. Infectivity neutralization can be tested in a standard assay, for example, by incubating the antibody or ABP of interest with viral isolates and susceptible human cells, and then measuring viral levels in a RT-PCR assay. Such an assay is described in Example 8 (below).
[0084] In an embodiment, neutralizing antibodies to an HIV-1 virus particle product are generated by immunizing a subject with a concentrated HIV-1 virus particle product, such as TEGS. In a preferred embodiment, the concentrated HIV-1 virus particle product was produced by propagating the virus in serum-free medium, concentrating the virus, and treating the virus with agents to inactivate the virus. In some embodiments, the concentration step involves using molecular weight cutoff (MWCO) filters. In other embodiments, the agents for inactivating the virus can include a cyclodextrin or Benzonase.
[0085] The term "target" refers to a molecule or a portion of a molecule capable of being bound by an antigen binding protein. In certain embodiments, a target is an antigen. The use of "antigen" in the phrase "antigen binding protein" simply denotes that the moiety that comprises the antigen can be bound by an antibody.
[0086] The term "compete" when used in the context of antigen binding proteins (e.g., neutralizing antigen binding proteins or neutralizing antibodies) that compete for the same epitope means competition between antigen binding proteins as determined by an assay in which the antigen binding protein (e.g., antibody or immunologically functional fragment thereof) being tested prevents or inhibits (e.g., reduces) specific binding of a reference antigen binding protein (e.g., a ligand, or a reference antibody) to a common antigen. Numerous types of competitive binding assays can be used to determine if one antigen binding protein competes with another, for example: solid phase direct or indirect radioimmunoassay (RIA), solid phase direct or indirect enzyme immunoassay (ETA), sandwich competition assay (see, e.g., Stahli et al., 1983, Methods in Enzymology 9:242-253); solid phase direct biotin-avidin EIA (see, e.g., Kirkland et al., 1986, J. Immunol. 137:3614-3619) solid phase direct labeled assay, solid phase direct labeled sandwich assay (see, e.g., Harlow and Lane, 1988, Antibodies, A Laboratory Manual, Cold Spring Harbor Press); solid phase direct label RIA using 1-125 label (see, e.g., Morel et al., 1988, Molec. Immunol. 25:7-15); solid phase direct biotin-avidin EIA (see, e.g., Cheung, et al., 1990, Virology 176:546-552); and direct labeled RIA (Moldenhauer et al., 1990, Scand. J. Immunol. 32:77-82). Typically, such an assay involves the use of purified antigen bound to a solid surface or cells bearing either of these, an unlabeled test antigen binding protein and a labeled reference antigen binding protein. Competitive inhibition is measured by determining the amount of label bound to the solid surface or cells in the presence of the test antigen binding protein. Usually the test antigen binding protein is present in excess. Antigen binding proteins identified by competition assay (competing antigen binding proteins) include antigen binding proteins binding to the same epitope as the reference antigen binding proteins and antigen binding proteins binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference antigen binding protein for steric hindrance to occur. Additional details regarding methods for determining competitive binding are provided in the examples herein. Usually, when a competing antigen binding protein is present in excess, it will inhibit (e.g., reduce) specific binding of a reference antigen binding protein to a common antigen by at least 40-45%, 45-50%, 50-55%, 55-60%, 60-65%, 65-70%, 70-75% or 75% or more. In some instances, binding is inhibited by at least 80-85%, 85-90%, 90-95%, 95-97%, or 97% or more.
[0087] As used herein, "substantially pure" means that the described species of molecule is the predominant species present, that is, on a molar basis it is more abundant than any other individual species in the same mixture. In certain embodiments, a substantially pure molecule is a composition wherein the object species comprises at least 50% (on a molar basis) of all macromolecular species present. In other embodiments, a substantially pure composition will comprise at least 80%, 85%, 90%, 95%, or 99% of all macromolecular species present in the composition. In other embodiments, the object species is purified to essential homogeneity wherein contaminating species cannot be detected in the composition by conventional detection methods and thus the composition consists of a single detectable macromolecular species.
[0088] The term "virus" refers to a small infectious agent that only replicates inside the cell of another organism. A virus particle consists of genetic material made from either DNA or RNA, a protein coat, and optionally a lipid envelope. The term "retrovirus" refers to a virus that uses RNA as its genetic component.
[0089] The term "expansion" refers to propagation of the virus and or cells in vitro.
[0090] The term "trimeric envelope glycoprotein subunit" or "TEGS" refers to protein complexes of trimeric gp120 bound to the membrane-anchored trimeric gp41. Monomeric gp120 and gp 41 are HIV envelope proteins having masses of 120 and 41 kilodaltons (kDa) respectively. Thus, TEGS are predicted to have a mass of several hundred kDa. TEGS function in the attachment and entry of HIV into the cell. Proposed is that TEGS contain a highly conserved protein shape or `conformational determinant` that is required for HIV attachment and entry. Antibodies that bind and obscure the `conformational determinant` can be broadly neutralizing antibodies. Non-neutralizing antibodies that bind to TEGS can also help to reduce infectious virus particles and therefore can also be clinically beneficial.
[0091] The term "non-infectious" refers to the infectivity state of all components of the fluids harvested from cultures containing virus-infected cells. Non-infectious material, when used in standard infectivity assays with blood cells, permissive cell lines, and/or animal models, produces no detectable virus replication.
[0092] The term "fluid" refers to cell culture conditioned medium. In addition to the input cell culture medium, a "fluid" can contain modifications to the constituents of the input cell culture medium, cells, cellular debris, products secreted by cells, products of cellular breakdown, intact viruses, partial viruses, virus proteins, and contaminants.
[0093] The term "agent" is used herein to denote a chemical compound, a mixture of chemical compounds, a biological macromolecule, or an extract made from biological materials.
[0094] The term "biological sample", as used herein, includes, but is not limited to, any quantity of a substance from a living thing or formerly living thing. Such living things include, but are not limited to, humans, mice, monkeys, rats, rabbits, and other animals. Such substances include, but are not limited to, blood, serum, urine, cells, organs, tissues, bone, bone marrow, lymph nodes, and skin.
[0095] The term "prevent" does not require the 100% elimination of the possibility of an event. Rather, it denotes that the likelihood of the occurrence of the event has been reduced in the presence of the compound or method.
[0096] The term "enhancing antibody" refers to an antibody that can promote the replication of a virus, virus subset, or molecular virus construct. This phenomenon facilitates antibody-dependent enhancement (ADE) of infection and can involve complexes of microorganisms and antibodies, interactions of antibodies with Fc receptors (FcR), complement proteins, and complement receptors (CR).
[0097] Standard techniques can be used for recombinant DNA, oligonucleotide synthesis, and tissue culture and transformation (e.g., electroporation, lipofection). Enzymatic reactions and purification techniques can be performed according to manufacturer's specifications or as commonly accomplished in the art or as described herein. The foregoing techniques and procedures can be generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the present specification. See, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual (2d ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989)), which is incorporated herein by reference for any purpose. Unless specific definitions are provided, the nomenclatures utilized in connection with, and the laboratory procedures and techniques of, analytical chemistry, synthetic organic chemistry, and medicinal and pharmaceutical chemistry described herein are those well known and commonly used in the art. Standard techniques can be used for chemical syntheses, chemical analyses, pharmaceutical preparation, formulation, and delivery, and treatment of patients.
[0098] Methods of the Invention
[0099] Viruses and virus derivatives, natural or synthetic, when used for immunization are appreciated for their abilities to elicit protective immune responses. The resulting protection can be attributed to the production of antibodies that are specific for components of the immunogen. Thus, the use of viruses or virus products can enable the production of virus-specific antibodies. The viruses and virus derivatives can be useful in the form of an immunogen or vaccine. The resulting antibodies can also be used for research and clinical benefit. The present virus particle product can be used to elicit virus-particle-specific antibodies. The present invention relates to: producing trimeric envelope glycoproteins derived from HIV, using these glycoproteins for use in clinical and research assays for immunization purposes, and producing antigen-binding proteins (ABPs) (for example, antibodies) that have a neutralizing activity on a wide range of HIV strains. The present invention is not limited to any known variant of HIV and it can include future strains that can arise from recombination of present circulating forms.
[0100] Practices of the method of the present invention include extracting cholesterol from a virus membrane and depleting capsid proteins and RNA, and creating a virus particle product. In some examples, the virus is an infectious retroviral particle that comprises RNA, an envelope protein, a capsid protein, a gp120 protein, and a gp41 protein. In one embodiment, the virus particle product is prepared from HIV-1 cultured in primary human cells. The HIV stocks can be prepared from HIV isolated from individuals undergoing acute HIV infection (such that the individuals' blood is HIV RNA positive and HIV antibody negative). In a further embodiment, the primary human cells are CD4+ blood cells cultured in a serum-free medium.
[0101] In an embodiment, the virus particle product is processed to render the HIV-1 non-infectious. In one embodiment, the virus particle product is not exposed to chemical compounds, such as formaldehyde, ethyleimine, or beta-propiolactone that can modify or disrupt the natural envelope protein structure. The virus particle product retains TEGS (trimeric envelope glycoprotein subunit) in its natural state as evidenced by its ability to bind both anti-gp120 and anti-gp41 antibodies (Vyas G N et al., Biologicals, 2012 40: 15-20). One method of preparing the virus particle product includes contacting an infectious retroviral particle with an agent (for example, a cyclodextrin) that selectively removes RNA, reverse transcriptase and capsid protein while retaining the envelope protein in a non-denatured conformation, wherein said agent does not chemically fix or cross-link said envelope protein, thereby producing an immunogenic, inactivated retroviral composition. Any residual DNA/RNA is degraded by hydrolysis with protease-free Benzonase®. Thus, the immunogenic, inactivated retroviral composition comprises a trimeric envelope glycoprotein subunit, said subunit comprising said envelope, said gp120, and said gp41 proteins. The native HIV-1 envelope structure is retained, and said gp120 subunits are noncovalently attached to said gp41 proteins. In another embodiment, supernatant from the serum-free cell culture of HIV-infected CD4+ cells is concentrated and treated with beta-cyclodextrin and with or without Benzonase to render the HIV non-infectious.
[0102] The virus particle product can be derived from HIV obtained from HIV-infected by seronegative subjects, or further derived from a plurality of HIV types, including HIV-1, HIV-2, groups, and clades. The virus particle product can also be obtained from a mammalian subject that lacks antibodies against said infectious retroviral particle, or from animal lentiviruses such as Feline Immunodeficiency Virus (FIV) or Equine Infectious Anemia (EIAV). The virus particle product can also be a Fiebig I/II isolate or founder virus.
[0103] The virus particle product is capable of eliciting neutralizing antibodies or enhancing antibodies in a mammalian subject inoculated with said product. For example, an immunogenic amount of the virus particle product can be administered to a subject to generate an anti-virus particle product antibody (for example, a TEGS-specific antibody), after which antibody can then be isolated. In some cases, said subject is a camelid subject. In a preferred embodiment, the anti-virus particle product antibody has neutralizing activity against at least one HIV strain, and more preferably has neutralizing activity against a broad range of HIV strains, including the R5 strain and the X4 strain.
[0104] In an embodiment, virus-particle-specific antibodies are elicited in animals. For example, to elicit antibodies, animals (e.g., mice, rabbits, camelids) can be immunized with TEGS or iTEGS. During the antibody production protocol (e.g., 8+ weeks), animals receive multiple (e.g., 3-5) immunizations. The resulting animal serum can contain virus-particle-specific antibodies. Compounds such as Freund's Adjuvant, aluminum salts, CpG, and other adjuvants can be administered along with the immunization to enhances the production of antibodies.
[0105] In the case of FIG. 6, a diagram (ptbi-env11) is shown that demonstrates the ability to genetically engineer components of natural viruses for the production of virus particle products. In this case, the envelope gene was PCR amplified from primary cells infected with a founder/transmitted HIV-1 isolate (HIV-1.sub.TBI-11, or TBI01280) and then cloned into a plasmid. The insert was confirmed by sequence analysis to be a full-length HIV-1 envelope gene.
[0106] In some cases, the anti-virus particle product antibodies are quantified by contacting a sample from a subject with the virus particle product, and determining the specific binding of antibodies in said sample to the virus particle product. One example includes a method of generating an immune response in a subject by administering an immunogenic amount of the virus particle product to said subject. The subject may be genetically resistant to viral infection, or the subject may be receiving anti-retroviral therapy. In some cases, the immune response includes a neutralizing response against the virus particle product.
[0107] Monoclonal antibodies can be generated from lymphocytes (for example, B lymphocytes) that have been isolated from the blood, blone marrow, or spleen of an immunized animal or human and immortalized using hybridoma and/or transformation procedures. By culturing the obtained cell derivatives, monoclonal antibodies can be obtained from the cells. In one embodiment, the antibodies are purified by methods such as DEAE anion exchange chromatography, affinity chromatography, ammonium sulfate fractionation, PEG fractionation, or ethanol fractionation. Some of the monoclonal antibodies of the present invention comprise VH and VL amino acid sequences as listed in Table 1. An oligopeptide or polypeptide is within the scope of the invention if it has an amino acid sequence that is at least 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to a portion of at least one of the amino acid sequences of Table 1, preferably to achieve maximal levels of sequence identity. Some of the monoclonal antibodies of the present invention comprise VH, VL and linker nucleic acid sequences as listed in Table 2. An oligonucleotide is within the scope of the invention if it has a nucleic acid sequence that is at least 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to a portion of at least one of the nucleic acid sequences of Table 2, preferably to achieve maximal levels of sequence identity.
[0108] In an embodiment, monoclonal antibodies are generated when an immunogenic amount of the virus particle product is administered to a subject, and a hybridoma is produced using a splenocyte isolated from said immunized subject. Thehybridoma produces a monoclonal antibody that specifically binds to the virus particle product, and the monoclonal antibody is isolated. In an embodiment, said antibody is capable of neutralizing in vivo the virus particle product. Furthermore, a polyclonal antibody can be prepared that specifically binds to the virus particle product, where the antibody is capable of neutralizing in vivo the virus particle product Immunotherapeutic methods are possible which involve administering a therapeutic amount of the aforementioned monoclonal antibody or polyclonal antibody to a subject.
[0109] Enhancing antibodies are reported for a variety of viruses and infections, including HIV, hepatitis C virus, and Ebola (Fust G. Parasitology 1997, 115: S127-140) (Meyer K et al., PloS one 2011, 6:e23699). These enhancing antibodies can be elicited in subjects and/or measured using the embodied procedures. A preferred application of the elicited or otherwise obtained enhancing antibodies is for clinical use in exposing reservoirs of HIV, where virus replication levels are too low to be detected and/or targeted by natural immune responses or clinical interventions. Another preferred application is the use of enhancing antibodies in clinical and laboratory settings where elevated levels of virus infectivity and/or replication are desired, such as for gene therapy, gene delivery using viral vectors, or maximizing the production of virus particle products.
[0110] To generate an enhancing antibody, an immunogenic amount of the virus particle product is administered to a subject. In an embodiment, said antibody is capable of activating replication in vivo of said infectious retroviral particle Immunotherapeutic methods are possible which involve administering a therapeutic amount of the enhancing antibody to a subject. Also, a protein or protein fragment that binds to the enhancing antibody can be produced, and immunotherapeutic methods are possible which involve administering a therapeutic amount of said protein or protein fragment to a subject.
[0111] In one embodiment, an anti-virus particle product antibody is a bispecific antibody having two different antigen binding sites. The bispecific antibody binds two different epitopes. In a further embodiment, the bispecific antibody that selectively recognizes TEGS, has functional properties that differ from either of the corresponding monospecific antibodies. Further disclosure for producing bispecific antibodies is found in Rouet R and Christ D, Nature Biotechnology 2014, 32: 136-137; and Kontermann R, Landes Biosciences 2012, 4: 182-197.
[0112] A genetic sequence encoding an anti-virus particle product antibody can be obtained by producing a cDNA library using mRNA derived from immunized animals that produce TEGS-specific monoclonal antibodies as described above, and isolating a plasmid containing cDNA encoding a monoclonal antibody. In an embodiment, the mRNA from a specimen containing B cells is prepared by dissolving the cells in a guanidinium isothiocyanate solution, followed by mRNA extraction. The cDNA is produced using the extracted mRNA as a template, and the cDNA, or PCR amplified cDNA, is incorporated into vectors to produce a cDNA library. A gene encoding an anti-virus particle product monoclonal antibody is obtained using the cDNA library. Amino acid sequences of TEGS-specific antibody regions are in Table 1, and nucleic acid sequences of TEGS-specific antibody regions are in Table 2. The PCR primers used for this purpose are in Table 3.
TABLE-US-00001 TABLE 1 TEGS-specific antibody region amino acid sequences Antibody Regionand Clone SEQ ID NO Number Amino Acid Sequence SEQ ID NO: 1 VH QSLEESGGGLFKPTDTLTLTCTVSGFSLSNYGVVWVR TBIfabT203 QAPGNGLEWIGIIDHHGIPYYATWAKSRSTITRNTNLD TVTLKMTSLTAADTATYFCAR SEQ ID NO: 2 VL ELVMTQTESPVSAAVGSTVTINCQASQSVYSNNNLAW TBIfabT203 FQKKPGQPPKRLIHSASTLASGVPSRFKGSGSGTQFTLT ISDLECDDAATYYCAGVFSGSISVFGGGTEVVVK SEQ ID NO: 3 VH VGEGVRGGLLKPTDTLTLTCTVSGFSLNSYAVFWVRQ TBIfabT205 APGNGLEWIGTVSSVGDTYFATWAKSRSTITRNTNLN TVTLKMTSLTAADTATYFCA SEQ ID NO: 4 VL QPVLTQSPSVSAALGSSAKLTCTLSSAHKTYYIEWYQQ TBIfabT205 QQGEAPRYLMQLESDGSYTKGTGVPDRFSGSSSGADR YLIISSVQAEDEADYYCGADYSGGFVFGGGTQLTVT SEQ ID NO: 5 VH QSVEESGGGLFKPTDTLTLTCTVSGFSLSGYGVSWVR TBIfabT206 QAAGNGLEWIGAISSGGSAYYARWAKSRSTITRNTNL NTVTLKMTSLTAADTATYFCAR SEQ ID NO: 6 VL ELVMTQTEPPVSAPVGGTVTINCQASQNIGSSYLSWYQ TBIfabT206 QKPGQPPKLLIYQASTLASGVPSRFKGGGSGTDYSLTIS GVQCADAATYYCQSTFYSSGTGYAFGGGTELEIL SEQ ID NO: 7 VH QSVKESEGGLFKPTDTLTLTCTASEFTIGSYSSGWVRQ TBIfabT208 APGKELEWIGTLSSTGSAHYANWAKGRSTITRNTNEN TVTLKMASLTAADTATYFCAR SEQ ID NO: 8 VL PVLTQSPSVSAALGASAKLTCTLSSGHKTYTIDWYQQ TBIfabT208 QQQGEAPRYLMQIGSDGSYTKGTGVPDRFSGSSSGTD RYLIISSVQAEDEADYYCGADYSGGFVFGGGTQLTVT SEQ ID NO: 9 VH QSVEESGGGLFKPTDTLTLTCTVSGIDLSRNGVTWVRQ TBIfabT209 APGSGLEWIGVINSHGDSDYATWANSRSTITRNTNLNT VTLKMTSLTAADTATYFCA SEQ ID NO: VL ELVMTQTPSSVSAAVGGTVTINCQASQTINNLLAWYQ 10 TBIfabT209 QKPGQPPKLLIYGASTLASGVPSRFSGSGSGTQFILTISG MKAEDAATYYCQSAYYNAGATFGAGTNVEIK SEQ ID NO: VH QSLEESGGGLFKPTDTLTLTCTVSGFSLSNSAMSWVRQ 11 TBIfabT210 APGNGLEWIGDIDSSGSAYYASWAKSRSTITRNTNLNT VTLKMTSLTAADTATYFCAR SEQ ID NO: VL PVLTQSPSVSAALGASAKFTCTLSSGHKTYTIDWYQQ 12 TBIfabT210 QQQGEAPRYLMQIGSDGSYTKGTGVPDRFSGSSSGTD RYLIISSVQAEDEADYICGVTGSNVYAQDPADRH SEQ ID NO: VH QSLEESGGGLFKPTDTLTLTCTVSGFDISGVYMSWVRQ 13 TBIfabT216 APGNGLEWIGAIDRGGGTYYASWAIGRSTITRNTNDN TVTLEMTSLTAADTATYFCAK SEQ ID NO: VL ELVMTQTPSSVSAAVGGTVTINCQASESISNYLAWYQ 14 TBIfabT216 QKPGQPPKLLTYDASDLASGVPSRFSGSGYGTEFTLTIS GVKAEDAATYYCQSGYVSAGTFGAGTNVEIK SEQ ID NO: VH QSLEESGGGLIKPTDMLTLTCTVSGFSLSNYGVMWVR 15 TBIfabT222 QAPGNGLESIGYIGSGGDTSYASWAKSRSTIARNTNEN TVSLLMNGLTAADTATYFCAR SEQ ID NO: VL QPVLTQSPSVSAALGASAKLTCTLSSAHKTYTIDWYQ 16 TBIfabT222 QQQGEAPRYLMHLKSDGTYTKGTGVPDRFSGSSSGAD RYLIIPSVRTDDEADYYCGTDYSGGYVFGGGTQLTVT SEQ ID NO: VH QSLEESGGGLFKPTDTLTLTCTVSGFSLSIYGVSWVRQ 17 TBIfabT226 APGNGLEWVGAIGSGGSAYYATWAKSRSTITRNTNLN TVTLKMASLTAADTATYFCAR SEQ ID NO: VL QPVLTQSPSASAALGSSAKLTCTLSSAHKTYYIDWYQ 18 TBIfabT226 QQQGEAPRYLMQVKSDGSYTRGTGVPDRFSGSSSGAD RYLIIPSVQADDEADYYCGSDYSGGYVFGGGTQLTVT SEQ ID NO: VH QSVEESRGGLFKPTDTLTLTCTVSGFSLSTYNIQWVRQ 19 TBIfabT229 APGNGLEYIGTIGSSGSAYYASRAKSRSTITRNTALNTV SLQVDSLTDADTATYFCAR SEQ ID NO: VL ELDLTQTPSSVSAAVGGTVTINCQASQSVSNLLAWYQ 20 TBIfabT229 QKPGQPPKLLIYGASNLESGVPSRFRGSGSGTEFTLTIS DVVCDDAATYYCAGHKSSSTDGTAFGGGTELEIL SEQ ID NO: VH QSVKESEGGLFKPTDTLTLTCTVSGFTVSNNAISWVRQ 21 TBIfabT232 APGNGLEWIGAISYGGNTYYANWPKSRSTITRNTNLN TVTLKMTSLTAADTATYFCAR SEQ ID NO: VL QPVLTQSPSASAALGSSAKLTCTLSSAHKTYYIDWYQ 22 TBIfabT232 QQQGEAPRYLMQVKSDGSYTKGTGVPDRFSGSSSGA DRYLIIPSVQADDEADYYCGSDYSGGYVFGGGAQLTVT SEQ ID NO: VH QSVKESEGGLFKPTDTLTLTCTVSGFSLSNYGVSWVR 23 TBIfabT234 QAPGKEVEWIGYINSGGSTNYASWAKSRSTITRNTNL NTVTLKMTSLTAADTATYFCAR SEQ ID NO: VL ELDMTQTPSSVSAAVGDTVTINCQASQSVTNLLAWYQ 24 TBIfabT234 QKPRQPPKLLIYDASNLESGVPSRFRGSGSGTEFTLTIS GMKAEDAATYYCQSGYYSAGATFGAGTNVEIK SEQ ID NO: VH QSVKESEGGLFKPMDSMTLTCTVSGFSLSSYGVSWVR 25 TBIfabT236 QAPGNGLEWIGAISSGGSAYYARWAKSRATITRNTNL NTVTLKMASLTAADTATYFCAR SEQ ID NO: VL ELVLTQTPSPVSAAVGGTVTINCQSSQSVYSNNRLAW 26 TBIfabT236 YQQKPGQPPKQLIYYASTLASGVSSRFKGSGSGTQFTL TISDVVCDDAATYYCAGYKNSGIDEHAFGGGTELEIL SEQ ID NO: VH QSLEESGGGLFKPTDTLTLTCTVSGFSLNRYDMSWVR 27 TBIfabT239 QAPGNGLEWIGVINSGGFTYYASWAKSRSTITRNTNE NTVTLKMTSLTAADTATYFCAR SEQ ID NO: VL QPVLTQSPSVSAALGASAKLTCTLSSGHKTYTIDWYQ 28 TBIfabT239 QQQGEAPRYLMQLGSDGSYTKQTGVPDRFSGSSSGAD RYLIISSVQADDEADYYCGADYSGGFVFGGGTQLTVT SEQ ID NO: VH QSVKESEGGLFKPTDTLTLTCTVSGFSLSNNAINWVRQ 29 TBIfabT240 APGNGLEWIGAVGSGGRAYYAGWAKSRSTITRNTNL NTVTLKMTNLTAADTATYFCAR SEQ ID NO: VL ELVLTQTPSSVSAAVGGTVSISCQSSQSVYSNYLAWYQ 30 TBIfabT240 QKPGQPPKLLIYYASTLASGVSSRFKGSGSGTQFTLTIN GVQCDDAATYYCQGTFDDGLYKAFGGGTELEIL SEQ ID NO: VH QSLEESGGGLFKPTDTLTLTCTVSGFSLSNYGMGWVR 31 TBIfabT241 QAPGNGLEYIGFISSGGNTYYASWAKSRSTITRDTNLN TVTLKMSSLTAADTATYFCAR SEQ ID NO: VL ELVMTQTPSSVSAAVGGTVTINCQASQSVYNLLAWYQ 32 TBIfabT241 QKPGQPPKLLTHGTSNLESGVPSRFRGSGSGTEFTLTIS GMKAEDAATYYCQSGYYSTGATFGAGTNVEIK SEQ ID NO: VH QSLEESGGGLFKPTDPLTLTCTVSGFSINDYNMQWVR 33 TBIfabT247 QAPGIGLEWIGAINAWGDTYYTSWAKSRSTITRDTNL NTVTLKMTSLTAADTATYFCAR SEQ ID NO: VL ELDLTQTPSSVSAAVGGTVTINCQSSQSVDSNNYLSW 34 TBIfabT247 YQQKPGQPPKLLIYDASTLASGVPSRFSGSGSGTQFTL TISEVQCDDAATYYCQGSYYSGDWYGAFGGGTELEIL SEQ ID NO: VH QSLEESGGGLFKPTDTLTLTCTASGFTVTSNAISWVRQ 35 TBIfabT249 APGNGLEYIGFIGAAGNANYASWAKSRSTITRNTNLNT VTLKMTSLTAADTATYFCAR SEQ ID NO: VL ELVMTQTPASVSEPVGGTVTISCQASQGVYSDRLAWY 36 TBIfabT249 QQKPGQPPKLLMYYASDLSSGVPSRFKGSGSGTEFTLT ISDLECADAATYYCQSNYGSLSSSYTFGGGTEVVVK SEQ ID NO: VH QSVEESRGGLFKPTDTLTLTCTVSGFTIDTYGVTWVRQ 37 TBIfabP202 APGNGLEYIGFISSGGAAYYASWAKSRSTITRNTNLNT VTLKMTSLTAADTATYFCAR SEQ ID NO: VL ELVMTQTPPSLSASVGETVRIRCLASENVYSAVAWYQ 38 TBIfabP202 QKPGKPPTLLISGASNLESGVPPRFSGSGSGTDYTLTIG GVQAEDAATYFCQGYSSYLTFGAGTNVEIK SEQ ID NO: VH QSLEESGGGLIKPTDTLTLTCTVSGFSLSIYDISWVRQA 39 TBIfabP210 PGNGLEWIGAIGSGDTTYYASWAKSRSTITRNTYLNTV TLKMTSLTAADTATYFCAR SEQ ID NO: VL QPVLTQSPSASAALRSSAKLTCTLSSAHKSYDIDWYQQ 40 TBIfabP210 QSGEAPRYLMRLRSDGKYTKGTGVPDRFSGSSSGADR YLIIPSVQADDGADYYCGTDYSGGYVFGGGTQLTVT SEQ ID NO: VH EQLVESEGGLFKPTDTLTLTCTVSGFSLNNYGVTWVR 41 TBIfabP214 QAPGRGLEWIGAVWSGATTDYASWAKSRSTITRNTNE NTVTLKMSSLTAADTATYFCA SEQ ID NO: VL ELVMTQTESPVSAAVGGTVTINCQASQSISSWLAWYQ 42 TBIfabP214 QKPGKPPTLLISGASNLESGVPPRFSGSGSGTDYTLTIG GVQAEDAATYYCLGGYSYSSIGTTFGAGTNVEIK SEQ ID NO: VH QEQLEESGGGLVQPGGSLKLSCKASGFDFINYGVIWV 43 TBIfabP217 RQAPGKGLEWIGYIDPIFGNTIYASWVNDRFTISSHNA QNTLYLQLNSLTAADTATYFCAR SEQ ID NO: VL ELVMTQTPSSVSAAVGGTVTINCQASQSVNNLLAWYQ 44 TBIfabP217 QKPGQPPKLLTYGTSNLESGVPSRFRGSGSGTEFTLTIS GMKAEDAATYYCQSGYYSAGLTFGAGTNVEIK SEQ ID NO: VH QSLEESGGGLIKPTDTLTLTCTVSGFSLSTNGVSWVRQ 45 TBIfabP219 APGSGLEWIGAIDLYGATYYATWAKSRSTITRNTNLN TVTLKMTSLTAADTATYFCAR SEQ ID NO: VL ELVLTQTPASVSEPVGGTVTIKCQASQNIYSGISWYQQ 46 TBIfabP219 KPEKPPTLLISGASNLEPGVPPRFSGSGSGTDYTLTIGG VQAGDAATYYCLGVYSFGSTDLTFGAGTNVEIK SEQ ID NO: VH QSLEESGGGLFKPTDTLTLTCTVSGFSLSSYAISWVRQ 47 TBIfabP220 APGNGLEWIGYINYDGIAYYASWAKSRSTITRNTNLNT VTLKMTGLTAADTATYFCAR SEQ ID NO: VL ELDLTQTPSSVSAAVGGTVSISCQSSQSVYNNYLAWY 48 TBIfabP220 QQKPGQPPKLLIYYASKLASGVPSRFKGSGSGTQFTLTI SDVQCDDAATYYCQGTFDNGLYKAFGGGTELEIL SEQ ID NO: VH QSLEESGGGLVQPGGSLKLSCKGSGFDLDSNAMCWV 49 TBIfabP221 RQAPGSGLEWIGTITSGGSAYYASWAKSRSTITRNTNL NTVTLKMTSLTAADTATYFCAR SEQ ID NO: VL ELDMTQTPSSVSAAVGGTVTINCQASESISNLLAWYQ 50 TBIfabP221 QKPGQPPKLLIYSASTLASGVPSRFRGSGSGTEFTLTIS GMKAEDAATYYCQSGYYSTGATFGAGTNVEIK SEQ ID NO: VH TBIfabT7 QEQLEESGGRLVKPDETLTLTCTVSGLSLNNFGVSWV 51 RQAPGNGLEWIRAIDFGSGSAYYANWAKSRSTITSNTR LNTVTLKMISLTAADTATYFCSR SEQ ID NO: VL TBIfabT7 QPVLTQSPSVSAALGASAKLTCTLSSAHKTYTIDWYQ 52 QQSGEAPRYLMQLKSDGNYTKGTGVPDRFSGSSSGAD RYLIIPSVQADDEADYYCGADYSGGYVFGGGTQLTVT SEQ ID NO: VH QSVKESEGGLFKPTDTLTLTCTVSGFSLSNYAINWVRQ 53 TBIfabT14 APGEGLEWIGYIDPTFGSTYYASWVNDRFTISSHNAQN TLYLQLNSLTPADTATYFCAR SEQ ID NO: VL ELDMTQTPSSVSAAVGGTVTISCQASQSVYNNNNLSW 54 TBIfabT14 YQQKPGQPPKLLIYDASKLASGVPSRFKGSGSGTQFTL TISDLECDNAATYFCQQGYDGSDVDNVFGGGTEVVVK SEQ ID NO: VH TBIfabP9 QSLEESGGGLFKPGGSLTLTCTVSGFTITSYHMCWVRQ 55 APGNGLGWIGAVSASGHTYYANWAKSRSTITRDTNLN TMTLKMTSLTAADTATYFCA SEQ ID NO: VL TBIfabP9 ELVLTQTPPSLSASVGETVRIRCLASEFLFNAVSWYQQ 56 KPEKPPTLPIYGASNLESGVPPRFSGSGSGTQFTLTISDL ECDDAATYYCAGDYSDWIYAFGGGTEVVVK SEQ ID NO: VH QSLEESGGGLFKPTDTLTLTCTVSGFSLSSYGITWVRQ 57 TBIfabP12 APGNGLEWIGAIGSDAKTYYASWAKGRSTITGDTNLN TVTLRMTSLTAADTATYFCAR SEQ ID NO: VL ELVLTQTPSSVPAAVGGTVTIDCQSSESVYNNNNLAW 58 TBIfabP12 YQQKPGQPPKLLIYGASTLASGVSSRFKGSGSGTEFTL TISDLECADAATYYCQQGYSIGNVDNAFGGGTELEIL SEQ ID NO: VH QSVKESEGGLFKPTDTLTLTCTVSGFSLSSYGVSWVRQ 59 TBIfabP18 APGNGLEWIGAISSGGDAYYASWATSRSTITRNTNLNT VTLKMTSLTAADTATYFCAR SEQ ID NO: VL ELVMTQTPASVEVAVGGTVTIKCQASQSISSYLAWYQ 60 TBIfabP18 QKPGQPPKLLIYKASTLASGVPSRFKGSGSGTQFTLTIS DVVCDDAATYYCAGYKGGSSDGSAFGGGTELEIL SEQ ID NO: VH QSVEESGGGLFKPADTLTLTCTVSGFSLSYPGVSWVRQ 61 TBIfabP19 APGNGLEYIGFINADGDSYYPTWAKRRSTITRNTNLNT
VTLKMTSLTAADTATYFCA SEQ ID NO: VL QPVLTQSPSASAALGSSAKLTCTLSSAHKTYYIEWYQQ 62 TBIfabP19 QQGEAPRYLMQVKSDGSYTKGTGVPDRFSGSSSGADR YLIIPSVQADDEADYYCGADYSGGYVLGGGTQLTVT SEQ ID NO: VH QSLEESGGGLFKPADTLTLACTVSGFSLSTYGVIWVRQ 63 TBIfabT114 APGKGLEYIAYINYSGSPYYASWAKSRSTITRNTNEKT VTLKMTSLTAADTATYFCAR SEQ ID NO: VL QPVLTQSPSASAALGSSAKLTCTLSSAHKTYYIDWYQ 64 TBIfabT114 QQQGEAPRYLMQLGSDGSYTKGTGVPDRFSGSSSGAD RYLIIPSVQADDEADYYCGSDYSGGYVFGGGTQLTVT SEQ ID NO: VH SRWRSPGGGLFKPTDTLTLTCTVSGFSLSGYGVSWVR 65 TBIfabT116 QAPGNGLEWIGAISSGGSAYYARWAKSRSTITRNTNL NTVTLKMTSLTAADTATYFCAR SEQ ID NO: VL QPVLTQSPSVSAALGASAKLTCTLSSAHKTYTIDWYQ 66 TBIfabT116 QQQGEAPRYLMQLKSDGSYTKGTGVPDRFSGSSSGAD RYLIIPSVQADDEADYYCGADYSGGYVFGGGTQLTVT SEQ ID NO: VH QSVKESEGGLFKPTDTLTLTCTVSGFSLSNYGVSWVR 67 TBIfabT124 QAPGNGLEYIGFISNGGATFYATWARSRATITRNTGLN TVALTMTSLTAADTATYFCVR SEQ ID NO: VL ELDMTQTPPSLSASVGETVRIRCLASEDIGSAISWYQQ 68 TBIfabT124 KPGKPPTLLIYGVFNLESGVPPRFSGSGSGTDYTLTIGG VQAEDAATYYCLGGASDSSTGLTFGAGTNVEIK SEQ ID NO: VH QSVKESEGGLFKPTDTQTLTCTVSGFSLSSNAISWVRQ 69 TBIfabT129 APGNGLKSIGFINSGGGAYYATWAKSRSTITRNTNENT VTLKMTSLTAADTATYFCAR SEQ ID NO: VL QPVLTQSPSLSASLGTTARLTCTLSTGYSVGEYPLVWL 70 TBIfabT129 QQVPGRPPRYLLSFTSDEDKHHDSWGPTRFSGSKDTSE NTFILSISGLQPEDEADYYCATAHGSDNSLHYVFGGRT QLTVT SEQ ID NO: VH QSLEESGGGLFKPTDTLTLTCTVSGFALNNYNIHWVR 71 TBIfabT134 QAPGNGLEWIGAIGSSGSAYYASWAKSRSTITRNTNLN TVTLKMTSLTAADTATYFCAR SEQ ID NO: VL QPVLTQSPSASAALGSSAKLTCTLSSAHKTYYIEWYQQ 72 TBIfabT134 QQGEAPRYLIQLKSDGSYTKGTGVPDRFSGSSSGTDRY LIISSVQAEDEADYSCGADYSGGFVFGGGTQLTVT SEQ ID NO: VH VGGGVQGGGLVKPGDTLTLTCTVSGFPLSSYDMNWV 73 TBIfabP212 RQAPGEGLEWIGWITYDGYNHYASWANGRSTITRNTN ENAVTLKMTSLTAADTATYFCAR SEQ ID NO: VL ELVLTQTPPSLSASVGGTVTINCLASENVYSAVAWYQ 74 TBIfabP212 QKPGKPPTLLISGTSNLEAGVPPRFSGSGSGTDYTLTIG GVQAEDAATYFCQGYSSYPLTFGAGTNVEIK
TABLE-US-00002 TABLE 2 TEGS-specific antibody region nucleic acid sequences Clone Nucleic Acid Sequence SEQ ID NO Number (VL-linker-VH; linker underlined) SEQ ID NO: TBIfabT203 CCCAGCCGGCCATGGCTGAGCTCGTGATGACCCAGA 75 CTGAATCGCCCGTGTCTGCAGCTGTGGGAAGCACAG TCACCATCAATTGCCAGGCCAGTCAGAGTGTTTATA GTAACAACAACTTAGCCTGGTTTCAGAAGAAACCAG GGCAGCCTCCCAAGCGCCTGATCCATTCTGCATCCA CTCTGGCATCTGGGGTCCCATCGCGGTTCAAAGGCA GTGGATCTGGGACACAGTTCACTCTCACCATCAGCG ACCTGGAGTGTGACGATGCTGCCACTTACTACTGTG CAGGCGTTTTTAGTGGTAGTATTAGTGTTTTCGGCG GAGGGACCGAGGTGGTCGTCAAGGTGGTTCCTCTAG ATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGG TGGGCAGTCGCTGGAGGAGTCCGGGGGAGGTCTCTT CAAGCCAACGGATACCCTGACACTCACCTGCACAGT CTCTGGATTCTCCCTCAGTAACTATGGAGTGGTCTG GGTCCGCCAGGCTCCAGGGAACGGGCTGGAATGGA TCGGAATCATTGATCATCATGGTATCCCATACTACG CAACCTGGGCGAAAAGCCGATCCACCATCACCAGA AACACCAACCTGGACACGGTGACTCTGAAAATGAC CAGTCTGACAGCCGCGGACACGGCCACCTATTTCTG TGCGAGAGCTTACGTTAATTTTGGCTGGGATTATGC TCTTAACATCTGGGGTCCAGGCACCCTGGTCACCGT CTCCTCAGGGCAACCTAAGGCTCCGTCAGTCACTAG TGGCCCGGGAGGCCA SEQ ID NO: TBIfabT205 CCGGCCATGGCTCAGCCTGTGCTGACTCAGTCGCCC 76 TCTGTGTCTGCTGCCCTGGGATCCTCGGCCAAGCTC ACCTGCACTCTGAGCAGTGCTCACAAGACCTACTAT ATTGAATGGTATCAGCAACAACAAGGGGAGGCCCC TCGGTACCTGATGCAACTTGAGAGTGATGGAAGCTA CACCAAGGGGACCGGGGTCCCTGATCGCTTCTCGGG CTCCAGCTCTGGGGCTGACCGCTACTTGATCATCTC CAGCGTCCAGGCTGAGGACGAAGCCGACTACTATTG TGGTGCAGATTATAGTGGTGGGTTTGTGTTCGGCGG AGGGACCCAGCTGACCGTCACAGGTGGTGGTTCCTC TAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGG TGGTGGGCAGTCGGTGAAGGAGTCCGGGGAGGTCT CCTCAAGCCAACGGATACCCTGACACTCACCTGCAC AGTCTCTGGATTCTCCCTCAATAGCTATGCAGTATTC TGGGTCCGCCAGGCTCCAGGGAACGGGCTGGAATG GATCGGAACCGTTAGTAGTGTTGGTGACACATACTT CGCGACCTGGGCGAAAAGCCGATCCACCATCACCA GAAACACCAACCTGAACACGGTGACTCTGAAAATG ACCAGTCTGACAGCCGCGGACACGGCCACCTATTTT TGTGCGAGGGGGGTTGGTGTTAGTTATTATCTTGAT GCTTTTGATTCTTGGGGCCCAGGCACCCTGGTCACC GTCTCCTCAGGGCAACCAGGCTCCATCAGTCACTAG TGGCCCGGGAGGCCA SEQ ID NO: TBIfabT206 CCGGCCATGGCTGAGCTCGTGATGACCCAGACTGAA 77 CCCCCCGTGTCTGCACCTGTGGGAGGCACAGTCACC ATCAATTGCCAGGCCAGTCAGAACATTGGTAGTAGC TACTTATCCTGGTATCAGCAGAAACCAGGGCAGCCT CCCAAGCTCCTGATCTACCAGGCTTCCACTCTGGCA TCTGGGGTCCCATCGCGGTTCAAAGGCGGTGGATCT GGGACAGACTACAGTCTCACCATCAGCGGCGTGCA GTGTGCCGATGCCGCCACTTATTACTGTCAAAGTAC TTTTTATAGTAGTGGTACTGGTTATGCTTTCGGCGGA GGGACCGAGCTGGAGATCCTGGTGGTTCCTCTAGAT CTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTG GGCAGTCGGTGGAGGAGTCCGGGGGAGGTCTCTTC AAGCCAACGGATACCCTGACACTCACCTGCACAGTC TCTGGATTCTCCCTCAGTGGCTATGGAGTGAGCTGG GTCCGCCAGGCTGCAGGGAACGGGCTGGAATGGAT CGGAGCCATTAGTAGTGGTGGTAGCGCATACTACGC GAGATGGGCGAAAAGCCGATCCACCATCACCAGAA ACACCAACCTGAACACGGTGACTCTGAAAATGACC AGTCTGACAGCCGCGGACACGGCCACCTATTTCTGT GCGAGAGGTTACTATACTGCTATTGGTGGTACTTAT GACAATGCTTTTGATCCCTGGGGCCCAGGCACCCTG GTCACCGTCTCCTCAGGGCAACCTAAGGCCATCAGT CACTAGTGGCCCGGGAGGCCA SEQ ID NO: TBIfabT208 GGCCCAGCCGGCCATGGCTCAGCCTGTGCTGACTCA 78 GTCGCCCTCTGTGTCTGCCGCCCTGGGAGCCTCTGC CAAGCTCACCTGCACCCTGAGCAGTGGCCACAAGAC CTACACCATTGACTGGTATCAGCAGCAGCAGCAAGG GGAGGCCCCTCGGTACCTGATGCAGATTGGGAGTGA TGGAAGCTACACCAAGGGGACCGGGGTCCCTGATC GCTTCTCGGGCTCCAGCTCTGGGACTGACCGCTACT TGATCATCTCCAGCGTCCAGGCTGAGGACGAAGCCG ACTACTATTGTGGTGCAGATTATAGTGGTGGGTTTG TGTTCGGCGGAGGGACCCAGCTGACCGTCACAGGTG GTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGG CTCGGGCGGTGGTGGGCAGTCGGTGAAGGAGTCCG AGGGAGGTCTCTTCAAGCCAACGGATACCCTGACAC TCACCTGCACAGCCTCCGAATTCACCATCGGTAGTT ATAGTAGTGGCTGGGTCCGCCAGGCTCCAGGGAAG GAGCTGGAGTGGATCGGAACCCTTAGTTCTACTGGT AGCGCACACTACGCGAACTGGGCGAAAGGCCGTTC CACCATCACCAGAAACACCAACGAGAACACGGTGA CTCTGAAGATGGCCAGTCTGACAGCCGCGGACACG GCCACCTATTTCTGTGCGAGAGCTGATTATGGGCCC TGTTATTTTGACATCTGGGGCCCAGGCACCCTGGNC ACCGTTTTCTCNGGNAACCTNANNCTCCATCAGTCA CTAGTGGCCCGGGAGGCCA SEQ ID NO: TBIfabT209 CCGGCCATGGCTGAGCTCGTGATGACCCAGACTCCA 79 TCCTCTGTGTCTGCAGCTGTGGGAGGCACAGTCACC ATCAATTGCCAGGCCAGTCAGACTATTAACAACCTC TTAGCCTGGTATCAGCAGAAACCAGGGCAGCCTCCC AAGCTCCTGATTTATGGTGCATCCACTCTGGCATCT GGGGTCCCATCGCGTTTCAGCGGCAGTGGATCTGGG ACACAGTTCATTCTCACCATCAGTGGCATGAAGGCT GAAGATGCTGCCACTTATTACTGTCAAAGTGCTTAT TATAATGCTGGTGCGACTTTTGGAGCTGGCACCAAT GTGGAAATCAAGGTGGTTCCTCTAGATCTTCCTCCT CTGGTGGCGGTGGCTCGGGCGGTGGTGGGCAGTCG GTGGAGGAGTCCGGGGGAGGTCTCTTCAAGCCAAC GGATACCCTGACACTCACCTGCACAGTCTCTGGAAT CGACCTCAGTAGAAATGGAGTGACCTGGGTCCGCCA GGCTCCAGGGAGCGGGCTGGAATGGATCGGAGTCA TTAATAGTCATGGTGACAGTGATTACGCGACCTGGG CGAACAGCCGATCCACCATCACCAGAAACACCAAC CTGAACACGGTGACTCTGAAAATGACCAGTCTGACA GCCGCGGACACGGCCACCTATTTCTGTGCGAGTACT TATGATAGTTATTATGATTATGCTTGGCCTAATTTTG GCATCTGGGGCCCAGGCACCCTGGTCACCGTCTCCT CAGGGCAACCTAAGGCCAGTCACTAGTGGCCCGGG AGGCCA SEQ ID NO: TBIfabT210 GGCCCAGCCGGCCATGGCTCAGCCTGTGCTGACTCA 80 GTCGCCCTCTGTGTCTGCCGCCCTGGGAGCCTCTGC CAAGTTCACCTGCACCCTGAGCAGTGGCCACAAGAC CTACACCATTGACTGGTATCAGCAGCAGCAGCAAGG GGAGGCCCCTCGGTACCTGATGCAGATTGGGAGTGA TGGAAGCTACACCAAGGGGACCGGGGTCCCTGATC GCTTCTCGGGCTCCAGCTCTGGGACTGACCGCTACT TGATCATCTCCAGCGTCCAGGCTGAGGACGAAGCTG ACTACATCTGTGGTGTAACTGGTAGTAATGTTTATG CACAGGACCCAGCTGACCGTCACAGGTGGTGGTTCC TCTAGATCTTCCCCTGGTGGCGGTGGCCGGGCGGTG GTGGGCAGTCGCTGGAGGAGTCCGGGGGAGGTCTC TTCAAGCCAACGGATACCCTGACACTCACCTGCACA GTCTCTGGATTCTCCCTCAGTAACAGTGCAATGAGC TGGGTCCGCCAGGCTCCAGGGAACGGGCTGGAATG GATCGGAGACATTGATAGTAGTGGTAGCGCATACTA CGCGAGCTGGGCGAAAAGCCGATCCACCATCACCA GAAACACCAACCTGAACACGGTGACTCTGAAAATG ACCAGTCTGACAGCCGCGGACACGGCCACCTATTTC TGTGCGAGAGGGGGTTATGGTAATGCTGGTACTCCT TACTATGGCATGGACCTCTGGGGCCCAGGGACCCTC GTCACCGTCTCCTCAGGGCAACCTAAGGCTCCATCA GTCACTAGTGGCCCGGGAGGCCA SEQ ID NO: TBIfabT216 CCGGCCATGGCTGAGCTCGTGATGACCCAGACTCCA 81 TCCTCTGTGTCTGCAGCTGTGGGAGGCACAGTCACC ATCAATTGCCAGGCCAGTGAAAGCATTAGCAACTAC TTAGCCTGGTATCAGCAGAAACCAGGGCAGCCTCCC AAGCTCCTGACCTATGATGCATCTGATCTGGCATCT GGGGTCCCATCGCGGTTCAGCGGCAGTGGATATGGG ACAGAGTTCACTCTCACCATTAGTGGCGTGAAGGCT GAAGATGCTGCCACTTATTATTGTCAAAGTGGTTAT GTTAGTGCTGGGACTTTTGGAGCTGGCACCAATGTG GAAATCAAGGTGGTTCCTCTAGATCTTCCTCCTCTG GTGGGGCGGTGGTGGGCAGTCGTTGGAGGAGTCCG GGGGAGGTCTCTTCAAGCCAACGGATACCCTGACAC TCACCTGCACAGTCTCTGGATTCGACATTAGTGGCG TTTACATGAGCTGGGTCCGCCAGGCTCCAGGGAACG GGCTGGAGTGGATCGGAGCCATTGATCGTGGTGGTG GCACTTACTACGCGAGCTGGGCGATAGGCCGATCCA CCATCACCAGAAACACCAACGACAACACGGTGACT CTGGAAATGACCAGTCTGACAGCCGCGGACACGGC CACCTATTTCTGTGCGAAAGGATATAGTGTTCTTGA TCCCTGGGGCCCAGGCACCCTGGNCACCGTCTCCTC AGGGCAACCTAAGGCTCCATCAGTCACTAGTGGCCC GGGAGGCCA SEQ ID NO: TBIfabT222 GGCCCAGCCGGCCATGGCTCAGCCTGTGCTGACTCA 82 GTCGCCCTCTGTGTCTGCCGCCCTGGGAGCCTCTGC CAAGCTCACCTGCACCCTGAGCAGTGCCCACAAGAC CTACACCATTGACTGGTATCAGCAGCAGCAAGGGG AGGCCCCTCGATACCTGATGCATCTTAAGAGTGATG GAACCTACACCAAGGGGACCGGGGTCCCTGATCGCT TCTCGGGCTCCAGCTCTGGGGCTGACCGCTACTTGA TCATCCCCAGCGTCCGAACTGATGACGAAGCCGACT ACTATTGTGGTACAGATTACAGCGGTGGGTATGTAT TCGGCGGAGGGACCCAGCTGACCGTCACAGGTGGT GGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCT CGGGCGGTGGTGGGCAGTCGCTGGAGGAGTCCGGG GGAGGCCTGATCAAGCCAACGGATATGTTGACACTC ACCTGCACAGTCTCTGGATTCTCCCTCAGTAACTAT GGAGTGATGTGGGTCCGCCAGGCTCCAGGGAACGG ACTGGAGTCGATCGGATATATTGGTAGTGGTGGTGA CACATCCTACGCGAGCTGGGCGAAAAGCCGATCCA CCATCGCCAGAAACACCAACGAGAACACGGTGTCT CTGCTCATGAATGGTCTGACAGCCGCGGACACGGCC ACCTATTTCTGTGCGAGAGATCCTGGTTATAGTGCT GGTAGTGCTTTTGATCCCTGGGGCCCAGGCACCCTG GTCACCGTCTTCTCAGGGCAACCTAAGGCTCCATCA GTCACTAGTGGCCCGGGAGGCCA SEQ ID NO: TBIfabT226 GGCCCAGCCGGCCATGGCTCAGCCTGTGCTGACTCA 83 GTCGCCCTCTGCATCTGCTGCCCTGGGATCCTCGGC CAAGCTCACCTGCACTCTGAGCAGTGCTCACAAGAC CTACTATATTGACTGGTATCAGCAGCAGCAAGGGGA GGCCCCTCGGTACCTGATGCAGGTTAAGAGTGATGG AAGCTACACCAGGGGGACCGGGGTCCCTGATCGCTT CTCGGGCTCCAGCTCTGGGGCTGACCGCTACTTGAT CATCCCCAGCGTCCAGGCTGATGACGAAGCCGACTA CTATTGTGGTTCAGATTATAGCGGTGGGTATGTGTT CGGCGGAGGGACCCAGCTGACCGTCACAGGTGGTG GTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTC GGGCGGTGGTGGGCAGTCGTTGGAGGAGTCCGGGG GAGGTCTCTTCAAGCCAACGGATACCCTGACACTCA CCTGCACAGTCTCTGGATTCTCCCTCAGTATCTATGG AGTGAGCTGGGTCCGCCAGGCTCCGGGGAATGGGC TGGAATGGGTCGGAGCCATTGGTAGTGGTGGTAGCG CATACTACGCGACCTGGGCGAAAAGCCGATCCACC ATCACCAGAAACACCAACCTGAACACGGTGACTCTG AAAATGGCCAGTCTGACAGCCGCGGACACGGCCAC CTATTTCTGTGCGAGAGGTTACTATACTGCTATTGGT GGTACTTATGACAATGCTTTTGATCCCTGGGGCCCA GGCACCCTGGTCACCGTCTCCTCAGGGCAACCTAAG TCCATCAGTCACTAGTGGCCCGGGAGGCCA SEQ ID NO: TBIfabT229 CCGGCCATGGCTGAGCTCGATCTGACCCAGACTCCA 84 TCCTCTGTGTCTGCAGCTGTGGGAGGCACAGTCACC ATCAATTGCCAGGCCAGTCAGAGTGTTAGCAACCTC TTAGCCTGGTATCAGCAGAAACCAGGGCAGCCTCCC AAGCTCCTGATTTATGGTGCATCCAATCTGGAATCT GGGGTCCCATCGCGTTTCCGTGGCAGTGGATCTGGG ACAGAGTTCACTCTCACCATCAGCGATGTGGTGTGT GACGATGCTGCCACTTACTACTGTGCAGGACATAAA AGTAGTAGTACTGATGGTACTGCTTTCGGCGGAGGG ACCGAGCTGGAGATCCTGGTGGTTCCTCTAGATCTT CCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGC AGTCGGTGGAGGAGTCCAGGGGAGGTCTCTTCAAG CCAACGGATACCCTGACACTCACCTGTACAGTCTCT GGATTCTCCCTTAGTACCTACAACATACAATGGGTC CGCCAGGCTCCAGGGAACGGGCTGGAATATATCGG AACCATTGGTAGTAGTGGTAGCGCATACTACGCGAG CCGGGCGAAAAGCCGATCCACCATCACCAGAAACA CCGCCCTGAACACGGTGTCTCTGCAAGTGGACAGTC TGACAGACGCGGACACGGCCACCTATTTCTGTGCGA GAGGAGGGACTTGGTATACAGATGGTCTTGCTTATG TTGATGCTTTTGATCTCTGGGGCCCAGGCACCCTGG NCACCGCCTNCTCNGGCAACCTAGTCACTAGTGGNC CGGGAGGCCA SEQ ID NO: TBIfabT232 GGCCCAGCCGGCCATGGCTCAGCCTGTGCTGACTCA 85 GTCGCCCTCTGCATCTGCTGCCCTGGGATCCTCGGC CAAGCTCACCTGCACTCTGAGCAGTGCTCACAAGAC CTACTATATTGACTGGTATCAGCAGCAGCAAGGGGA GGCCCCTCGGTATCTGATGCAGGTTAAGAGTGATGG
AAGCTACACCAAGGGGACCGGGGTCCCTGATCGCTT CTCGGGCTCCAGCTCTGGGGCTGACCGCTACTTGAT CATCCCCAGCGTCCAGGCTGATGACGAAGCCGACTA CTATTGTGGTTCAGATTATAGCGGTGGGTATGTGTT CGGCGGAGGGGCCCAGCTGACCGTCACAGGTGGTG GTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTC GGGCGGTGGTGGGCAGTCGGTGAAGGAGTCCGAGG GAGGTCTCTTCAAGCCAACGGATACCCTGACACTCA CCTGCACAGTCTCTGGATTCACCGTCAGTAACAATG CAATAAGCTGGGTCCGCCAGGCTCCAGGGAATGGG CTGGAATGGATCGGAGCCATTAGTTACGGTGGTAAC ACATACTACGCGAACTGGCCGAAAAGCCGATCCAC CATCACCAGAAACACCAACCTGAACACGGTGACTCT GAAAATGACCAGTCTGACAGCCGCGGACACGGCCA CCTATTTCTGTGCGAGATTCTACTATGGTGCTGGTTA TGCCTATGACATCTGGGGCCCAGGCACCCTGGTCAC CGTCTTCTCAGGGCAACCTAAGGCTCCGTCAGTCAC TAGTGGCCCGGGAGGCCA SEQ ID NO: TBIfabT234 CCGGCCATGGCTGAGCTCGATATGACCCAGACTCCA 86 TCCTCTGTGTCTGCAGCTGTGGGAGACACAGTCACC ATCAATTGTCAGGCCAGTCAGAGTGTTACCAACCTC TTAGCCTGGTATCAGCAGAAACCAAGGCAGCCTCCC AAACTCCTGATTTATGATGCATCCAATCTAGAATCT GGAGTCCCATCGCGTTTCCGTGGCAGTGGATCTGGG ACAGAGTTCACTCTCACCATCAGTGGCATGAAGGCT GAAGATGCTGCCACTTATTACTGTCAAAGTGGTTAT TATAGTGCTGGTGCGACTTTTGGAGCTGGCACCAAT GTGGAAATCAAGGTGGTTCCTCTAGATCTTCCTCCT CTGGTGGCGGTGGCTCGGGCGGTGGTGGGCAGTCG GTGAAGGAGTCCGAGGGAGGTCTCTTCAAGCCAAC GGATACCCTGACACTCACCTGCACAGTCTCTGGATT CTCCCTCAGTAACTATGGAGTGAGCTGGGTCCGCCA GGCTCCAGGGAAGGAGGTGGAGTGGATCGGATACA TTAACAGTGGTGGTAGTACTAATTACGCGAGCTGGG CGAAAAGCCGATCCACCATCACCAGAAACACCAAT TTGAACACGGTGACTCTGAAAATGACCAGCCTGACA GCCGCGGACACGGCCACCTATTTCTGTGCGAGAGGT TACCGTGGTTATAATGTTGGTATGGATGCTTTTGATG TCTGGGGCCCANGCAATCTGGTCACCGTCTCCTCAG GNAACCTANNCTCTCAGTCACTAGTGGCCCGGGAGG CCA SEQ ID NO: TBIfabT236 CCGGCCATGGCTGAGCTCGTGCTGACCCAGACTCCA 87 TCCCCAGTGTCTGCGGCTGTTGGAGGCACAGTCACC ATCAATTGCCAGTCCAGTCAGAGTGTTTATAGTAAC AACCGCTTAGCCTGGTATCAGCAGAAACCAGGGCA GCCTCCCAAGCAACTGATCTATTATGCATCCACTCT GGCATCTGGGGTCTCATCGCGGTTCAAAGGCAGTGG ATCTGGGACACAGTTCACTCTCACCATCAGCGATGT GGTGTGTGACGATGCTGCCACTTACTACTGTGCAGG ATATAAAAATAGTGGTATTGATGAACATGCTTTCGG CGGAGGGACCGAGCTGGAGATCCTGGTGGTTCCTCT AGACTTCTCCTCTGGTGGCGGTGGCTCGGGCGGTGG TGGGCAGTCGGTGAAGGAGTCCGAGGGAGGTCTCTT CAAGCCAATGGATAGCATGACACTCACCTGCACAGT CTCTGGATTCTCCCTCAGTAGCTATGGAGTGAGCTG GGTCCGCCAGGCTCCAGGGAACGGGCTGGAATGGA TCGGAGCCATTAGTAGTGGTGGTAGCGCATACTACG CGAGATGGGCGAAAAGCCGAGCCACCATCACCAGA AACACCAACCTGAACACGGTGACTCTGAAAATGGC CAGTCTGACAGCCGCGGACACGGCCACCTATTTCTG TGCGAGAGGTTACTATACTGCTATTGGTGGTACTTA TGACAATGCTTTTGATCCCTGGGGCCCAGGCACCCT GGTCACCGTCTCCTCAGGGCAACCTAACAGTCACTA GTGGCCCGGGAGGCCA SEQ ID NO: TBIfabT239 GGCCCAGCCGGCCATGGCTCAGCCTGTGCTGACTCA 88 GTCGCCCTCTGTGTCTGCCGCCCTGGGAGCCTCTGC CAAGCTCACCTGCACCCTGAGCAGTGGCCACAAGAC CTACACCATTGACTGGTATCAGCAGCAGCAAGGGG AGGCCCCTCGGTACCTGATGCAGCTTGGGAGTGATG GAAGCTACACCAAGCAGACCGGGGTCCCTGATCGCT TCTCGGGCTCCAGCTCTGGGGCTGACCGCTACTTGA TCATCTCCAGCGTCCAGGCTGATGACGAAGCCGACT ACTATTGTGGTGCGGATTATAGTGGTGGGTTTGTGT TCGGCGGAGGGACCCAGCTGACCGTCACAGGTGGT GGCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTC GGGCGGTGGTGGGCAGTCGTTGGAGGAGTCCGGGG GAGGTCTCTTCAAGCCAACGGATACCCTGACACTCA CCTGCACAGTCTCTGGATTCTCCCTCAACAGGTACG ACATGAGTTGGGTCCGCCAGGCTCCAGGGAACGGG CTGGAATGGATCGGAGTCATTAATAGTGGTGGGTTC ACATACTACGCGAGCTGGGCGAAAAGCCGATCCAC CATCACCAGAAACACCAACGAGAACACGGTGACTC TGAAAATGACCAGTCTGACAGCCGCGGACACGGCC ACCTATTTCTGTGCGAGAGGTTACCGTGGTTATAAT GTTGGTATGGATGCTTTTGATGTCTGGGGCCCAGGC AATCTGGTCACCGTCTCCTCAGGGCAACCTAAGTCC GTCAGTCACTAGTGGCCCGGGAGGCCA SEQ ID NO: TBIfabT240 GGCCCAGCCGGCCATGGCTGAGCTCGTGCTGACCCA 89 GACTCCATCGTCCGTGTCTGCAGCTGTGGGAGGCAC AGTCAGCATCAGTTGCCAGTCCAGTCAGAGTGTTTA TAGTAACTACTTAGCCTGGTATCAGCAGAAACCAGG GCAGCCTCCCAAGCTCCTGATCTATTATGCATCCAC TCTGGCATCTGGGGTCTCATCGCGGTTCAAAGGCAG TGGATCTGGGACACAGTTCACTCTCACCATCAACGG CGTGCAGTGTGACGATGCTGCCACTTACTACTGTCA AGGCACTTTTGATGATGGTTTGTACAAGGCTTTCGG CGGAGGGACCGAGCTGGAGATCCTGGTGGTTCCTCT AGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGT GTGGGCAGTCGGTGAAGGAGTCCGAGGGAGGTCTC TTCAAGCCAACGGATACCCTGACACTCACCTGCACA GTCTCTGGATTCTCCCTCAGTAACAATGCAATAAAC TGGGTCCGCCAGGCTCCAGGGAACGGGCTGGAGTG GATCGGAGCCGTTGGTAGTGGTGGTAGGGCATACTA CGCGGGCTGGGCGAAAAGCCGATCCACCATCACCA GAAACACCAACCTGAACACGGTGACTCTGAAAATG ACGAATCTGACAGCCGCGGACACGGCCACCTATTTC TGTGCGAGAGTCGGATTTTACTATGGCAATGGTCTT TCTTATGGTATTGGCGCTTTTGATCCCTGGGGCCCAG GCACCCTGGTCACCGTCTCCTCAGGGCAACCAGGCT CCGTCAGTCACTAGTGGCCCGGGAGGCCA SEQ ID NO: TBIfabT241 CCGGCCATGGCTGAGCTCGTGATGACCCAGACTCCA 90 TCCTCTGTGTCTGCAGCTGTGGGAGGCACAGTCACC ATCAATTGCCAGGCCAGTCAGAGTGTTTACAACCTC TTAGCCTGGTATCAGCAGAAACCAGGGCAGCCTCCC AAGCTCCTGACTCATGGTACATCCAATCTGGAATCT GGGGTCCCATCGCGTTTCCGTGGCAGTGGATCTGGG ACAGAGTTCACTCTCACCATCAGTGGCATGAAGGCT GAAGATGCTGCCACTTATTACTGTCAAAGTGGTTAT TATAGTACTGGTGCGACTTTTGGAGCTGGCACCAAT GTGGAAATCAAGGTGGTTCCTCTAGATCTTCCTCCT CCGGTGGCGGTGGCTCGGGCGGTGGTGGGCAGTCG CTGGAGGAGTCCGGGGGAGGTCTCTTCAAGCCAAC GGATACCCTGACACTCACCTGCACAGTCTCTGGATT CTCCCTCAGTAACTATGGAATGGGCTGGGTCCGCCA GGCTCCAGGGAACGGGCTGGAATACATCGGATTCAT TAGTAGTGGTGGTAATACATACTACGCGAGCTGGGC GAAAAGCCGATCCACCATCACCAGAGACACCAACC TGAACACGGTGACTCTGAAAATGAGCAGTCTGACA GCCGCGGACACGGCCACCTATTTCTGTGCGAGAGGT TACCGTGGTTATAATGTTGGTATGGATGCTTTTGATG TCTGGGGCCCAGGCAATCTGGTCACCGTCTCCTCAG GGCAACAAGGCTCCATCAGTCACTAGTGGCCCGGG AGGCCA SEQ ID NO: TBIfabT247 CCGGCCATGGCTGAGCTCGATCTGACCCAGACTCCA 91 TCCTCCGTGTCTGCAGCTGTGGGAGGCACAGTCACC ATCAATTGCCAGTCCAGTCAGAGTGTTGATAGTAAC AATTACTTATCCTGGTATCAGCAGAAACCAGGGCAG CCTCCCAAGCTCCTGATCTATGATGCATCCACTCTG GCATCTGGGGTCCCATCGCGGTTCAGCGGCAGTGGA TCTGGGACACAGTTCACTCTCACCATCAGCGAAGTA CAGTGTGACGATGCTGCCACTTACTACTGTCAAGGC AGTTATTATAGTGGTGATTGGTATGGGGCTTTCGGC GGAGGGACCGAGCTGGAGATCCTGGTGGTTCCTCTA GATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGTG GTGGGCAGTCGTTGGAGGAGTCCGGGGGAGGTCTCT TCAAGCCAACGGATCCCCTGACACTCACCTGCACAG TCTCTGGATTCTCCATCAATGACTACAACATGCAAT GGGTCCGCCAGGCTCCAGGGATCGGGCTGGAATGG ATCGGAGCCATTAATGCTTGGGGTGATACATACTAT ACGAGCTGGGCGAAAAGCCGATCCACCATCACCAG AGACACCAACCTGAACACGGTGACTCTGAAAATGA CCAGTCTGACAGCCGCGGACACGGCCACCTATTTCT GTGCNAGAGGTTACAGTCTTGACATCTGGGGCCCAG GCACCCTGGTCACCGTCTCCTCAGGGCAACCTAAGG CTCCGTCAGTCACTAGTGGCCCGGGAGGCCA SEQ ID NO: TBIfabT249 CCCAGCCGGCCATGGCTGAGCTCGTGATGACCCAGA 92 CTCCAGCCTCCGTGTCTGAACCTGTGGGAGGCACAG TCACCATCAGTTGCCAGGCCAGTCAGGGTGTTTATA GCGACCGCCTAGCCTGGTATCAACAGAAACCAGGG CAGCCTCCCAAGCTCCTGATGTATTATGCATCCGAT CTGTCATCTGGGGTCCCATCGCGGTTCAAAGGCAGT GGATCTGGGACAGAGTTCACTCTCACCATCAGCGAC CTGGAGTGTGCCGATGCTGCCACTTACTACTGTCAA AGCAATTATGGTAGTCTTAGTAGTAGTTATACTTTC GGCGGAGGGACCGAGGTGGTCGTCAAGGTGGTTCC TCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGC GGTGGTGGGCAGTCGTTGGAGGAGTCCGGGGGAGG TCTCTTCAAGCCAACGGATACCCTGACACTCACCTG CACAGCCTCCGGATTCACCGTCACTAGCAACGCAAT AAGCTGGGTCCGCCAGGCTCCAGGGAACGGGCTGG AATATATCGGATTCATTGGTGCTGCTGGTAATGCAA ACTACGCGAGCTGGGCGAAAAGCCGCTCCACCATC ACCAGAAACACCAACCTGAACACGGTGACTCTGAA AATGACCAGTCTGACAGCCGCGGACACGGCCACCT ATTTCTGTGCGAGAGAGGGTGGTTGGGGTACATTGT TTGGTGCTTTTGATTCCTGGGGCCCAGGCACCCTGG TCACCGTCTCCTCAGGGCAACCTAAGGCTCCATCAG TCACTAGTGGCCCGGGAGGCCA SEQ ID NO: TBIfabP202 GGCCCAGCCGGCCATGGCTGAGCTCGTGATGACCCA 93 GACTCCACCCTCCCTGTCTGCATCTGTGGGAGAAAC TGTCAGGATTAGGTGCCTGGCGAGTGAGAACGTTTA CAGTGCTGTAGCCTGGTATCAACAGAAGCCAGGGA AACCTCCTACACTCCTGATCTCTGGTGCATCCAATTT AGAATCTGGGGTCCCACCACGGTTCAGTGGCAGTGG ATCTGGGACAGATTACACCCTCACCATCGGCGGCGT GCAGGCTGAAGATGCTGCCACTTACTTCTGTCAAGG GTATAGCAGTTACCTGACTTTTGGAGCTGGCACCAA TGTGGAAATCAAGGTGGTTCCTCTAGATCTTCCTCCT CTGGTGGCGGTGGCTCGGGCGGTGGTGGGCAGTCG GTGGAGGAGTCCAGGGGAGGTCTCTTCAAGCCAAC GGATACCCTGACACTCACCTGCACAGTCTCTGGATT TACCATCGATACCTATGGAGTGACCTGGGTCCGCCA GGCTCCAGGGAACGGGCTGGAATATATCGGATTCAT TAGTAGTGGTGGTGCCGCATACTACGCGAGCTGGGC GAAAAGCCGATCCACCATCACCAGAAACACCAATC TGAACACGGTGACTCTGAAAATGACCAGTCTGACAG CCGCGGACACGGCCACCTATTTCTGTGCGAGAGATC GTGGCTATGTTTATGGTTATGGTGATGGTACTGACA TCTGGGGCCCAGGCACCCTGGTCACCGTCTCCTCAG GGCAACCTAAGGCTCCATCAGTCACTAGTGGCCCGG GAGGCCA SEQ ID NO: TBIfabP210 CCCAGCCGGCCATGGCTCAGCCTGTGCTGACTCAGT 94 CGCCCTCTGCGTCTGCTGCCCTGAGATCCTCGGCCA AGCTCACCTGCACCCTGAGCAGTGCCCACAAGAGTT ACGACATTGACTGGTATCAGCAGCAGTCAGGGGAG GCCCCTCGGTACCTAATGCGTCTTAGGAGTGATGGA AAGTACACCAAGGGGACCGGGGTCCCTGATCGCTTC TCGGGCTCCAGCTCTGGGGCTGACCGCTACTTGATC ATCCCCAGCGTCCAGGCTGATGACGGAGCCGACTAT TATTGTGGTACAGATTATAGCGGTGGATATGTGTTC GGCGGAGGGACCCAGCTGACCGTCACAGGTGGTGG TTCCTCTAGATCTTCCTCCTGGTGGCGGTGGCTCGGG CGGTGGTGGGCAGTCGCTGGAGGAGTCCGGGGGAG GCCTGATCAAGCCAACGGATACCCTGACACTCACCT GCACAGTCTCTGGATTCTCCCTCAGTATCTACGACA TAAGCTGGGTCCGCCAGGCTCCAGGGAACGGGCTG GAATGGATCGGAGCCATTGGTAGTGGTGATACCACA TACTACGCGAGCTGGGCGAAAAGCCGATCCACCATC ACCAGAAACACCTACCTGAACACGGTGACTCTGAA AATGACCAGTCTGACAGCCGCGGACACGGCCACCT ATTTCTGTGCGAGAGGGGGGTTATCCTGGTTCAACA TCTGGGGCCCAGGCACCCTGGTCACCGTCTCCTCAG GGCAACCTAAGGCTCCGTCAGTCACTAGTGGCCCGG GAGGCCA SEQ ID NO: TBIfabP214 CCGGCCATGGCTGAGCTCGTGATGACCCAGACTGAA 95 TCCCCCGTGTCTGCAGCTGTGGGAGGCACAGTCACC ATCAATTGCCAGGCCAGTCAGAGCATTAGCAGTTGG TTGGCCTGGTATCAACAGAAGCCAGGGAAACCTCCT ACACTCCTGATCTCTGGTGCATCCAATTTAGAATCT GGGGTCCCACCACGGTTCAGTGGCAGTGGATCTGGG ACAGATTACACCCTCACCATTGGCGGCGTGCAGGCT GAAGATGCTGCCACCTACTATTGTCTAGGCGGTTAT AGTTACAGTAGTATCGGTACGACTTTTGGAGCTGGC ACCAATGTGGAAATCAAGGTGGTTCCTCTAGATCTT CCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGC AGGAGCAGCTGGTGGAGTCCGAGGGAGGTCTCTTC AAGCCAACGGATACCCTGACACTCACCTGCACAGTG TCTGGATTCTCCCTCAATAACTATGGAGTGACCTGG GTCCGCCAGGCTCCAGGGAGGGGGCTGGAATGGAT CGGAGCCGTTTGGAGTGGTGCTACCACAGACTATGC GAGCTGGGCGAAAAGCCGATCCACCATCACCAGAA
ACACCAACGAGAACACGGTGACTCTGAAAATGTCC AGTCTGACAGCCGCGGACACGGCCACCTATTTCTGT GCGAATTTTCCTGGTTATACTTCTGGTACCGACATCT GGGGCCCTGGCACCCTGGTCACCGTCTCCTCAGGGC AACCTAAGGCTCCGTCAGTCACTAGTGGCCCGGGAG GCCA SEQ ID NO: TBIfabP217 CCGGCCATGGCTGAGCTCGTGATGACCCAGACTCCA 96 TCCTCTGTGTCTGCAGCTGTGGGAGGCACAGTCACC ATCAATTGTCAGGCCAGTCAGAGTGTTAACAACCTC TTAGCCTGGTATCAGCAGAAACCAGGGCAGCCTCCC AAGCTCCTGACTTATGGTACATCCAATCTGGAATCT GGGGTCCCATCGCGTTTCCGTGGCAGTGGATCTGGG ACAGAGTTCACTCTCACCATCAGTGGCATGAAGGCT GAAGATGCTGCCACTTATTACTGTCAAAGTGGTTAT TATAGTGCTGGTTTGACTTTTGGAGCTGGCACCAAT GTGGAAATCAAGGTGGTTCCTCTAGATCTTCCTCCT CTGGTGGCGGTGGCTCGGGCGGTGGTGGGCAGGAG CAGCTGGAGGAGTCCGGGGGAGGCCTGGTCCAGCC TGGGGGATCCCTGAAACTCTCCTGCAAAGCCTCTGG ATTCGACTTCATTAACTATGGAGTAATCTGGGTCCG CCAGGCTCCTGGGAAGGGGCTGGAGTGGATCGGAT ACATTGATCCTATTTTTGGTAACACAATCTACGCGA GCTGGGTGAATGACCGATTCACCATCTCCAGCCACA ACGCCCAGAACACGCTGTATCTGCAACTGAACAGTC TGACAGCCGCGGACACGGCCACCTATTTCTGTGCGA GATGCGGGGATAGACGTGGCTGGGGTTATGGTTTTG ATCCCTGGGGCCCAGGCACCCTGGTCACCGTCTCCT CAGGGCAACCTAAGGCTCCGTCAGTCACTAGTGGCC CGGGAGGCCA SEQ ID NO: TBIfabP219 CCGGCCATGGCTGAGCTCGTGCTGACCCAGACTCCA 97 GCCTCCGTGTCTGAACCTGTGGGAGGCACAGTCACC ATCAAGTGCCAGGCCAGTCAGAACATTTACAGTGGT ATATCCTGGTACCAACAGAAGCCAGAGAAACCTCCT ACACTCCTGATCTCTGGTGCATCCAATTTAGAACCT GGGGTCCCACCACGGTTCAGTGGCAGTGGATCTGGG ACAGATTACACCCTCACCATTGGCGGCGTGCAGGCT GGAGATGCTGCCACCTACTACTGTCTAGGCGTTTAT AGTTTCGGTAGTACCGATTTGACTTTTGGAGCTGGC ACCAATGTGGAAATCAAGGTGGTTCCTCTAGATCTT CCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGC AGTCGCTGGAGGAGTCCGGGGGAGGCCTCATCAAG CCAACGGATACCCTGACACTCACCTGCACGGTCTCT GGATTCTCCCTCAGTACCAATGGAGTGAGTTGGGTC CGCCAGGCTCCAGGGAGCGGGCTGGAATGGATCGG AGCCATTGATCTTTATGGTGCCACATATTACGCGAC CTGGGCGAAAAGCCGATCCACCATCACCAGAAACA CCAACCTAAACACGGTGACTCTGAAAATGACCAGTC TGACAGCCGCGGACACGGCCACCTATTTCTGTGCGA GAGAGGGATATGGTTATCCAAACATCTGGGGCCCA GGCACCCTGGTCACCGTCTCCTCNGGCAACCTNANN NTCCGTCAGTCACTAGTGGCCCGGGAGGCCA SEQ ID NO: TBIfabP220 GGCCCAGCCGGCCATGGCTGAGCTCGATCTGACCCA 98 GACTCCATCGTCCGTGTCTGCAGCTGTGGGAGGCAC AGTCAGCATCAGTTGCCAGTCCAGTCAGAGTGTTTA TAATAACTACTTAGCCTGGTATCAGCAGAAACCAGG GCAGCCTCCCAAGCTCCTGATCTATTATGCATCCAA ACTGGCATCTGGGGTCCCATCGCGGTTCAAAGGCAG TGGATCTGGGACACAGTTCACTCTCACCATCAGCGA CGTGCAGTGTGACGATGCTGCCACTTACTACTGTCA AGGCACTTTTGATAATGGTTTGTACAAGGCTTTCGG CGGAGGGACCGAGCTGGAGATCCTGGTGGTTCCTCT AGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGT GGTGGGCAGTCGTTGGAGGAGTCCGGGGGAGGTCT CTTCAAGCCAACGGATACCCTGACACTCACCTGCAC AGTCTCTGGATTCTCCCTCAGTAGCTATGCAATAAG CTGGGTCCGCCAGGCTCCAGGGAACGGGCTGGAAT GGATCGGATACATTAATTACGATGGTATCGCATACT ACGCGAGCTGGGCGAAAAGCCGATCCACCATCACC AGAAACACCAACCTGAACACGGTGACTCTGAAAAT GACCGGTCTGACAGCCGCGGACACGGCCACCTATTT CTGTGCGAGAGATGACTATACTACTCCTTATGGTTA TCGATTGGNTCTCTGGGGCCAGGGCACCCTGGTCAC CGTCTCCTCAGGGCAACCTAAGGCTCCGTCAGTCAC TAGTGGCCCGGGAGGCCA SEQ ID NO: TBIfabP221 GGCCCAGCCGGCCATGGCTGAGCTCGATATGACCCA 99 GACTCCATCCTCTGTGTCTGCAGCTGTGGGAGGCAC AGTCACCATCAATTGCCAGGCCAGTGAAAGCATTAG CAACCTCTTAGCCTGGTATCAGCAGAAACCAGGGCA GCCTCCCAAGCTCCTGATCTATTCTGCATCCACTCTG GCATCTGGGGTCCCATCGCGTTTCCGTGGCAGTGGA TCTGGGACAGAGTTCACTCTCACCATCAGTGGCATG AAGGCTGAAGATGCTGCCACTTATTACTGTCAAAGT GGTTATTATAGTACTGGTGCGACTTTTGGAGCTGGC ACCAATGTGGAAATCAAGGTGGTTCCTCTAGATCTT CCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGC AGTCGCTGGAGGAGTCCGGAGGAGGCCTGGTCCAG CCGGGGGGATCCCTGAAACTCTCCTGCAAAGGCTCT GGGTTCGACCTCGATAGCAATGCAATGTGCTGGGTC CGCCAGGCTCCAGGGAGCGGGCTGGAATGGATCGG AACCATTACTAGTGGTGGTAGCGCATACTACGCGAG CTGGGCGAAAAGCCGATCCACCATCACCAGAAACA CCAACCTAAACACGGTGACTCTGAAAATGACCAGTC TGACAGCCGCGGACACGGCCACCTATTTCTGTGCGA GAGGACCTACTTGGGGAATTGGAGATACTTTTCATC CCTGGGGCCCAGGCACCCTGGTCACCGTCTCCTCGG GGCAACCTAAGGCTCCGTCAGTCACTAGTGGCCCGG GAGGCCA SEQ ID NO: TBIfabT7 GGCCCAGCCGGCCATGGCTCAGCCTGTGCTGACTCA 100 GTCGCCCTCTGTGTCTGCCGCCCTGGGAGCCTCTGC CAAGCTCACCTGCACCCTGAGCAGTGCCCACAAGAC CTACACCATTGACTGGTATCAACAGCAGTCAGGGGA GGCCCCTCGATACCTGATGCAGCTTAAGAGTGATGG AAACTACACCAAGGGGACCGGGGTCCCTGATCGCTT CTCGGGCTCCAGCTCTGGGGCTGACCGCTACTTGAT CATCCCCAGCGTCCAGGCTGATGACGAAGCCGACTA CTATTGTGGTGCAGATTATAGCGGTGGGTATGTGTT TGGCGGAGGGACCCAGCTGACCGTCACAGGTGGTG GTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTC GGGCGGTGGTGGGCAGGAGCAGCTGGAGGAGTCCG GGGGTCGCCTGGTCAAGCCTGACGAAACCCTGACAC TCACCTGCACAGTCTCTGGACTCTCCCTGAATAATTT TGGAGTGAGCTGGGTCCGCCAGGCCCCAGGAAACG GGCTGGAATGGATCAGAGCCATTGATTTTGGTAGTG GTAGCGCATACTACGCGAACTGGGCGAAAAGTCGG TCCACCATCACCAGCAACACTCGCCTGAACACGGTG ACTCTGAAAATGATTAGTCTGACAGCCGCGGACACG GCCACCTATTTTTGTTCGAGAGGAGACATCTGGGGC CCAGGCACCCTGGTCACCGTCTTCTCAGGGCAACCT AAGGCTCCGTCAGTCACTAGTGGCCCGGGAGGCCA SEQ ID NO: TBIfabT14 GCCCAGCCGGCCATGGCTGAGCTCGATATGACCCAG 102 ACTCCATCCTCCGTGTCTGCAGCTGTGGGAGGCACA GTCACCATCAGTTGCCAGGCCAGTCAGAGTGTTTAT AATAACAACAATTTATCCTGGTATCAGCAAAAACCA GGGCAGCCTCCCAAGCTCTTGATCTACGATGCATCC AAATTGGCATCTGGGGTCCCATCGCGGTTCAAAGGC AGTGGATCTGGGACACAGTTCACTCTCACCATTAGC GACCTGGAGTGTGACAATGCTGCCACTTACTTCTGT CAACAGGGTTATGATGGTAGTGATGTTGATAATGTT TTCGGCGGAGGGACCGAGGTGGTGGTCAAGGTGGT TCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGG GCGGTGGTGGGCAGTCGGTGAAGGAGTCCGAGGGA GGTCTCTTCAAGCCAACGGATACCCTGACACTCACC TGCACAGTCTCTGGATTCTCCCTCAGTAACTATGCA ATAAACTGGGTCCGCCAGGCTCCAGGGGAGGGGCT GGAGTGGATCGGCTATATTGATCCTACTTTTGGTAG CACGTACTACGCGAGCTGGGTGAATGACCGATTCAC CATCTCCAGCCACAACGCCCAGAACACGCTGTATCT GCAACTGAACAGTCTGACACCTGCGGACACGGCCA CCTATTTCTGTGCGAGAGATGATATTAGTATTAGTG GTTATTCATTTGACATCTGGGGCCCAGGCACCCTGG TCACCGTCTCCTCAGGGCAACCTAAGGCTCCATCAG TCACTAGTGGCCCGGGAGGCCA SEQ ID NO: TBIfabP9 GGCCCAGCCGGCCATGGCTGAGCTCGTGCTGACCCA 103 GACTCCACCCTCCCTATCTGCATCTGTGGGAGAAAC TGTCAGGATTAGGTGCCTGGCCAGTGAGTTCCTTTTT AATGCTGTATCCTGGTATCAACAGAAGCCAGAGAA ACCTCCTACACTCCCGATCTATGGTGCATCCAATTTA GAATCTGGGGTCCCACCACGGTTCAGTGGCAGTGGA TCTGGGACACAGTTCACTCTCACCATCAGCGACCTG GAGTGTGACGATGCTGCCACTTACTACTGTGCAGGC GATTATAGTGATTGGATTTATGCTTTTGGCGGGGGG ACCGAGGTGGTGGTCAAGGTGGTTCCTCTAGATCTT CCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGGC AGTCGTTGGAGGAGTCCGGGGGAGGTCTCTTCAAGC CTGGAGGATCCCTGACACTCACCTGCACAGTCTCTG GATTCACCATCACTAGCTACCACATGTGCTGGGTCC GCCAGGCTCCAGGGAACGGGCTGGGATGGATCGGA GCCGTTAGTGCTAGCGGACACACATATTACGCGAAC TGGGCGAAAAGCCGATCCACCATCACCAGAGACAC CAACTTAAACACCATGACTCTGAAAATGACCAGTCT GACAGCCGCGGACACGGCCACCTATTTCTGTGCGAC ACCATATCCTGGTTATGATATTGATCCCTTTGACATC TGGGGCCCAGGCACCCTGGTCACCGTCTCCTCAGGG CAACCTAAGGCTCCGTCAGTCACTAGTGGCCCGGGA GGCCA SEQ ID NO: TBIfabP12 GGCCCAGCCGGCCATGGCTGAGCTCGTGCTGACCCA 104 GACTCCATCCTCCGTGCCTGCAGCTGTGGGAGGCAC AGTCACCATCGATTGCCAGTCCAGTGAGAGTGTTTA TAATAACAACAACTTAGCCTGGTATCAGCAGAAACC AGGGCAGCCTCCCAAGCTCCTGATCTACGGGGCATC CACTCTGGCATCTGGGGTCTCATCGCGGTTCAAAGG CAGTGGATCTGGGACAGAGTTCACTCTCACCATCAG CGACCTGGAGTGTGCCGATGCTGCCACTTACTACTG TCAACAGGGTTATAGTATTGGTAATGTAGATAATGC TTTCGGCGGAGGGACCGAGCTGGAGATCCTGGTGGT TCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCGG GCGGTGGTGGGCAGTCGCTGGAGGAGTCCGGGGGA GGTCTCTTCAAGCCAACGGATACCCTGACACTCACC TGCACGGTCTCTGGATTCTCCCTCAGTAGCTATGGA ATTACTTGGGTCCGCCAGGCTCCAGGGAACGGGCTG GAATGGATCGGCGCCATTGGTAGTGATGCTAAAACA TACTACGCGAGCTGGGCGAAAGGCCGATCCACCATC ACCGGAGACACCAACCTGAACACGGTGACTCTGAG AATGACCAGTCTGACAGCCGCGGACACGGCCACCT ATTTCTGTGCGAGATATTTTGATTGGTTTAATGTGGA CATCTGGGGCCCAGGCACCCTGGTCACCGTCTCCTC AGGGCAACCTAAGGCTCCATCAGTCACTAGTGGCCC GGGAGGCCA SEQ ID NO: TBIfabP18 GGCCCAGCCGGCCATGGCTGAGCTCGTGATGACCCA 105 GACTCCAGCCTCTGTGGAGGTAGCTGTGGGAGGCAC TGTCACCATCAAGTGCCAGGCCAGTCAGAGCATTAG TAGCTACTTAGCCTGGTATCAACAGAAACCAGGGCA GCCTCCCAAGCTCCTGATCTACAAGGCTTCCACTCT GGCATCTGGGGTCCCGTCGCGGTTCAAAGGCAGTGG ATCTGGGACACAGTTCACTCTCACCATCAGCGATGT GGTGTGTGACGATGCTGCCACTTACTACTGTGCAGG ATATAAAGGTGGTAGTAGTGATGGTAGTGCTTTCGG CGGAGGGACCGAGCTGGAGATCCTGGTGGTTCCTCT AGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGT GGTGGGCAGTCGGTGAAGGAGTCCGAGGGAGGTCT CTTCAAGCCAACGGATACCCTGACACTCACCTGCAC AGTCTCTGGATTCTCCCTCAGTAGCTATGGAGTGAG CTGGGTCCGCCAGGCTCCAGGGAACGGGCTGGAAT GGATCGGAGCCATTAGTAGTGGTGGTGACGCATACT ACGCGAGCTGGGCGACCAGCCGATCCACCATCACC AGAAACACCAACCTGAACACGGTGACTCTGAAAAT GACCAGTCTGACAGCCGCGGACACGGCCACCTATTT CTGTGCGAGACATTTTGGTTATGGTACTGCTGGGGG CATCTGGGGCCCAGGCACCCTCGTCACCGTCTCTTC AGGGCAACCTAAGGCTCCGTCAGTCACTAGTGGCCC GGGAGGCCA SEQ ID NO: TBIfabP19 GGCCCAGCCGGCCATGGCTCAGCCTGTGCTGACTCA 106 GTCGCCCTCTGCATCTGCTGCCCTGGGATCCTCGGC CAAGCTCACCTGCACTCTGAGCAGTGCTCACAAGAC CTACTATATTGAATGGTATCAGCAGCAGCAAGGGGA GGCCCCTCGGTACCTGATGCAGGTTAAGAGTGATGG AAGCTACACCAAGGGGACCGGGGTCCCTGATCGCTT CTCGGGCTCCAGCTCTGGGGCTGACCGCTACTTGAT CATCCCCAGCGTCCAGGCTGATGACGAAGCCGACTA CTATTGTGGTGCAGATTATAGCGGTGGGTATGTGCT CGGCGGAGGGACCCAGCTGACCGTCACAGGTGGTG GTTCCTCTAGATCTTCCTCCTCTGGTGGCTCGGGCGG TGGTGGGCAGTCGGTGGAGGAGTCCGGGGGAGGTC TCTTCAAGCCAGCGGATACCCTGACACTCACCTGCA CAGTCTCTGGATTTTCCCTCAGTTACCCTGGAGTGA GCTGGGTCCGCCAGGCTCCAGGGAACGGGCTGGAA TACATCGGATTCATTAATGCTGATGGTGACTCATAC TACCCGACCTGGGCGAAACGCCGATCCACCATCACC AGAAACACCAACCTGAACACGGTGACTCTGAAAAT GACCAGTCTCACAGCCGCGGACACGGCCACCTATTT CTGTGCGAGAGAGGGTGGCTGGGGTACATTGTTTGG TGCTTTTGATTCCTGGGGCCCAGGCACCCTAGTCAC CGTCTTCTCAGGGCAACCTAAGGCTCCGTCAGTCAC TAGTGGCCCGGGAGGCCA SEQ ID NO: TBIfabT114 GGCCCAGCCGGCCATGGCTCAGCCTGTGCTGACTCA 107 GTCGCCCTCTGCATCTGCTGCCCTGGGATCCTCGGC CAAGCTCACCTGCACTCTGAGCAGTGCTCACAAGAC CTACTATATTGACTGGTATCAGCAGCAGCAAGGGGA GGCCCCTCGGTACCTGATGCAGCTTGGGAGTGATGG AAGTTACACCAAGGGGACCGGGGTCCCTGATCGCTT
CTCGGGCTCCAGCTCTGGGGCTGACCGCTACTTGAT CATCCCCAGCGTCCAGGCTGATGACGAAGCCGACTA CTATTGTGGTTCAGATTATAGCGGTGGGTATGTGTT CGGCGGAGGGACCCAGCTGACCGTCACAGGTGGTG GTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTC GGGCGGTGGTGGGCAGTCGCTGGAGGAGTCCGGGG GAGGTCTCTTCAAGCCAGCGGATACCCTGACACTCG CCTGCACAGTCTCTGGATTCTCCCTCAGTACTTATGG AGTGATCTGGGTCCGCCAGGCTCCAGGGAAGGGGC TGGAATACATCGCATACATTAATTATAGTGGTAGTC CATACTACGCGAGCTGGGCGAAAAGCCGATCCACC ATCACCAGAAACACCAACGAGAAAACGGTGACTCT GAAAATGACCAGTCTGACAGCCGCGGACACGGCCA CCTATTTCTGTGCGAGGGGTGTTCCTGGTTACAATG CGGATATGGGGGACATCTGGGGCCCAGGCACCCTG GTCACCGTCTTCTCAGGGCAACCTAAGGCTCCATCA GTCACTAGTGGCCCGGGAGGCCA SEQ ID NO: TBIfabT116 GGCCCAGCCGGCCATGGCTCAGCCTGTGCTGACTCA 108 GTCGCCCTCTGTGTCTGCCGCCCTGGGAGCCTCTGC CAAGCTCACCTGCACCCTGAGCAGTGCCCACAAGAC CTACACCATTGATTGGTATCAGCAGCAGCAAGGGGA GGCCCCTCGGTACCTGATGCAGCTTAAGAGTGATGG AAGCTACACCAAGGGGACCGGGGTCCCTGATCGCTT CTCGGGCTCCAGCTCTGGGGCTGACCGCTACTTGAT CATCCCCAGCGTCCAGGCTGATGACGAAGCCGACTA CTATTGTGGTGCAGATTATAGCGGTGGGTATGTGTT CGGCGGAGGGACCCAGCTGACCGTCACAGGTGGTG GTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTC GGGCGGTGGTGGGCAGTCGGTGGAGGAGTCCAGGG GGAGGTCTCTTCAAGCCAACGGATACCCTGACACTC ACCTGCACAGTCTCTGGATTCTCCCTCAGTGGCTAT GGAGTGAGCTGGGTCCGCCAGGCTCCAGGGAACGG GCTGGAATGGATCGGAGCCATTAGTAGTGGTGGTAG CGCATACTACGCGAGATGGGCGAAAAGCCGCTCCA CCATCACCAGAAACACCAACCTGAACACGGTGACTC TGAAAATGACCAGTCTGACAGCCGCGGACACGGCC ACCTATTTCTGTGCGAGAGGTTACTATACTGCTATTG GTGGTACTTATGACAATGCTTTTGATCCCTGGGGCC CAGGCACCCTGGNCACCGTCTCCTCAGGGCAACCTA AGGCCAGTCACTAGTGGCCCGGGAGGCCA SEQ ID NO: TBIfabT124 GGCCCAGCCGGCCATGGCTGAGCTCGATATGACCCA 109 GACTCCACCCTCCCTGTCTGCATCTGTGGGAGAAAC TGTCAGGATTAGGTGCCTGGCCAGTGAGGACATTGG CAGTGCTATATCCTGGTACCAACAGAAGCCAGGGA AACCTCCTACACTCCTGATCTATGGTGTATTTAATTT AGAATCTGGGGTCCCACCACGATTCAGTGGCAGTGG ATCTGGGACAGATTACACCCTCACCATTGGCGGCGT GCAGGCTGAAGATGCTGCCACCTACTACTGTCTAGG CGGTGCTAGTGACAGTAGTACCGGTTTGACTTTTGG AGCTGGCACCAATGTGGAAATCAAGGTGGTTCCTCT AGATCTTCCTCCTCTGGTGGCGGTGGCTCGGGCGGT GGTGGGCAGTCGGTGAAGGAGTCCGAGGGAGGTCT CTTCAAGCCAACGGATACCCTGACACTCACCTGCAC AGTCTCTGGATTCTCCCTCAGTAACTATGGAGTGAG CTGGGTCCGCCAGGCTCCAGGGAACGGGCTGGAAT ACATCGGCTTCATTAGTAACGGTGGTGCCACATTCT ACGCGACCTGGGCGAGAAGCCGAGCCACCATCACC AGAAACACCGGCCTGAACACGGTGGCTCTGACAAT GACCAGTCTGACAGCCGCGGACACGGCCACCTATTT CTGTGTGAGGGATTCTGTTGCTACTTATGCTACTGAT GTTGCTGCTTTTGATCCCTGGGGCCCAGGCACCCTG GTCACCGTCTCCTCAGGGCAACCTAACTCCGTCAGT CACTAGTGGCCCGGGAGGCCA SEQ ID NO: TBIfabT129 GCCCAGCCGGCCATGGCTCAGCCTGTGCTGACTCAG 110 TCGCCCTCCCTGTCTGCGTCTCTGGGCACAACGGCC AGACTCACCTGCACCCTGAGCACTGGCTACAGTGTT GGCGAGTACCCTTTAGTGTGGCTCCAGCAGGTGCCA GGGAGGCCTCCCAGGTATCTCCTGAGCTTCACCTCA GATGAAGACAAACACCATGACTCTTGGGGCCCCACC CGCTTTTCTGGATCCAAAGACACCTCAGAGAATACC TTTATCCTGAGCATCTCTGGGCTGCAGCCCGAGGAC GAGGCCGACTATTACTGTGCTACAGCTCATGGTAGT GATAACAGCCTCCATTATGTCTTCGGCGGAAGGACC CAGCTGACCGTCACAGGTGGTGGTTCCTCTAGATCT TCCTCCTCTGGTGGCGGTGGCTCGGGCGGTGGTGGG CAGTCGGTGAAGGAGTCCGAGGGAGGTCTCTTCAA GCCAACGGATACCCAGACACTCACCTGCACAGTCTC TGGATTCTCCCTCAGTAGCAATGCAATAAGCTGGGT CCGCCAGGCTCCAGGGAACGGGCTGAAAAGCATCG GATTCATTAATAGTGGTGGTGGCGCATATTACGCGA CCTGGGCGAAAAGCCGATCCACCATCACCAGAAAC ACCAACGAGAACACGGTGACTCTGAAAATGACCAG TCTGACAGCCGCGGATACGGCCACCTATTTCTGTGC GAGAACACCCCATTATTATGATACTTATGATACCTC ATTTAACATATGGGGCCCAGGCACCCTGGTCACCGT CTTCTCAGGGCAACCTAAGGCTCCGTCAGTCACTAG TGGCCCGGGAGGCCA SEQ ID NO: TBIfabT134 GGCCCAGCCGGCCATGGCTCAGCCTGTGCTGACTCA 111 GTCGCCCTCTGCATCTGCTGCCCTGGGATCCTCGGC CAAGCTCACCTGCACTCTGAGCAGTGCTCACAAGAC CTACTATATTGAATGGTATCAGCAGCAGCAAGGGGA GGCCCCTCGGTACCTGATACAACTTAAGAGTGATGG AAGCTACACCAAGGGGACCGGGGTCCCTGATCGCTT CTCGGGCTCCAGCTCTGGGACTGACCGCTACTTGAT CATCTCCAGCGTCCAGGCTGAGGACGAAGCCGACTA CTCTTGTGGTGCAGATTATAGTGGTGGGTTTGTGTTC GGCGGAGGGACCCAGCTGACCGTCACAGGTGGTGG TTCCTCTAGATCTTCCTCCTCTGGTGGCGGTGGCTCG GGCGGTGGTGGGCAGTCGCTGGAGGAGTCCGGGGG AGGTCTCTTCAAGCCAACGGATACCCTGACACTCAC CTGCACAGTCTCTGGATTCGCCCTCAATAACTACAA CATACACTGGGTCCGCCAGGCTCCAGGGAACGGGCT GGAATGGATCGGAGCCATTGGTAGTAGTGGTAGCG CATACTACGCGAGCTGGGCGAAAAGCCGATCCACC ATCACCAGAAACACCAACCTGAACACGGTGACTCTG AAAATGACCAGTCTGACAGCCGCGGACACGGCCAC CTATTTCTGTGCGAGAGGTTATAATTCTGATGATTCT TATCTCTGGGGCCCAGGCACCCTGGTCACCGTCTCC TCAGGGCAACCTAAGGCTCCATCAGTCACTAGTGGC CCGGGAGGCCA SEQ ID NO: TBIfabP212 CCGGCCATGGCTGAGCTCGTGCTGACCCAGACTCCA 112 CCCTCCCTGTCTGCATCTGTGGGAGGCACAGTCACC ATAAACTGTCTGGCGAGTGAGAACGTCTACAGTGCT GTAGCCTGGTATCAACAGAAGCCAGGGAAACCTCCT ACACTCCTGATCTCTGGTACATCCAATTTAGAGGCT GGGGTCCCACCACGGTTCAGTGGCAGTGGATCTGGG ACAGATTACACCCTCACCATCGGCGGCGTGCAGGCT GAAGATGCTGCCACTTACTTCTGTCAAGGGTATAGC AGTTACCCTTTGACTTTTGGAGCTGGCACCAATGTG GAAATCAAGGTGGTTCCTCTAGATCTTCCTCCTCGG TGGCGGTGGCTCGGGCGGTGGTGGGCAGTCGGTGG AGGAGTCCAGGGGGGAGGCCTGGTCAAGCCTGGGG ATACCCTCACACTCACCTGCACAGTCTCTGGATTCC CCCTCAGCAGCTACGACATGAACTGGGTCCGCCAGG CTCCAGGGGAGGGGCTGGAATGGATCGGATGGATT ACTTATGATGGTTACAATCACTACGCGAGCTGGGCG AATGGCCGATCCACCATCACCAGAAACACCAACGA GAACGCGGTGACTCTGAAAATGACCAGTCTGACAG CCGCGGACACGGCCACCTATTTCTGTGCGCGAGATT ACTATAATGGTGCTTATGTTTATGCCTTTAACATCTG GGGCCCAGGCACCCTGGTCACCGTCTCCTCAGGGCA ACCTAAGGCTCCATCAGTCACTAGTGGCCCGGGAGG CCA
TABLE-US-00003 TABLE 3 PCR Primer Sequences SEQ ID NO SEQ NAME NUCLEIC ACID SEQUENCE SEQ ID NO: SKVHF01 GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTG 113 GCTCGGGCGGTGGTGGGCAGTCGGTGGAGGAGTCCR GG SEQ ID NO: SKVHF02 GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTG 114 GCTCGGGCGGTGGTGGGCAGTCGGTGAAGGAGTCCG AG SEQ ID NO: SKVHF03 GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTG 115 GCTCGGGCGGTGGTGGGCAGTCGYTGGAGGAGTCCG GG SEQ ID NO: SKVHF04 GGTGGTTCCTCTAGATCTTCCTCCTCTGGTGGCGGTG 116 GCTCGGGCGGTGGTGGGCAGSAGCAGCTGGWGGAG TCC SEQ ID NO: SKCHR01 TGGTGTTGGCCTCCCGGGCCACTAGTGACTGAYGGA 117 GCCTTAGGTTGC SEQ ID NO: SKOVERPA TGGTGTTGGCCTCCCGGGCCACTA 118 DR1 SEQ ID NO: SKVLKF01 GGGCCCAGCCGGCCATGGCTGAGCTCGTGMTGACCC 119 AGACTCCA SEQ ID NO: SKVLKF02 GGGCCCAGCCGGCCATGGCTGAGCTCGATMTGACCC 120 AGACTCCA SEQ ID NO: SKVLKF03 GGGCCCAGCCGGCCATGGCTGAGCTCGTGATGACCC 121 AGACTGAA SEQ ID NO: SKVLLF01 GGGCCCAGCCGGCCATGGCTGAGCTCGTGCTGACTC 122 AGTCGCCCTC SEQ ID NO: SKVLLF02 GGGCCCAGCCGGCCATGGCTCAGCCTGTGCTGACTC 123 AGTCG SEQ ID NO: SKOVERPA TACTCAGGGCCCAGCCGGCCATGGCTGA 124 DF1 SEQ ID NO: SKVLKR01 GGAAGATCTAGAGGAACCACCAGGATCTCCAGCTCG 125 GTCCC SEQ ID NO: SKVLKR02 GGAAGATCTAGAGGAACCACCTTGATTTCCACATTG 126 GTGCC SEQ ID NO: SKVLKR03 GGAAGATCTAGAGGAACCACCTTGACSACCACCTCG 127 GTCCC SEQ ID NO: SKVLLR01 GGAAGATCTAGAGGAACCACCACCTGTGACGGTCAG 128 CTGGGTCC SEQ ID NO: SKpf41F01-2 TAAGCAGAATTCGGCCCAGCCGGCCGCGGTGGGAAC 129 ACTAGGA SEQ ID NO: SKpf41F02-3 AGCAGAATTCTGGCCCAGCCGGCCGCGGTGGGAACA 130 CTAG SEQ ID NO: SKpf41F03-4 AGCAGAATTCTAGGCCCAGCCGGCCGCGGTGGGAAC 131 ACTA SEQ ID NO: SKpf41R01-2 CTCTAGATCTGGCCTCCCGGGCCTTTTTATATACCAC 132 AGCCAGTTTG SEQ ID NO: SKpf41R01-3 CTCTAGATCTAGGCCTCCCGGGCCTTTTTATATACCA 133 CAG SEQ ID NO: SKpf41R01-4 CTCTAGATCTATGGCCTCCCGGGCCTTTTTATATACC 134 ACA SEQ ID NO: SKRTlucF01 AACATAAAGAAAGGCCCGGC 135 SEQ ID NO: SKRTlucR01 GCCTTATGCAGTTGCTCTCCA 136
[0113] SEQ ID NOs 113-128 are used for amplification of rabbit VL and VH cDNA for production of the phagemid inserts.
[0114] SEQ ID NOs 129-134 are used for amplification of gp41, ligation into the pFUSE hIgG1-2 vector, and excision to generate sfiI restriction sites in multiple frames.
[0115] SEQ ID NOs 135-136 are used for amplification of firefly luciferase reverse transcripts produced in the Reverse Transcriptase assay.
[0116] In one embodiment, a gene encoding an anti-virus particle product antibody is chemically synthesized. Nucleotide sequences encoding the amino acid sequences shown in Table 1 are selected, broken into multiple oligonucleotides, chemically synthesized, and successively ligated together, to produce a gene encoding an anti-virus particle product antibody.
[0117] Once an antibody or ABP sequence is known, particularly the CDRs, any suitable method of making an ABP therefrom can be employed, including both cell-based and cell-free methods. Various methods of cell-free antibody synthesis are found in Carlson, E et al., Biotechnology Advances, 2012, 30: 1185-94. In cell-based methods, an anti-virus particle product monoclonal antibody or ABP gene is inserted into an expression vector for construction of a recombinant expression vector. An expression vector generally has a promoter region upstream of a translation start codon (ATG), as well as a polyA signal region downstream of a translation stop codon (TAA, TGA, or TAG). A recombinant expression vector is introduced into a host cell, and the transformed host cells are cultured to express the anti-virus particle product monoclonal antibody. Escherichia coli, yeast, or other animal cells can be used as host cells.
[0118] An immunoassay using an anti-virus particle product monoclonal antibody (or fragment thereof) can be used to detect the presence of HIV. In one embodiment, the immunoassay procedure involves allowing an anti-virus particle product monoclonal antibody to react with a sample including an antigen, and allowing any resulting antigen-antibody complex to further react with an antibody having a detectable label. In a further embodiment, detection or quantification of the antibody may be performed by a method such as enzyme-linked immunosorbent assay (ELISA), fluorescent immunoassay, radioimmunoassay (RIA), luminescent immunoassay, enzyme antibody technique, fluorescence antibody technique, immunonephelometry, latex agglutination reaction, latex turbidimetry method, hemagglutination, particle agglutination, Western blotting method, competition method, or sandwich method. In a further embodiment, the sandwich method uses a solid-phased antibody or a labeled antibody as the anti-virus particle product monoclonal antibody.
[0119] In some embodiments, the monoclonal antibody is sensitized/immobilized to a solid phase carrier, such as polystyrene, styrene-butadiene copolymer, (meth)acrylic acid ester polymer, latex, gelatin, a liposome, a microcapsule, erythrocyte, silica, alumina, carbon black, a metallic comipound, metal, ceramic, or a magnetic body. Sensitization methods include physical adsorption method, chemical bond method, or a combined physical adsorption and chemical bond method. In an embodiment, measurement is performed using an optical method, such that the sample reacts with an antibody (sensitized to a solid phase carrier or unsensitized), and a transmitted or scattering light is measured by an end point method or a rate method. In another embodiment, measurement is performed by visual observation, such that the sample reacts with an antibody that has been sensitized to a solid phase carrier in a vessel (for example, a plate or microtiter plate), and the agglutinated reaction product is visually observed. A microplate reader is further used in some embodiments to observe the agglutinated reaction product.
[0120] In a like manner, TEGS can be used in any suitable immunoassay format, such as those described above, to detect and/or quantify HIV antibodies or ABPs in a sample. TEGS can be immobilized on an immunoassay support in, for example, a standard sandwhich format, or used in solution in, for example, a standard competition assay.
[0121] FIG. 1 provides an illustrated flowchart that summarizes a method for producing TEGS, according to an embodiment. First, the HIV virus is isolated from multiple sources of acute infection virus (i.e., from antibody low/negative subjects) by using specialized coated beads (102). Next, the virus is propagated in a purified and homogenous cell substrate (104). In an embodiment, the virus is propagated in serum-free medium. The number of passages of virus is minimized, and the capacity of the cell substrate to produce type 1 interferons (e.g., interferon-alpha), type 2 interferons (e.g., interferon-gamma), and beta-chemokines (e.g., RANTES, MIP1 alpha, and MIP1 beta) is reduced. The cytokines can inhibit virus replication and add complexity to the TEGS composition. Next, the fluid containing the virus is concentrated by using molecular weight cutoff (MWCO) filters (106). Use of serum-free medium is required in an embodiment to use the MWCO filters, to prevent clogging the filter pores. Thus, ultracentrifugation, which potentially disrupts any non-covalently attached envelope proteins, is not required. Next, the fluid containing virus is treated with agents to inactivate virus (108). These agents include a cyclodextrin and Benzonase. In an embodiment, the fluid containing the virus is additionally exposed to heat (e.g., 56° C. or less). The fluid containing the virus is then processed to remove any inactivating agents (110). In one embodiment, a smaller MWCO filter (such as a 10 KDa filter) is used for this step to prevent the loss of free gp41. Finally, the inactivated virus composition is reconstituted in final buffer (112). In some embodiments, the final buffer is dPBS with no calcium or magnesium ions. Additives (such as azide or PEG) are used in some embodiments to stabilize proteins and prevent microbial contamination. In other embodiments, other additives such as CpG-rich DNA are used to boost localized immune response to TEGS.
[0122] Pharmaceutical Compositions of the Invention
[0123] Methods for treatment of diseases are also encompassed by the present invention. Said methods of the invention include administering a therapeutically effective amount of anti-virus particle product antibody (for example, a TEGS-specific antibody) for preventing or treating HIV infection. These antibodies can be formulated in pharmaceutical compositions. These compositions can comprise, in addition to one or more of the anti-virus particle product antibody, a pharmaceutically acceptable excipient, carrier, buffer, stabilizer or other materials well known to those skilled in the art. Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient. The precise nature of the carrier or other material can depend on the route of administration, e.g. oral, intravenous, cutaneous or subcutaneous, nasal, intramuscular, intraperitoneal routes.
[0124] For intravenous, cutaneous or subcutaneous injection, or injection at the site of affliction, the active ingredient will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability. Those of relevant skill in the art are well able to prepare suitable solutions using, for example, isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection. Preservatives, stabilisers, buffers, antioxidants and/or other additives can be included, as required.
[0125] Other routes of administration of the pharmaceutical composition are in accord with known methods, e.g. orally, through injection by intraperitoneal, intracerebral (intra-parenchymal), intracerebroventricular, intramuscular, intra-ocular, intraarterial, intraportal, intralesional routes, intramedullary, intrathecal, intraventricular, transdermal, or intraperitoneal; as well as intranasal, enteral, topical, sublingual, urethral, vaginal, or rectal means, by sustained release systems or by implantation devices. Administration is preferably in a "therapeutically effective amount" or "prophylactically effective amount" (as the case can be, although prophylaxis can be considered therapy), this being sufficient to show benefit to the individual. The actual amount administered, and rate and time-course of administration, will depend on the nature and severity of protein aggregation disease being treated. Prescription of treatment, e.g. decisions on dosage etc, is within the responsibility of general practitioners and other medical doctors, and typically takes account of the disorder to be treated, the condition of the individual patient, the site of delivery, the method of administration and other factors known to practitioners. Examples of the techniques and protocols mentioned above can be found in Remington's Pharmaceutical Sciences, 16th edition, Osol, A. (ed), 1980.
[0126] A composition can be administered alone or in combination with other treatments, either simultaneously or sequentially dependent upon the condition to be treated.
[0127] The pharmaceutical compositions of the present invention are preferably made under GMP conditions. It is also preferred that the compositions are packaged in a suitable sterile container, typically in a unit dosage form. The composition can be administered for therapeutic or prophylactic reasons. For example, therapeutic TEGS-specific antibodies can be administered as a substitute for an anti-retroviral drug. Therapeutic antibodies can also be administered in addition to an anti-retroviral drug, and/or added to a combination of antiretroviral drugs in Highly Active Anti-Retroviral Therapy (HAART). In an embodiment, this combination of antibody and antiretroviral drug is administered to a patient who is failing antiretroviral therapy. In another embodiment, the composition is administered prophylactically for protection of a fetus from an infected mother.
[0128] An effective amount of a pharmaceutical composition to be employed therapeutically will depend on the therapeutic context and objectives. One of skill in the art will appreciate that appropriate dosage levels for treatment will vary depending on the indication for which the therapeutic antibody is being used, the route of administration, and the size and condition of the patient. A typical dosage may range from about 0.1 mg/kg to up to about 100 mg/kg or more. Therapeutic antibodies may be preferably injected or administered intravenously. In some embodiments, the antibodies are lyophilized.
[0129] In some embodiments, therapeutic antibodies are administered at a dosage of from about 1 ng of antibody per kg of subject's weight per dose, to about 10 mg/kg/dose, or preferably from about 500 ng/kg/dose to about 5 mg/kg/dose. In other embodiments, a dosage for subcutaneous or intravenous administration of a dose of 0.5, 1, 3, 5, 6, 7, 8, 9, 10, 11, 12, 15, or 20 milligrams of therapeutic antibody is administered per kilogram body mass of the subject (mg/kg) (Flego et al, BMC Medicine 2013, 11:4). The dose can be administered once to the subject, or more than once at a certain interval, for example, once a day, three times a week, twice a week, once a week, three times a month, twice a month, once a month, once every two months, once every three months, once every six months, or once a year. The duration of the treatment, and any changes to the dose and/or frequency of treatment, can be altered or varied during the course of treatment in order to meet the particular needs of the subject.
[0130] The term "pharmaceutical agent composition" (or agent or drug) as used herein refers to a chemical compound, composition, agent or drug capable of inducing a desired therapeutic effect when properly administered to a patient. It does not necessarily require more than one type of ingredient.
[0131] The term "therapeutically effective amount" refers to the amount of an agent determined to produce a therapeutic response in a mammal Such therapeutically effective amounts are readily ascertained by one of ordinary skill in the art.
[0132] The term "modulator," as used herein, is a compound that changes or alters the activity or function of a molecule. For example, a modulator can cause an increase or decrease in the magnitude of a certain activity or function of a molecule compared to the magnitude of the activity or function observed in the absence of the modulator. In certain embodiments, a modulator is an inhibitor, which decreases the magnitude of at least one activity or function of a molecule. Certain exemplary activities and functions of a molecule include, but are not limited to, binding affinity, enzymatic activity, and signal transduction. Certain exemplary inhibitors include, but are not limited to, proteins, peptides, antibodies, peptibodies, carbohydrates or small organic molecules. Peptibodies are described in, e.g., U.S. Pat. No. 6,660,843 (corresponding to PCT Application No. WO 01/83525).
[0133] The terms "patient" and "subject" are used interchangeably and include human and non-human animal subjects as well as those with formally diagnosed disorders, those without formally recognized disorders, those receiving medical attention, those at risk of developing the disorders, etc. In some embodiments, the patient is a human subject with a homozygous deletion of 32 base pairs in the CCR5 gene, which encodes a major HIV-1 coreceptor (Buseyne F et al., J Infect Dis 1998, 178: 1019-1023). In an embodiment, the patient is a human subject who is failing antiretroviral therapy.
[0134] The term "treat" and "treatment" includes therapeutic treatments, prophylactic treatments, and applications in which one reduces the risk that a subject will develop a disorder or other risk factor. Treatment does not require the complete curing of a disorder and encompasses embodiments in which one reduces symptoms or underlying risk factors.
[0135] In an embodiment, an anti-virus particle product monoclonal antibody is formulated into a pharmaceutical composition and administered to a human patient. In a further embodiment, the dosage for the treatment is dependent on the degree of symptoms, age, and body weight of the patient, as well as the administration method. The antibody weight for the pharmaceutical composition ranges from 10 ng to 100 mg/kg of body weight, in an embodiment.
EXAMPLES
[0136] Below are examples of specific embodiments for carrying out the present invention. The examples are offered for illustrative purposes only, and are not intended to limit the scope of the present invention in any way. Efforts have been made to ensure accuracy with respect to numbers used (e.g., amounts, temperatures, etc.), but some experimental error and deviation should, of course, be allowed for.
[0137] The practice of the present invention will employ, unless otherwise indicated, conventional methods of protein chemistry, biochemistry, recombinant DNA techniques and pharmacology, within the skill of the art. Such techniques are explained fully in the literature. See, e.g., T. E. Creighton, Proteins: Structures and Molecular Properties (W.H. Freeman and Company, 1993); A. L. Lehninger, Biochemistry (Worth Publishers, Inc., current addition); Sambrook, et al., Molecular Cloning: A Laboratory Manual (2nd Edition, 1989); Methods In Enzymology (S. Colowick and N. Kaplan eds., Academic Press, Inc.); Remington's Pharmaceutical Sciences, 18th Edition (Easton, Pa.: Mack Publishing Company, 1990); Carey and Sundberg Advanced Organic Chemistry 3rd Ed. (Plenum Press) Vols A and B(1992).
Example 1
Manufacture of the Virus Particle Product
[0138] Those of ordinary skill in the art can appreciate that there are many processes employed in the production of the non-infectious virus particle product that retains trimeric envelope glycoprotein subunits (TEGS) in their natural state. While TEGS is the virus particle product in the following examples, other virus particle products may also be produced and used. In a preferred embodiment, infectious virus stocks were prepared from plasma in mitogen-stimulated PBMC or CD4+ blood cells (Vyas G N. Human peripheral blood mononuclear cell substrate for propagating wild type HIV-1, Dev Biol (Basel) 2001 106:345-356), purified and concentrated, and then inactivated by treatment to deplete membrane cholesterol, capsid proteins, and RNA (FIG. 1).
Example 2
Production of High-Titer HIV-1 Stocks
[0139] The production of the viral particle product requires appreciable amounts of infectious virus. In a preferred embodiment, high-titer stocks of HIV were produced using HIV isolated from HIV-infected individuals who were in the earliest stage of infection prior to antibody detection. Such viruses have been called `Fiebig I/II` isolates or `founder` viruses (Fiebig E W, et al., AIDS 2003, 17:1871-1879; Keele B F et al. Proc Nat'l Acad Sci 2008, 105: 7552-7557). The expansion of virus was performed using primary blood cells that can be obtained from blood banks while preserving the anonymity of the blood donors. Primary blood cells were used to expand the virus in its most natural form, as opposed to the use of cell lines that produce variants of the original virus.
[0140] Peripheral blood mononuclear cells (PBMCs) were isolated by routine Ficoll density gradient separation procedures (Vyas G N et al., Biologicals, 2012 40: 15-20). To further purify blood cells for use in the expansion of virus, CD4+ cells were isolated from the PBMC by positive selection using immunomagnetic beads or other cell sorting methods. The PBMC or PBMC subpopulation was stimulated with PHA (1-3 micrograms per ml) for 2-4 days in medium A or B; medium A is the traditional growth medium that is comprised of RPMI 1640, 10% heat-inactivated fetal calf serum, 2 mM L-glutamine, 100 U/ml penicillin, 100 μg/ml streptomycin, and 10 ng/ml recombinant human IL-2; medium B is a preferred growth medium that is comprised of F12/DMEM, 1× insulin, transferrin, selenium (ITS), and 10 ng/ml recombinant human IL-2. The use of medium B has advantages including that viral particle products can be produced in the absence of serum. The mitogen-stimulated primary cells were acutely infected for 2 hr (37° C. with periodic mixing) with infectious virus (e.g., 10e4 TCID50).
[0141] Five days later, the virus-infected cells were collected, washed, and mixed (1:10) with fresh mitogen-stimulated cells to allow for virus expansion. These cells (10e9/device) were then placed into a gas permeable rapid cell expansion device (e.g., G-Rex bioreactor, Wilson Wolf, New Brighton, Minn.). The cell culture fluids were collected and exchanged with fresh complete medium every 3 days for a period of 9-21 days. Peak virus concentrations (˜1 ug/ml p24) were observed at days 6-12 in many cases. HIV-1 levels were measured by p24 ELISA or assays for reverse transcriptase activity.
[0142] In FIG. 1A, it is demonstrated that the preferred procedures allow for substantial gains in the amount of virus produced in cell culture. In this case, the use of a bioreactor for the culture of virus-infected cells was found to be superior to the use of a conventional flask.
[0143] In another method of producing high-titer HIV-1 stocks, peripheral blood mononuclear cells (PBMCs) were isolated by routine Ficoll density gradient separation procedures (Vyas G N et al., Biologicals, 2012 40: 15-20). To further purify blood cells for use in the expansion of virus, CD4+ cells were isolated from the PBMC by positive selection using immunomagnetic beads or other cell sorting methods. The PBMC or PBMC subpopulation was stimulated with PHA (1-3 micrograms per ml) for 2-4 days in medium A or B; medium A is the traditional growth medium that is comprised of RPMI 1640, 10% heat-inactivated fetal calf serum, 2 mM L-glutamine, 100 U/ml penicillin, 100 μg/ml streptomycin, and 10 ng/ml recombinant human IL-2; medium B is a preferred growth medium that is comprised of F12/DMEM, 1× insulin, transferrin, selenium (ITS), and 10 ng/ml recombinant human IL-2. The use of medium B has advantages including that viral particle products can be produced in the absence of serum. The mitogen-stimulated primary cells were acutely infected for 2 hr (37° C. with periodic mixing) with infectious virus (e.g., 10e4 TCID50). Next, the virus-infected cells were collected and expanded as described above.
Example 3
Measuring Viruses and Virus Particle Products
[0144] The assay most widely used in research laboratories for measuring HIV levels is an ELISA that detects the p24 capsid protein. The p24 protein is the most abundantly produced virus protein in infected cells and is the most abundant protein in the virus. Thus, the p24 ELISA is a useful assay for detecting the presence of HIV. However, because the majority of p24 is not incorporated into the virus and because p24 is present in defective viruses, the p24 ELISA does not reliably measure infectious viruses. An alternative assay measures levels of the virus reverse transcriptase protein. The present application embodies a preferred method for measuring virus reverse transcriptase: a one-step quantitative non-radioactive RT-PCR method. The method involved pelleting virus from an aliquot of the sample to be tested, lysis of the pelleted virions, the addition of a reaction mixture, incubations of varying lengths of time at various temperatures, and the acquisition and analysis of the data. This method is applied to the measurement of HIV, other viruses, and virus-like constructs.
[0145] In the case of FIG. 2, it is demonstrated that a quantitative RT-PCR assay has been validated and optimized for the measurement of virus. The left panel shows the performance of serial dilutions (10-fold) of a purified virus reverse transcriptase enzyme. The right panel shows the assay applied to the measurement of HIV at days 4, 7, and 10 of cell culture.
Example 4
Refinement of the Virus Particle Product
[0146] The preferred method for the production of a virus particle product from an infectious virus stock employs gentle virus inactivation procedures collectively termed "cholesterol extraction with nucleic acid depletion" or "CENAD". Briefly, fluids containing infectious virions were concentrated using centrifugal filtration devices (e.g., 100 kDa molecular weight cut off, MWCO) and/or ultracentrifugation. The retentate or pellet was treated with beta-cyclodextrin to remove membrane-bound cholesterol, permeabilize the virions, and to expel capsid proteins, reverse transcriptase and viral RNA (Graham D R et al., J Virol 2003, 77: 8237-8248). The resulting viral particle product was further washed and concentrated using centrifugal filtration devices (e.g., 100 kDa MWCO, Millipore). This method for producing the virus particle product is a modified (streamlined and optimized) version of the one reported by Vyas et al (Vyas G N et al., Biologicals 2012, 40: 15-20).
Example 5
Coupling Multiple Virus Particle Products
[0147] The virus particle products derived from distinct infectious viruses can vary in protein sequence and structure. Therefore, collections of pooled virus particle products can be more diverse in protein composition than individual virus particle products (Vyas G N. Dev Biol (Basel) 2001, 106: 345-356; Vyas G N et al., Biologicals 2012, 40: 15-20). The simplest procedure for creating diverse virus particle products is to combine equal or non-equal amounts of individual virus particle products in a single vessel. The surface of a microsphere is coated with a variety of virus particle products. This is achieved by co-incubating virus particle products with DC-SIGN-expressing lipoparticles in PBS (pH7, 30 min, 4° C.), followed by washing and concentrating steps using 100 kDa MWCO filters. Alternatively, specialized microparticles such as Virobeads (AdemTech) can be employed to capture virus particle products. We have termed microparticles that are coated with pooled virus particle products "iTEGS". In one example, iTEGS is used as an antigen that presents multiple virus particle products in a concentrated format. A product that displays multiple virus particle products is highly useful for vaccines that present multiple antigens from one or several different types of viruses.
[0148] In the case of FIG. 3, a diagram of one type of iTEGS is presented. In this case, viral particle products are produced from multiple clades of HIV-1. Then the viral particle products are pooled and captured with a microparticle (e.g., DC-SIGN-expressing lipoparticles or Virobeads)
Example 6
Metrics of ABPs
[0149] TEGS is useful for the capture, analysis, and/or measurement of ABPs. An example is the use of the virus particle product as a means to capture anti-virus antibodies on a solid platform. The method involved coating a surface, such as high-binding plastic, with the virus particle product, followed by the input of a source that potentially contained anti-viral antibodies. After an incubation period of 1-2 hours, the surface was washed, and then bathed in a detection antibody that broadly bound antibodies from the species used to generate the anti-viral antibody. Emphasized is that the virus particle product, where displaying natural envelope proteins, binds to antibodies that would otherwise remain unbound by viral proteins that have been subjected to procedures that disrupt the natural envelope structure. Thus the present virus particle product has advantages over commonly used virus lysates that are prepared using procedures that disrupt the natural structure of envelope proteins. The use of the virus particle product can be applied to a wide variety of immunodetection platforms including ELISA, ELISpot assays, bead-based assays, flow cytometry, mass spectrometry, microscopy-based assays, and Western and other blot-based assays.
[0150] In the case of FIG. 4, it is demonstrated that the virus particle product can be used for the capture, detection and measurement of anti-virus particle product ABPs. The left panel shows raw RT-PCR data from an experiment where a virus-particle-product-specific antibody (J3) (McCoy et al., J Exp Med 2012: 209(6) 1091-103) was incubated with a virus particle product and then evaluated for infectivity in cell culture. The right panel is a bar graph that shows the data in terms of the fold-reduction in HIV replication.
Example 7
TEGS Production
[0151] In a separate experiment, a TEGS composition was generated. HIV-1 was isolated from a 10-year old plasma specimen (stored at -80° C.) obtained from an individual at the time of acute HIV infection, when the nucleic acid amplification test for HIV was positive and the antibody test was negative. Specialized beads (Virobeads; Accurate Chemical & Scientific Corp., Westbury, N.Y.) were used to capture the virus from plasma. This method allows for successful isolation of infectious HIV where other procedures fail, perhaps due to the separation of infectious virus from inhibitory factors commonly found in plasma by using other procedures. Using the specialized beads also acts to concentrate the virus.
[0152] The virobead-captured HIV was then propagated in vitro using primary blood cells that were obtained from blood banks while preserving the anonymity of the blood donors. Primary blood cells were used to expand the virus in its most natural form, as opposed to the use of cell lines that could produce variants of the original virus. The HIV was used for in vitro infection of primary CD4+ cells that were isolated from a leukoreduction chamber (LRC) obtained from a healthy blood bank donor. In some cases, a PCR test for CCR5 genotyping was performed and used to screen blood from a healthy donor. R5-TEGS was produced in CCR5 positive cells. Briefly, peripheral blood mononuclear cells (PBMCs) were isolated from the total blood in the LRC using a routine ficoll gradient separation procedure. From the PBMCs, CD4+ cells were isolated using immunomagnetic beads (Miltenyi Biotec, Auburn, Calif.; Stemcell Technologies, Vancouver BC, Canada). The CD4+ cells were mitogen stimulated in vitro with PHA (2 μl/mL phytohemagglutinin, Sigma-Aldrich, St. Louis, Mo.) and then acutely infected with the virobead-captured HIV. The acutely HIV-infected CD4+ cells were cultured in serum-free medium: F12/DMEM (Thermo Fisher Scientific, Life Technologies), lx ITS (Thermo Fisher Scientific, Life Technologies), 3 μl/mL human IL-2 (Thermo Fisher Scientific, Invitrogen), and 1× pen/strep (UCSF Cell Culture Facility). The cells were cultured in the serum-free medium and cell culture supernatants were collected at routine intervals for up to 14 days. In some cases, freshly stimulated CD4+ was added to increase HIV yields. A portion (half) of the cell culture supernatant was collected and replaced with fresh serum-free medium every 2-3 days. HIV levels in the cell culture supernatants were measured using a p24 ELISA assay and a reverse transcriptase (RT) assay.
[0153] PCR amplicons were cloned into a per2.1-TOPO vector (Invitrogen) that was used to transform competent cells. Colonies from the transformed E. coli preparations were selected and cultured. Plasmids from the cultures were isolated (minipreps; Qiagen) and sequenced (ElimBio, Hayward, Calif.). The resulting sequences were compiled and analyzed using tools in the LANL online database.
[0154] HIV virions in the cell culture supernatants were concentrated using molecular weight cutoff (MWCO) filtration. The supernatants containing an appreciable amount of HIV were centrifuged (e.g., 2000×g for 15 minutes) and filtered through 0.2μ filters to remove large particulate matter. The supernatants were then concentrated using 100 kDa molecular weight cutoff filters (MWCO; e.g., Amicon filters; Millipore Corp., Billerica, Mass.).
[0155] Concentrated HIV virions were treated with agents to render them non-infectious. The HIV virions were treated with beta-cyclodextrin (BCD, Trappsol, CTD Inc., High Spring, Fla.) to remove cholesterol from virion membranes. As a third orthogonal inactivation procedure, fluids can be briefly heated (e.g. up to 56° C. for 5 min) The benefit of this method for inactivating viruses is that the inactivation procedures are not known to modify the native envelope structure of the virus. Also, BCD can act to release virus proteins that are not attached to the surface of the virus. Notably, BCD can be increasingly effective in the reduced presence of serum. The inactivated virus material was washed with PBS, using MWCO filters. This procedures removed BCD and washed away smaller proteins and debris. Notably, this procedure involving MWCO filters was facilitated by the production of serum-free fluids. The retentate was resuspended in a buffer that varied with the intended use of the resulting TEGS composition. Additives were sometimes used to stabilize the proteins (e.g., PEG) and prevent microbial contamination (e.g., azide). Other additives (e.g. CpG-rich DNA) could be used to boost the localized immune response to the TEGS composition. The resulting material was then analyzed for its HIV Env composition using ELISA and Western blot procedures.
Example 8
TEGS Elicit Production of TEGS-Specific Antibodies in Immunized Animals
[0156] New Zealand white rabbits were immunized with the TEGS generated in Example 7 (Pacific Immunology, San Diego, Calif.). The immunization protocol included 4 injections and 4 production bleeds, with injections taking place at weeks 0, 3, 6, and 10, and bleeds taking place at weeks 7, 9, 11, and 13. At week 14, the rabbit was euthanized, followed by an exsanguinations bleed and a harvesting of the bone marrow and spleen.
[0157] FIG. 5 illustrates SDS-PAGE gels showing that rabbits immunized with TEGS produce TEGS-specific antibodies. The LEFT panel shows the immunoreactivity of the final bleed sera from two rabbits (#79 and #81) against TEGS separated by SDS-PAGE under denaturing and reducing conditions. Arrows denote bands of appreciable intensity above background. The MIDDLE panel shows the immunoreactivity of pooled sera from the pre- and post-immunization (final) bleeds of rabbits #79 and #81 against recombinant gp41 protein separated by SDS-PAGE under denaturing and reducing conditions. The RIGHT panel shows the immunoreactivity of pooled post-immune sera from rabbits #57 and #58 against various recombinant gp120 (lanes 1-4) and gp140 proteins (lanes 5-7) separated by SDS-PAGE under denaturing and reducing conditions. Together, the data in FIG. 5 demonstrate that rabbits immunized with TEGS produce antibodies against TEGS and recombinant gp41 and gp120 proteins. Thus, it can be concluded that TEGS prepared from an acute HIV infection isolate elicit a pronounced anti-HIV antibody response.
[0158] FIG. 6 is a graph demonstrating that the antibody response elicited by immunizing rabbits with TEGS is dose dependent, and serum dependent. A microtiter plate was coated with 100 ul of a virus particle product (1:5 dilution of TBI01280 stock in PBS). Pre- and post-immune sera from rabbits immunized with serum-free TEGS or serum-grown TEGS were diluted 1:10000 (grey bars) or 1:1000 (black bars) in PBS and added to the coated plates. Shown are the resulting O.D.s (450 nm). Respectively, rabbits #79, #81, and #83 received TEGS doses of 300×, 30×, and 3× volumetric equivalents based on the volume of virus particle product concentrated using MWCO filters. The TEGS in these cases were grown in serum-free medium (medium B). Rabbits #57 and #58 were immunized with equivalent TEGS doses, the TEGS in these cases grown in serum-grown medium (medium A). A strong dose-response relationship is observed. Based on the frequencies of virus-particle-specific hybridoma fluids, a similar dose-response relationship was observed in mice immunized with TEGS (see Example 10). These data are consistent with the elevated frequency of bands and the heightened band intensities seen with rabbit #79 as compared to #81 in FIG. 5 (LEFT). Altogether, these data help establish a TEGS optimal immunizing dose.
[0159] FIG. 7 illustrates that the TEGS anti-serum inhibits HIV infection (i.e., neutralizes HIV). The pre-immune serum and the final bleed serum from rabbit #79 were tested in a neutralization assay. Briefly, the sera were pre-adsorbed with human PBMC to remove antibodies capable of binding human cells. Next, the sera were added to aliquots (1000 TCID50) of two distinct HIV-1 isolates (TBI01280 (R5) and HIV-1 SF33 (X4)), resulting in the dilution of the serum. RPMI was used as a control. After a 1-hour incubation period (37° C.), the entire 200 μl serum/virus mixture was added to 1×106 PHA-stimulated human CD4 cells. Following a 2 hour incubation (37° C. with periodic mixing), the cells were washed with RPMI and plated in duplicate in a 96-well plate (BD Falcon; 1×105 cells per well) in complete growth medium. The medium was changed at 3-day intervals and aliquots of the supernatants were stored. HIV levels in the supernatants were measured by an RT-PCR assay designed to measure reverse transcriptase (RT) levels. FIG. 7 shows a representative amplification profile (LEFT) and neutralization results (RIGHT), which reveal that the TEGS antiserum from rabbit #79 markedly reduces the replication of two distinct HIV-1 isolates in vitro, presumably by binding virus envelope proteins. Notably, anti-sera from rabbits immunized with serum-grown TEGS (i.e., using medium A), did not neutralize HIV-1 in repeated experiments. Therefore, serum-free TEGS (i.e., using medium B) is distinguished by the specificities and/or titers of the antibodies elicited in immunized rabbits.
[0160] FIG. 8 is a chart showing that select recombinant HIV-1 envelope proteins do not block the neutralizing activity of the TEGS antiserum from rabbit #79. Briefly, the specificity of the neutralizing anti-serum was evaluated by pre-absorbing the anti-serum with recombinant gp41 and gp120 proteins (1 μl/ml; NIH AIDS Reagents Program) prior to performing neutralization assays with TBI01280. FIG. 8 shows that the reductions in HIV-1 replication result from treatment of the virus particle product with TEGS antiserum alone, TEGS antiserum pre-absorbed with recombinant gp41, TEGS antiserum pre-absorbed with a pool of recombinant gp120 proteins, and TEGS antiserum pre-absorbed with recombinant gp41 and pooled gp120 proteins. The pre-absorption procedure did not lower the antiviral activity of the TEGS antiserum. Thus, it can be concluded that the neutralizing activity of the TEGS antiserum is attributable to the recognition of an epitope that is not present in recombinant gp41 and gp120 monomeric proteins. These results provide evidence in support of the premise that TEGS can elicit antibodies against a discontinuous determinant(s) present in the quaternary structure of the native HIV-1 envelope.
[0161] FIG. 9 shows a substantial improvement of the virus particle product. Various samples (i-vii) of medium compositions and virus particle products were mixed with lithium dodecyl sulfate buffer (Invitrogen) and reducing agent (Invitrogen), heated (70° C., 10 min), loaded into the lanes of a 12% Bis-Tris gel (Invitrogen), and electrophoresed (200V, 40 min) in MES buffer (Invitrogen). The LEFT panel shows an image of a gel stained with G-250 coomassie (BioRad). The samples shown are: i) serum containing medium only, ii) serum-grown TEGS, iii) serum-free medium, iv) serum-free TEGS. The results in the left panel demonstrate the superiority of TEGS produced using serum-free medium, such as medium B in Example 2. The serum-free medium has markedly reduced levels of more than 8 different proteins. In comparison to a composition similar to mHIVenv, serum-free TEGS have greatly reduced levels of proteins in the 175 kDa and 60 kDa range and the overall composition is distinguished. The RIGHT panel shows the Western blot results of the immunoreactivity of a high positive control (BioRad; pooled sera from HIV-infected individuals). The samples shown are: v) concentrated serum-free TBI01280, vi) serum-free TEGS, and vii) serum-free medium. The results in the right panel demonstrate that HIV proteins are retained through the various procedures (i.e., FIG. 1 elements 106 thru 112) involved in producing TEGS.
Example 9
Cloning of Envelope Genes from the Virus Particle Product
[0162] It will be apparent to those skilled in the art that the HIV envelope gene can be cloned and expressed in prokaryotic and eukaryotic cells and even cell-free systems. The expression of HIV envelope proteins or peptides can facilitate a wide variety of downstream applications related to the production and/or characterization of anti-envelope antibodies.
[0163] In the case of FIG. 10, it is demonstrated that an envelope gene from a virus particle product has been cloned into a plasmid and sequenced, as shown below. HIV-1 was isolated from the plasma of a healthy blood bank donor who tested negative for anti-HIV antibodies. After propagation of the virus in primary human mononuclear blood cells, RNA was extracted from the virus particle product and amplified by RT-PCR using consensus primers for HIV-1 clade B isolates. The PCR amplicons were cloned into a per2.1-TOPO vector (Invitrogen) that was then used to transform competent cells (Invitrogen). Colonies from the transformed E. coli preparations were selected and cultured. Plasmids from the cultures were isolated (minipreps; Qiagen) and sequenced (ElimBio). The resulting sequences were compiled and analyzed using tools in the LANL online database (http://www.hiv.lanl.gov/).
[0164] The sequence encoding gp41 (SEQ ID NO: 137) in the per2.1-TOPO vector was amplified and ligated into an expression vector, in-frame, between an IL-2 secretion peptide sequence and a sequence encoding a human IgG-Fc tag. After routine preparation of a plasmid stock, gp41 expression vector was transfected into 293 cells. Dot blot analysis of the cell lysate and cell culture supernatant confirmed the expression and secretion of gp41 (data not shown). The resulting secreted protein, derived from the virus particle product, can be useful for analysis of ABPs elicited by immunization with the virus particle product or otherwise.
TABLE-US-00004 SEQ ID NO: 137: ATGGGGCACCATGCTCCTTGGGATGTTGATGATCTGTAGTGCTGCAGATA AATTGTGGGTCACAGTCTACTATGGGGTACCTGTGTGGAAAGAAGCAACC ACCACTCTATTTTGTGCATCAGATGCTAAAGCATATGATACAGAGGTACA TAATGTTTGGGCCACGCATGCCTGTGTACCCACAGACCCCAACCCACAAG AAGTAGTATTGGAAAATGTGACAGAAAATTTTAACATGTGGAAAAATGAC ATGGTAGAACAAATGCATGAGGATATAATCAGTTTATGGGATCAAAGCCT AAAGCCATGTGTAAAATTAACCCCACTCTGTGTCACTTTAAATTGCAATG ATGTCAATAATAATAGTACTATCAACAATGGAACTACTAATGCCACTAGT CATAGTGGGGGAAAAATAGAGAGAGGAGAAATAAAAAATTGCTCTTTCAA TGTCACCACAAACATAAAAAATAAGCTGCAGAAAGAATATGCACTGTTTT ATAAGCTTGATCTAGTACCAACAGATGATAATAATTCTAGATATAGGTTG ATACATTGTAATACCTTAGTCATTACACAAGCCTGTCCAAAGGTATCCTT TGAGCCAATTCCCATACATTATTGTGCCCCGGCTGGTTTTGCGATTCTAA AGTGCAAAGATAGGAATTTCACAGGAAAAGGACAATGTAAAAATGTCAGC ACAGTACAATGTACACATGGCATTAGGCCAGTAGTGTCAACTCAACTGCT GTTAAATGGCAGTCTAGCAGAAGATGGGGTAGTAATTAGATCTGCCAATA TCACAGACAATACTAAAACCATAATAGTACAGTTGAAGGAAGCTGTAGAA ATTAATTGTACAAGACCCAATAACAATACAAGGAAAAGTATAACTATAGG ACCAGGGAGAGCATTTTGGACAACAGGAGGAATAATAGGAGATATAAGAC AAGCACATTGTAACCTTAGTAGCACAAAATGGAATAACACTTTAAGACAG ATAGCTACAAAATTAAGAGAACAATTTGGTAACAAAACAATAGTTTTTAA TCAATCCTCAGGAGGGGACCAAGAAATTGTGATGCACACTTTTAATTGTG GAGGGGAATTTTTCTACTGTAGTACAACACAACTGTTTAATAGTACTTGG ATTGCAAATAAGACTGGGAATGATACTGGAGGATCAAATGGAACTATTAC ACTTCCATGCAGAATAAAACAAATTGTAAACATGTGGCAGGAAGTAGGAA AAGCAATGTATGCCCCTCCCATCAAAGGACAAATTAGATGTTCATCAAAC ATTACAGGACTGCTATTATTAAGAGATGGTGGTAAGAATAACGGGACAGG AAACATGACAGAAATCTTCAGACCTGGAGGAGGAGATATGAGGGACAATT GGAGAAGTGAATTATATAAATATAAAGTAGTAAAAATTGAACCATTAGGA GTAGCACCCACCAAGGCAAAGAGAAGAGTGGTGCAGAGAGAAAAAAGAGC GGTGGGAACACTAGGAGCCTTGTTCCTTGGGTTCTTGGGAACAGCAGGAA GCACTATGGGCGCAGCATCACTAACGCTGACGGTACAGGCCAGACTATTA TTGCCTGGTATAGTGCAACAGCAAAACAATTTGCTGAGAGCTATTGAGGC GCAACAGCATTTGTTGCAACTCACAGTCTGGGGCATCAAGCAGCTCCAGG CAAGAGTCCTGGCTATGGAAAGATACCTACAGGATCAACAGCTCCTAGGG ATTTGGGGTTGCGCTGGAAAACTCATTTGCACCACAGCTGTGCCTTGGAA TACTAGTTGGAGTAATAAATCTCTGGATCAGATTTGGAATAACATGACCT GGATGCAATGGGAAAGAGAAATTGACAATTACACACACACAATATACAGC TTAATTGAAGAATCGCAGAACCAACAAGAAAAAAATGAACAAGAATTATT GGAACTAGACAAGTGGGCAAGTTTGTGGAATTGGTTTGACATAACAAACT GGCTGTGGTATATAAAAATATTCATAATGGTAGTAGGAGGCTTAGTAGGT TTAAGAATAGTTTTTGCTGTACTTTCTATAGTGAATAGAGTTAGGCAGGG ATACTCACCATTATCGTTGCAGACCCGATTCCCAGTCCAGAGGGGACCCG ACAGGCCCGAAGGAATCGAAGAAGAAGGTGGAGAGAGAGACAGAGACAGA TCCGGTCGATTAGTGACCGGATTCTTACCTCTTATCTGGGACGACCTGCG GAGCCTGTGCCTCTTCAGCTACCGCCGCTTGAGAGACTTACTCTTGATTG CAGCGAGGATTGTGGAACTTCTGGGACGCAGGGGGTGGGAACTCCTCAAA TATTGGTGGAATCTCCTAAAATATTGGAGTCAGGAACTAAAGAATAGTGC TGTCAGCTTGTACAACGCCACAGCTATAGCAGTAGCTGAGGGAACAGATA GGGTTATAGAAATAGTAAGAAGAACCTTTAGAGCTATTATCCACATACCT AGAAGAATAAGACAGGGCTTGGAAAGGGCTTTGCTATAAGATGGGTGGCA AGTGGTCAAAAAGTAGTGTGGTTGGATGGCCTGAGATAAGAGAAAGAATG AGACGAACCGAGCCACGAACCGAGCCAGCAGCAGAGGGGGTGGGAGCAGC ATCTCGAGACCTAGAAAAACATGGAGCAATCACAAGTAGCAATACAGCAG CTACTAATGCTGCTTGTGCCTGGCTAGAAGCACAAGAAGAAGAGGAAGTG GGTTTTCCAGTCAGACCTCAGGTACCTTTAAGACCAATGACCT
Example 10
Production of Cell Lines Producing TEGS-Specific Antibodies
[0165] FIG. 11 shows that the supernatants from mouse hybriboma cells produce virus-particle-product-specific antibodies. Mice were repeatedly injected with TEGS at biweekly intervals. With splenocytes from the mice, hybridomas were constructed. The supernatants from the hybridoma cultures were screened in ELISA assays for immunoreactivity to TEGS and to recombinant HIV proteins. The ELISA and Western blot data show that the hybridoma fluid is reactive with recombinant gp41, but not pooled recombinant gp120 proteins. While pre-immune serum from the mouse was not available for testing, normal mouse serum generally lacks immunoreactivity with recombinant HIV proteins. Thus, the anti-gp41 response likely resulted from immunization with TEGS. Therefore, the anti-gp41 immunoreactivity is likely TEGS-specific. It will be apparent to one skilled in the art that mouse B-cell hybridomas comprise immortalized cell lines that produce monoclonal antibodies.
Example 11
Cloning of TEGS-Specific ABPs from Rabbits Immunized with TEGS
[0166] FIG. 12 illustrates an antibody-phage display approach that was used with splenocytes and bone marrow derived from rabbits immunized with TEGS. Cells binding TEGS were selected, and total RNA was extracted. The RNA was converted to cDNA, and the antibody-encoding DNA was PCR-amplified using custom sequence-specific oligonucleotides (SSOs). The DNA was cloned into a phagemid vector (PADL-10b; Ab Design Labs; San Diego, Calif.) to create a library, the phagemid library was transfected into bacteria, the resulting bacteriophages were isolated, antigen-specific bacteriophages were captured (i.e., panning with TEGS), and the candidate antibody genes were subcloned into custom expression vectors. Unique SSOs were designed and validated. The resulting phagemids expressed novel single-chain variable fragment (scFV) proteins based on the unique combination of SSOs and the linker sequence used. Panning was performed using TEGS. For subcloning of the scFVs, a plasmid containing an IL-2 secretion signal and human Fc gene was used (Invivogen; San Diego, Calif.). The multiple cloning site (MCS) of the plasmid was uniquely modified to enable the subcloning of antibody sequences from the phagemids. Specifically, new restriction sites were introduced and a portion of the MCS was deleted.
[0167] Phagemids captured by panning with TEGS were used to infect E. coli. Phagemid DNA from the E. coli cultures was sequenced. The DNA sequences were analyzed using web-based tools at the international imMunoGeneTics information system (IMGT). These analyses were used in the identification of the rabbit variable chain genes and constructing alignments of the complementarity determining regions or CDRs. Amino acid sequences and nucleic acid sequences of antibody regions are provided in Tables 1 and 2, respectively.
Example 12
Production and Screening of TEGS-Specific ABPs
[0168] FIG. 13 illustrates a TEGS-specific ABP that was produced and validated. (LEFT) Briefly, the multiple cloning site (MCS) of an expression vector encoding an IL-2 secretion peptide and a human IgG Fc chain (Invivogen, San Diego, Calif.) was modified to enable the in-frame and directional ligation of the scFV constructs; unique SfiI sites were added and part of the MCS was deleted. The scFV insert (TBIfabT7; SEQ ID No: 151) from a phagemid captured with immobilized TEGS was excised with SfiI and then subcloned into an expression vector in-frame between sequences encoding an IL-2 secretion peptide and a human IgG Fc protein. Following the transfection of 293 cells, the cell culture supernatants were collected and analyzed for immunoreactivity in dot blot assays. (RIGHT) Shown are the results from a blot that was spotted with a) dPBS, e) FBS, and the concentrated supernatants from cultures of human primary mononuclear cells infected with HIV-1 virus particle products b) TBI01280-5F2, c) 1292-GNV, d) 1362-GNV, and TEGS-prepared from those isolates respectively (f-h). The supernatant from 293 cells transfected with the TBIfabT7 expression vector was used as a primary antibody, followed by the use of an anti-human IgG-HRP secondary antibody. The results show that TBIfabT7 is immunoreactive with each of the acute HIV infection virus isolates and, to a similar degree, with each of the TEGS compositions. TBIfabT7 is not immunoreactive with the multitude of proteins present in fetal bovine serum. In addition to demonstrating the physical production of a TEGS-specific ABP, these results establish the utility of TEGS for three distinct applications: immunization, phagemid capture, and ABP screening.
Example 13
Analytics of TEGS-Specific ABPs
[0169] The preceding Examples demonstrate the ability to produce virus particle product proteins and virus particle specific ABPs. This combined ability enables the exquisite analysis of the relationships among simple to complex TEGS epitopes and TEGS-specific ABPs. One analytic goal is to identify a highly conserved TEGS epitope(s) that is targeted by a broadly neutralizing TEGS-specific ABP(s). One skilled in the art will appreciate that a variety of analytic and experimental approaches can be used to map TEGS-specific ABPs to distinct TEGS epitopes.
[0170] In the case of FIG. 14, an analytic approach to determining the relatedness among TEGS-specific and recombinant HIV protein-specific ABPs is demonstrated. Briefly, a similarity matrix between all of the heavy chain variable region amino acid sequences in Table 2 was computed using the BioEdit software package. A separate similarity matrix was computed for the light chain variable region amino acid sequences. Then, the two matrices were compiled in a spreadsheet. Shown are the two similarity matrices separated by a dark diagonal line. Shaded boxes indicate amino acid sequences having a high degree of homology (e.g. >90%). The results reveal the presence of highly homologous amino acid sequences; the majority are among light chains. One skilled in the art will appreciate that similar analyses can be performed on the complementarity determining regions and other subsets of antibody sequences. When combined with protein or peptide binding data, the approach demonstrated can provide insight for the fine specifities of ABPs.
[0171] While the invention has been particularly shown and described with reference to a preferred embodiment and various alternate embodiments, it will be understood by persons skilled in the relevant art that various changes in form and details can be made therein without departing from the spirit and scope of the invention.
[0172] All references, issued patents and patent applications cited within the body of the instant specification are hereby incorporated by reference in their entirety, for all purposes.
Sequence CWU
1
SEQUENCE LISTING
<160> NUMBER OF SEQ ID NOS: 137
<210> SEQ ID NO 1
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 1
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Asn Tyr Gly
20 25 30
Val Val Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ile Ile Asp His His Gly Ile Pro Tyr Tyr Ala Thr Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asp Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 2
<211> LENGTH: 110
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 2
Glu Leu Val Met Thr Gln Thr Glu Ser Pro Val Ser Ala Ala Val Gly
1 5 10 15
Ser Thr Val Thr Ile Asn Cys Gln Ala Ser Gln Ser Val Tyr Ser Asn
20 25 30
Asn Asn Leu Ala Trp Phe Gln Lys Lys Pro Gly Gln Pro Pro Lys Arg
35 40 45
Leu Ile His Ser Ala Ser Thr Leu Ala Ser Gly Val Pro Ser Arg Phe
50 55 60
Lys Gly Ser Gly Ser Gly Thr Gln Phe Thr Leu Thr Ile Ser Asp Leu
65 70 75 80
Glu Cys Asp Asp Ala Ala Thr Tyr Tyr Cys Ala Gly Val Phe Ser Gly
85 90 95
Ser Ile Ser Val Phe Gly Gly Gly Thr Glu Val Val Val Lys
100 105 110
<210> SEQ ID NO 3
<211> LENGTH: 94
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 3
Val Gly Glu Gly Val Arg Gly Gly Leu Leu Lys Pro Thr Asp Thr Leu
1 5 10 15
Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Asn Ser Tyr Ala Val
20 25 30
Phe Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly Thr
35 40 45
Val Ser Ser Val Gly Asp Thr Tyr Phe Ala Thr Trp Ala Lys Ser Arg
50 55 60
Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys Met
65 70 75 80
Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala
85 90
<210> SEQ ID NO 4
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 4
Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala Leu Gly Ser
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Ala His Lys Thr Tyr Tyr
20 25 30
Ile Glu Trp Tyr Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Gln Leu Glu Ser Asp Gly Ser Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Ser
65 70 75 80
Ser Val Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Gly Ala Asp Tyr
85 90 95
Ser Gly Gly Phe Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 5
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 5
Gln Ser Val Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Gly Tyr Gly
20 25 30
Val Ser Trp Val Arg Gln Ala Ala Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Ser Ser Gly Gly Ser Ala Tyr Tyr Ala Arg Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 6
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 6
Glu Leu Val Met Thr Gln Thr Glu Pro Pro Val Ser Ala Pro Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ala Ser Gln Asn Ile Gly Ser Ser
20 25 30
Tyr Leu Ser Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu
35 40 45
Ile Tyr Gln Ala Ser Thr Leu Ala Ser Gly Val Pro Ser Arg Phe Lys
50 55 60
Gly Gly Gly Ser Gly Thr Asp Tyr Ser Leu Thr Ile Ser Gly Val Gln
65 70 75 80
Cys Ala Asp Ala Ala Thr Tyr Tyr Cys Gln Ser Thr Phe Tyr Ser Ser
85 90 95
Gly Thr Gly Tyr Ala Phe Gly Gly Gly Thr Glu Leu Glu Ile Leu
100 105 110
<210> SEQ ID NO 7
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 7
Gln Ser Val Lys Glu Ser Glu Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Ala Ser Glu Phe Thr Ile Gly Ser Tyr Ser
20 25 30
Ser Gly Trp Val Arg Gln Ala Pro Gly Lys Glu Leu Glu Trp Ile Gly
35 40 45
Thr Leu Ser Ser Thr Gly Ser Ala His Tyr Ala Asn Trp Ala Lys Gly
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Glu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Ala Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 8
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 8
Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala Leu Gly Ala Ser
1 5 10 15
Ala Lys Leu Thr Cys Thr Leu Ser Ser Gly His Lys Thr Tyr Thr Ile
20 25 30
Asp Trp Tyr Gln Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Gln Ile Gly Ser Asp Gly Ser Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Thr Asp Arg Tyr Leu Ile Ile Ser
65 70 75 80
Ser Val Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Gly Ala Asp Tyr
85 90 95
Ser Gly Gly Phe Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 9
<211> LENGTH: 95
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 9
Gln Ser Val Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Ile Asp Leu Ser Arg Asn Gly
20 25 30
Val Thr Trp Val Arg Gln Ala Pro Gly Ser Gly Leu Glu Trp Ile Gly
35 40 45
Val Ile Asn Ser His Gly Asp Ser Asp Tyr Ala Thr Trp Ala Asn Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala
85 90 95
<210> SEQ ID NO 10
<211> LENGTH: 108
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 10
Glu Leu Val Met Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ala Ser Gln Thr Ile Asn Asn Leu
20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu Ile
35 40 45
Tyr Gly Ala Ser Thr Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly
50 55 60
Ser Gly Ser Gly Thr Gln Phe Ile Leu Thr Ile Ser Gly Met Lys Ala
65 70 75 80
Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Ser Ala Tyr Tyr Asn Ala Gly
85 90 95
Ala Thr Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105
<210> SEQ ID NO 11
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 11
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Asn Ser Ala
20 25 30
Met Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Asp Ile Asp Ser Ser Gly Ser Ala Tyr Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 12
<211> LENGTH: 108
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 12
Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala Leu Gly Ala Ser
1 5 10 15
Ala Lys Phe Thr Cys Thr Leu Ser Ser Gly His Lys Thr Tyr Thr Ile
20 25 30
Asp Trp Tyr Gln Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Gln Ile Gly Ser Asp Gly Ser Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Thr Asp Arg Tyr Leu Ile Ile Ser
65 70 75 80
Ser Val Gln Ala Glu Asp Glu Ala Asp Tyr Ile Cys Gly Val Thr Gly
85 90 95
Ser Asn Val Tyr Ala Gln Asp Pro Ala Asp Arg His
100 105
<210> SEQ ID NO 13
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 13
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Asp Ile Ser Gly Val Tyr
20 25 30
Met Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Asp Arg Gly Gly Gly Thr Tyr Tyr Ala Ser Trp Ala Ile Gly
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Asp Asn Thr Val Thr Leu Glu
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Lys
85 90 95
<210> SEQ ID NO 14
<211> LENGTH: 107
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 14
Glu Leu Val Met Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ala Ser Glu Ser Ile Ser Asn Tyr
20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu Thr
35 40 45
Tyr Asp Ala Ser Asp Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly
50 55 60
Ser Gly Tyr Gly Thr Glu Phe Thr Leu Thr Ile Ser Gly Val Lys Ala
65 70 75 80
Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Ser Gly Tyr Val Ser Ala Gly
85 90 95
Thr Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105
<210> SEQ ID NO 15
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 15
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Ile Lys Pro Thr Asp Met
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Asn Tyr Gly
20 25 30
Val Met Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Ser Ile Gly
35 40 45
Tyr Ile Gly Ser Gly Gly Asp Thr Ser Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Ala Arg Asn Thr Asn Glu Asn Thr Val Ser Leu Leu
65 70 75 80
Met Asn Gly Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 16
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 16
Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala Leu Gly Ala
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Ala His Lys Thr Tyr Thr
20 25 30
Ile Asp Trp Tyr Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
His Leu Lys Ser Asp Gly Thr Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Pro
65 70 75 80
Ser Val Arg Thr Asp Asp Glu Ala Asp Tyr Tyr Cys Gly Thr Asp Tyr
85 90 95
Ser Gly Gly Tyr Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 17
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 17
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Ile Tyr Gly
20 25 30
Val Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Val Gly
35 40 45
Ala Ile Gly Ser Gly Gly Ser Ala Tyr Tyr Ala Thr Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Ala Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 18
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 18
Gln Pro Val Leu Thr Gln Ser Pro Ser Ala Ser Ala Ala Leu Gly Ser
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Ala His Lys Thr Tyr Tyr
20 25 30
Ile Asp Trp Tyr Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Gln Val Lys Ser Asp Gly Ser Tyr Thr Arg Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Pro
65 70 75 80
Ser Val Gln Ala Asp Asp Glu Ala Asp Tyr Tyr Cys Gly Ser Asp Tyr
85 90 95
Ser Gly Gly Tyr Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 19
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 19
Gln Ser Val Glu Glu Ser Arg Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Thr Tyr Asn
20 25 30
Ile Gln Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Tyr Ile Gly
35 40 45
Thr Ile Gly Ser Ser Gly Ser Ala Tyr Tyr Ala Ser Arg Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Ala Leu Asn Thr Val Ser Leu Gln
65 70 75 80
Val Asp Ser Leu Thr Asp Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 20
<211> LENGTH: 110
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 20
Glu Leu Asp Leu Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ala Ser Gln Ser Val Ser Asn Leu
20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu Ile
35 40 45
Tyr Gly Ala Ser Asn Leu Glu Ser Gly Val Pro Ser Arg Phe Arg Gly
50 55 60
Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Asp Val Val Cys
65 70 75 80
Asp Asp Ala Ala Thr Tyr Tyr Cys Ala Gly His Lys Ser Ser Ser Thr
85 90 95
Asp Gly Thr Ala Phe Gly Gly Gly Thr Glu Leu Glu Ile Leu
100 105 110
<210> SEQ ID NO 21
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 21
Gln Ser Val Lys Glu Ser Glu Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Thr Val Ser Asn Asn Ala
20 25 30
Ile Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Ser Tyr Gly Gly Asn Thr Tyr Tyr Ala Asn Trp Pro Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 22
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 22
Gln Pro Val Leu Thr Gln Ser Pro Ser Ala Ser Ala Ala Leu Gly Ser
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Ala His Lys Thr Tyr Tyr
20 25 30
Ile Asp Trp Tyr Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Gln Val Lys Ser Asp Gly Ser Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Pro
65 70 75 80
Ser Val Gln Ala Asp Asp Glu Ala Asp Tyr Tyr Cys Gly Ser Asp Tyr
85 90 95
Ser Gly Gly Tyr Val Phe Gly Gly Gly Ala Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 23
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 23
Gln Ser Val Lys Glu Ser Glu Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Asn Tyr Gly
20 25 30
Val Ser Trp Val Arg Gln Ala Pro Gly Lys Glu Val Glu Trp Ile Gly
35 40 45
Tyr Ile Asn Ser Gly Gly Ser Thr Asn Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 24
<211> LENGTH: 108
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 24
Glu Leu Asp Met Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Asp Thr Val Thr Ile Asn Cys Gln Ala Ser Gln Ser Val Thr Asn Leu
20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Arg Gln Pro Pro Lys Leu Leu Ile
35 40 45
Tyr Asp Ala Ser Asn Leu Glu Ser Gly Val Pro Ser Arg Phe Arg Gly
50 55 60
Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Gly Met Lys Ala
65 70 75 80
Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Ser Gly Tyr Tyr Ser Ala Gly
85 90 95
Ala Thr Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105
<210> SEQ ID NO 25
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 25
Gln Ser Val Lys Glu Ser Glu Gly Gly Leu Phe Lys Pro Met Asp Ser
1 5 10 15
Met Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Ser Tyr Gly
20 25 30
Val Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Ser Ser Gly Gly Ser Ala Tyr Tyr Ala Arg Trp Ala Lys Ser
50 55 60
Arg Ala Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Ala Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 26
<211> LENGTH: 112
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 26
Glu Leu Val Leu Thr Gln Thr Pro Ser Pro Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ser Ser Gln Ser Val Tyr Ser Asn
20 25 30
Asn Arg Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Gln
35 40 45
Leu Ile Tyr Tyr Ala Ser Thr Leu Ala Ser Gly Val Ser Ser Arg Phe
50 55 60
Lys Gly Ser Gly Ser Gly Thr Gln Phe Thr Leu Thr Ile Ser Asp Val
65 70 75 80
Val Cys Asp Asp Ala Ala Thr Tyr Tyr Cys Ala Gly Tyr Lys Asn Ser
85 90 95
Gly Ile Asp Glu His Ala Phe Gly Gly Gly Thr Glu Leu Glu Ile Leu
100 105 110
<210> SEQ ID NO 27
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 27
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Asn Arg Tyr Asp
20 25 30
Met Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Val Ile Asn Ser Gly Gly Phe Thr Tyr Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Glu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 28
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 28
Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala Leu Gly Ala
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Gly His Lys Thr Tyr Thr
20 25 30
Ile Asp Trp Tyr Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Gln Leu Gly Ser Asp Gly Ser Tyr Thr Lys Gln Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Ser
65 70 75 80
Ser Val Gln Ala Asp Asp Glu Ala Asp Tyr Tyr Cys Gly Ala Asp Tyr
85 90 95
Ser Gly Gly Phe Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 29
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 29
Gln Ser Val Lys Glu Ser Glu Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Asn Asn Ala
20 25 30
Ile Asn Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ala Val Gly Ser Gly Gly Arg Ala Tyr Tyr Ala Gly Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Asn Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 30
<211> LENGTH: 110
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 30
Glu Leu Val Leu Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Ser Ile Ser Cys Gln Ser Ser Gln Ser Val Tyr Ser Asn
20 25 30
Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu
35 40 45
Ile Tyr Tyr Ala Ser Thr Leu Ala Ser Gly Val Ser Ser Arg Phe Lys
50 55 60
Gly Ser Gly Ser Gly Thr Gln Phe Thr Leu Thr Ile Asn Gly Val Gln
65 70 75 80
Cys Asp Asp Ala Ala Thr Tyr Tyr Cys Gln Gly Thr Phe Asp Asp Gly
85 90 95
Leu Tyr Lys Ala Phe Gly Gly Gly Thr Glu Leu Glu Ile Leu
100 105 110
<210> SEQ ID NO 31
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 31
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Asn Tyr Gly
20 25 30
Met Gly Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Tyr Ile Gly
35 40 45
Phe Ile Ser Ser Gly Gly Asn Thr Tyr Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asp Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Ser Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 32
<211> LENGTH: 108
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 32
Glu Leu Val Met Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ala Ser Gln Ser Val Tyr Asn Leu
20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu Thr
35 40 45
His Gly Thr Ser Asn Leu Glu Ser Gly Val Pro Ser Arg Phe Arg Gly
50 55 60
Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Gly Met Lys Ala
65 70 75 80
Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Ser Gly Tyr Tyr Ser Thr Gly
85 90 95
Ala Thr Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105
<210> SEQ ID NO 33
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 33
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Pro
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Ile Asn Asp Tyr Asn
20 25 30
Met Gln Trp Val Arg Gln Ala Pro Gly Ile Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Asn Ala Trp Gly Asp Thr Tyr Tyr Thr Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asp Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 34
<211> LENGTH: 112
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 34
Glu Leu Asp Leu Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ser Ser Gln Ser Val Asp Ser Asn
20 25 30
Asn Tyr Leu Ser Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu
35 40 45
Leu Ile Tyr Asp Ala Ser Thr Leu Ala Ser Gly Val Pro Ser Arg Phe
50 55 60
Ser Gly Ser Gly Ser Gly Thr Gln Phe Thr Leu Thr Ile Ser Glu Val
65 70 75 80
Gln Cys Asp Asp Ala Ala Thr Tyr Tyr Cys Gln Gly Ser Tyr Tyr Ser
85 90 95
Gly Asp Trp Tyr Gly Ala Phe Gly Gly Gly Thr Glu Leu Glu Ile Leu
100 105 110
<210> SEQ ID NO 35
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 35
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Ala Ser Gly Phe Thr Val Thr Ser Asn Ala
20 25 30
Ile Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Tyr Ile Gly
35 40 45
Phe Ile Gly Ala Ala Gly Asn Ala Asn Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 36
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 36
Glu Leu Val Met Thr Gln Thr Pro Ala Ser Val Ser Glu Pro Val Gly
1 5 10 15
Gly Thr Val Thr Ile Ser Cys Gln Ala Ser Gln Gly Val Tyr Ser Asp
20 25 30
Arg Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu
35 40 45
Met Tyr Tyr Ala Ser Asp Leu Ser Ser Gly Val Pro Ser Arg Phe Lys
50 55 60
Gly Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Asp Leu Glu
65 70 75 80
Cys Ala Asp Ala Ala Thr Tyr Tyr Cys Gln Ser Asn Tyr Gly Ser Leu
85 90 95
Ser Ser Ser Tyr Thr Phe Gly Gly Gly Thr Glu Val Val Val Lys
100 105 110
<210> SEQ ID NO 37
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 37
Gln Ser Val Glu Glu Ser Arg Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Thr Ile Asp Thr Tyr Gly
20 25 30
Val Thr Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Tyr Ile Gly
35 40 45
Phe Ile Ser Ser Gly Gly Ala Ala Tyr Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 38
<211> LENGTH: 106
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 38
Glu Leu Val Met Thr Gln Thr Pro Pro Ser Leu Ser Ala Ser Val Gly
1 5 10 15
Glu Thr Val Arg Ile Arg Cys Leu Ala Ser Glu Asn Val Tyr Ser Ala
20 25 30
Val Ala Trp Tyr Gln Gln Lys Pro Gly Lys Pro Pro Thr Leu Leu Ile
35 40 45
Ser Gly Ala Ser Asn Leu Glu Ser Gly Val Pro Pro Arg Phe Ser Gly
50 55 60
Ser Gly Ser Gly Thr Asp Tyr Thr Leu Thr Ile Gly Gly Val Gln Ala
65 70 75 80
Glu Asp Ala Ala Thr Tyr Phe Cys Gln Gly Tyr Ser Ser Tyr Leu Thr
85 90 95
Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105
<210> SEQ ID NO 39
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 39
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Ile Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Ile Tyr Asp
20 25 30
Ile Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Gly Ser Gly Asp Thr Thr Tyr Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Tyr Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 40
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 40
Gln Pro Val Leu Thr Gln Ser Pro Ser Ala Ser Ala Ala Leu Arg Ser
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Ala His Lys Ser Tyr Asp
20 25 30
Ile Asp Trp Tyr Gln Gln Gln Ser Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Arg Leu Arg Ser Asp Gly Lys Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Pro
65 70 75 80
Ser Val Gln Ala Asp Asp Gly Ala Asp Tyr Tyr Cys Gly Thr Asp Tyr
85 90 95
Ser Gly Gly Tyr Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 41
<211> LENGTH: 95
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 41
Glu Gln Leu Val Glu Ser Glu Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Asn Asn Tyr Gly
20 25 30
Val Thr Trp Val Arg Gln Ala Pro Gly Arg Gly Leu Glu Trp Ile Gly
35 40 45
Ala Val Trp Ser Gly Ala Thr Thr Asp Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Glu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Ser Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala
85 90 95
<210> SEQ ID NO 42
<211> LENGTH: 110
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 42
Glu Leu Val Met Thr Gln Thr Glu Ser Pro Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ala Ser Gln Ser Ile Ser Ser Trp
20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Pro Pro Thr Leu Leu Ile
35 40 45
Ser Gly Ala Ser Asn Leu Glu Ser Gly Val Pro Pro Arg Phe Ser Gly
50 55 60
Ser Gly Ser Gly Thr Asp Tyr Thr Leu Thr Ile Gly Gly Val Gln Ala
65 70 75 80
Glu Asp Ala Ala Thr Tyr Tyr Cys Leu Gly Gly Tyr Ser Tyr Ser Ser
85 90 95
Ile Gly Thr Thr Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105 110
<210> SEQ ID NO 43
<211> LENGTH: 98
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 43
Gln Glu Gln Leu Glu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Lys Leu Ser Cys Lys Ala Ser Gly Phe Asp Phe Ile Asn Tyr
20 25 30
Gly Val Ile Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Ile
35 40 45
Gly Tyr Ile Asp Pro Ile Phe Gly Asn Thr Ile Tyr Ala Ser Trp Val
50 55 60
Asn Asp Arg Phe Thr Ile Ser Ser His Asn Ala Gln Asn Thr Leu Tyr
65 70 75 80
Leu Gln Leu Asn Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys
85 90 95
Ala Arg
<210> SEQ ID NO 44
<211> LENGTH: 108
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 44
Glu Leu Val Met Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ala Ser Gln Ser Val Asn Asn Leu
20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu Thr
35 40 45
Tyr Gly Thr Ser Asn Leu Glu Ser Gly Val Pro Ser Arg Phe Arg Gly
50 55 60
Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Gly Met Lys Ala
65 70 75 80
Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Ser Gly Tyr Tyr Ser Ala Gly
85 90 95
Leu Thr Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105
<210> SEQ ID NO 45
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 45
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Ile Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Thr Asn Gly
20 25 30
Val Ser Trp Val Arg Gln Ala Pro Gly Ser Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Asp Leu Tyr Gly Ala Thr Tyr Tyr Ala Thr Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 46
<211> LENGTH: 110
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 46
Glu Leu Val Leu Thr Gln Thr Pro Ala Ser Val Ser Glu Pro Val Gly
1 5 10 15
Gly Thr Val Thr Ile Lys Cys Gln Ala Ser Gln Asn Ile Tyr Ser Gly
20 25 30
Ile Ser Trp Tyr Gln Gln Lys Pro Glu Lys Pro Pro Thr Leu Leu Ile
35 40 45
Ser Gly Ala Ser Asn Leu Glu Pro Gly Val Pro Pro Arg Phe Ser Gly
50 55 60
Ser Gly Ser Gly Thr Asp Tyr Thr Leu Thr Ile Gly Gly Val Gln Ala
65 70 75 80
Gly Asp Ala Ala Thr Tyr Tyr Cys Leu Gly Val Tyr Ser Phe Gly Ser
85 90 95
Thr Asp Leu Thr Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105 110
<210> SEQ ID NO 47
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 47
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Ser Tyr Ala
20 25 30
Ile Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Tyr Ile Asn Tyr Asp Gly Ile Ala Tyr Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Gly Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 48
<211> LENGTH: 110
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 48
Glu Leu Asp Leu Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Ser Ile Ser Cys Gln Ser Ser Gln Ser Val Tyr Asn Asn
20 25 30
Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu
35 40 45
Ile Tyr Tyr Ala Ser Lys Leu Ala Ser Gly Val Pro Ser Arg Phe Lys
50 55 60
Gly Ser Gly Ser Gly Thr Gln Phe Thr Leu Thr Ile Ser Asp Val Gln
65 70 75 80
Cys Asp Asp Ala Ala Thr Tyr Tyr Cys Gln Gly Thr Phe Asp Asn Gly
85 90 95
Leu Tyr Lys Ala Phe Gly Gly Gly Thr Glu Leu Glu Ile Leu
100 105 110
<210> SEQ ID NO 49
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 49
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser
1 5 10 15
Leu Lys Leu Ser Cys Lys Gly Ser Gly Phe Asp Leu Asp Ser Asn Ala
20 25 30
Met Cys Trp Val Arg Gln Ala Pro Gly Ser Gly Leu Glu Trp Ile Gly
35 40 45
Thr Ile Thr Ser Gly Gly Ser Ala Tyr Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 50
<211> LENGTH: 108
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 50
Glu Leu Asp Met Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ala Ser Glu Ser Ile Ser Asn Leu
20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu Ile
35 40 45
Tyr Ser Ala Ser Thr Leu Ala Ser Gly Val Pro Ser Arg Phe Arg Gly
50 55 60
Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Gly Met Lys Ala
65 70 75 80
Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Ser Gly Tyr Tyr Ser Thr Gly
85 90 95
Ala Thr Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105
<210> SEQ ID NO 51
<211> LENGTH: 98
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 51
Gln Glu Gln Leu Glu Glu Ser Gly Gly Arg Leu Val Lys Pro Asp Glu
1 5 10 15
Thr Leu Thr Leu Thr Cys Thr Val Ser Gly Leu Ser Leu Asn Asn Phe
20 25 30
Gly Val Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile
35 40 45
Arg Ala Ile Asp Phe Gly Ser Gly Ser Ala Tyr Tyr Ala Asn Trp Ala
50 55 60
Lys Ser Arg Ser Thr Ile Thr Ser Asn Thr Arg Leu Asn Thr Val Thr
65 70 75 80
Leu Lys Met Ile Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys
85 90 95
Ser Arg
<210> SEQ ID NO 52
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 52
Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala Leu Gly Ala
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Ala His Lys Thr Tyr Thr
20 25 30
Ile Asp Trp Tyr Gln Gln Gln Ser Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Gln Leu Lys Ser Asp Gly Asn Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Pro
65 70 75 80
Ser Val Gln Ala Asp Asp Glu Ala Asp Tyr Tyr Cys Gly Ala Asp Tyr
85 90 95
Ser Gly Gly Tyr Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 53
<211> LENGTH: 97
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 53
Gln Ser Val Lys Glu Ser Glu Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Asn Tyr Ala
20 25 30
Ile Asn Trp Val Arg Gln Ala Pro Gly Glu Gly Leu Glu Trp Ile Gly
35 40 45
Tyr Ile Asp Pro Thr Phe Gly Ser Thr Tyr Tyr Ala Ser Trp Val Asn
50 55 60
Asp Arg Phe Thr Ile Ser Ser His Asn Ala Gln Asn Thr Leu Tyr Leu
65 70 75 80
Gln Leu Asn Ser Leu Thr Pro Ala Asp Thr Ala Thr Tyr Phe Cys Ala
85 90 95
Arg
<210> SEQ ID NO 54
<211> LENGTH: 112
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 54
Glu Leu Asp Met Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Ser Cys Gln Ala Ser Gln Ser Val Tyr Asn Asn
20 25 30
Asn Asn Leu Ser Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu
35 40 45
Leu Ile Tyr Asp Ala Ser Lys Leu Ala Ser Gly Val Pro Ser Arg Phe
50 55 60
Lys Gly Ser Gly Ser Gly Thr Gln Phe Thr Leu Thr Ile Ser Asp Leu
65 70 75 80
Glu Cys Asp Asn Ala Ala Thr Tyr Phe Cys Gln Gln Gly Tyr Asp Gly
85 90 95
Ser Asp Val Asp Asn Val Phe Gly Gly Gly Thr Glu Val Val Val Lys
100 105 110
<210> SEQ ID NO 55
<211> LENGTH: 95
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 55
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Gly Gly Ser
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Thr Ile Thr Ser Tyr His
20 25 30
Met Cys Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Gly Trp Ile Gly
35 40 45
Ala Val Ser Ala Ser Gly His Thr Tyr Tyr Ala Asn Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asp Thr Asn Leu Asn Thr Met Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala
85 90 95
<210> SEQ ID NO 56
<211> LENGTH: 108
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 56
Glu Leu Val Leu Thr Gln Thr Pro Pro Ser Leu Ser Ala Ser Val Gly
1 5 10 15
Glu Thr Val Arg Ile Arg Cys Leu Ala Ser Glu Phe Leu Phe Asn Ala
20 25 30
Val Ser Trp Tyr Gln Gln Lys Pro Glu Lys Pro Pro Thr Leu Pro Ile
35 40 45
Tyr Gly Ala Ser Asn Leu Glu Ser Gly Val Pro Pro Arg Phe Ser Gly
50 55 60
Ser Gly Ser Gly Thr Gln Phe Thr Leu Thr Ile Ser Asp Leu Glu Cys
65 70 75 80
Asp Asp Ala Ala Thr Tyr Tyr Cys Ala Gly Asp Tyr Ser Asp Trp Ile
85 90 95
Tyr Ala Phe Gly Gly Gly Thr Glu Val Val Val Lys
100 105
<210> SEQ ID NO 57
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 57
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Ser Tyr Gly
20 25 30
Ile Thr Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Gly Ser Asp Ala Lys Thr Tyr Tyr Ala Ser Trp Ala Lys Gly
50 55 60
Arg Ser Thr Ile Thr Gly Asp Thr Asn Leu Asn Thr Val Thr Leu Arg
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 58
<211> LENGTH: 112
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 58
Glu Leu Val Leu Thr Gln Thr Pro Ser Ser Val Pro Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asp Cys Gln Ser Ser Glu Ser Val Tyr Asn Asn
20 25 30
Asn Asn Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu
35 40 45
Leu Ile Tyr Gly Ala Ser Thr Leu Ala Ser Gly Val Ser Ser Arg Phe
50 55 60
Lys Gly Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Asp Leu
65 70 75 80
Glu Cys Ala Asp Ala Ala Thr Tyr Tyr Cys Gln Gln Gly Tyr Ser Ile
85 90 95
Gly Asn Val Asp Asn Ala Phe Gly Gly Gly Thr Glu Leu Glu Ile Leu
100 105 110
<210> SEQ ID NO 59
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 59
Gln Ser Val Lys Glu Ser Glu Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Ser Tyr Gly
20 25 30
Val Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Ser Ser Gly Gly Asp Ala Tyr Tyr Ala Ser Trp Ala Thr Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 60
<211> LENGTH: 110
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 60
Glu Leu Val Met Thr Gln Thr Pro Ala Ser Val Glu Val Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Lys Cys Gln Ala Ser Gln Ser Ile Ser Ser Tyr
20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu Ile
35 40 45
Tyr Lys Ala Ser Thr Leu Ala Ser Gly Val Pro Ser Arg Phe Lys Gly
50 55 60
Ser Gly Ser Gly Thr Gln Phe Thr Leu Thr Ile Ser Asp Val Val Cys
65 70 75 80
Asp Asp Ala Ala Thr Tyr Tyr Cys Ala Gly Tyr Lys Gly Gly Ser Ser
85 90 95
Asp Gly Ser Ala Phe Gly Gly Gly Thr Glu Leu Glu Ile Leu
100 105 110
<210> SEQ ID NO 61
<211> LENGTH: 95
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 61
Gln Ser Val Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Ala Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Tyr Pro Gly
20 25 30
Val Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Tyr Ile Gly
35 40 45
Phe Ile Asn Ala Asp Gly Asp Ser Tyr Tyr Pro Thr Trp Ala Lys Arg
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala
85 90 95
<210> SEQ ID NO 62
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 62
Gln Pro Val Leu Thr Gln Ser Pro Ser Ala Ser Ala Ala Leu Gly Ser
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Ala His Lys Thr Tyr Tyr
20 25 30
Ile Glu Trp Tyr Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Gln Val Lys Ser Asp Gly Ser Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Pro
65 70 75 80
Ser Val Gln Ala Asp Asp Glu Ala Asp Tyr Tyr Cys Gly Ala Asp Tyr
85 90 95
Ser Gly Gly Tyr Val Leu Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 63
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 63
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Ala Asp Thr
1 5 10 15
Leu Thr Leu Ala Cys Thr Val Ser Gly Phe Ser Leu Ser Thr Tyr Gly
20 25 30
Val Ile Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Tyr Ile Ala
35 40 45
Tyr Ile Asn Tyr Ser Gly Ser Pro Tyr Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Glu Lys Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 64
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 64
Gln Pro Val Leu Thr Gln Ser Pro Ser Ala Ser Ala Ala Leu Gly Ser
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Ala His Lys Thr Tyr Tyr
20 25 30
Ile Asp Trp Tyr Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Gln Leu Gly Ser Asp Gly Ser Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Pro
65 70 75 80
Ser Val Gln Ala Asp Asp Glu Ala Asp Tyr Tyr Cys Gly Ser Asp Tyr
85 90 95
Ser Gly Gly Tyr Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 65
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 65
Ser Arg Trp Arg Ser Pro Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Gly Tyr Gly
20 25 30
Val Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Ser Ser Gly Gly Ser Ala Tyr Tyr Ala Arg Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 66
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 66
Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala Leu Gly Ala
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Ala His Lys Thr Tyr Thr
20 25 30
Ile Asp Trp Tyr Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Gln Leu Lys Ser Asp Gly Ser Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Pro
65 70 75 80
Ser Val Gln Ala Asp Asp Glu Ala Asp Tyr Tyr Cys Gly Ala Asp Tyr
85 90 95
Ser Gly Gly Tyr Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 67
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 67
Gln Ser Val Lys Glu Ser Glu Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Asn Tyr Gly
20 25 30
Val Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Tyr Ile Gly
35 40 45
Phe Ile Ser Asn Gly Gly Ala Thr Phe Tyr Ala Thr Trp Ala Arg Ser
50 55 60
Arg Ala Thr Ile Thr Arg Asn Thr Gly Leu Asn Thr Val Ala Leu Thr
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Val Arg
85 90 95
<210> SEQ ID NO 68
<211> LENGTH: 110
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 68
Glu Leu Asp Met Thr Gln Thr Pro Pro Ser Leu Ser Ala Ser Val Gly
1 5 10 15
Glu Thr Val Arg Ile Arg Cys Leu Ala Ser Glu Asp Ile Gly Ser Ala
20 25 30
Ile Ser Trp Tyr Gln Gln Lys Pro Gly Lys Pro Pro Thr Leu Leu Ile
35 40 45
Tyr Gly Val Phe Asn Leu Glu Ser Gly Val Pro Pro Arg Phe Ser Gly
50 55 60
Ser Gly Ser Gly Thr Asp Tyr Thr Leu Thr Ile Gly Gly Val Gln Ala
65 70 75 80
Glu Asp Ala Ala Thr Tyr Tyr Cys Leu Gly Gly Ala Ser Asp Ser Ser
85 90 95
Thr Gly Leu Thr Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105 110
<210> SEQ ID NO 69
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 69
Gln Ser Val Lys Glu Ser Glu Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Gln Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Ser Asn Ala
20 25 30
Ile Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Lys Ser Ile Gly
35 40 45
Phe Ile Asn Ser Gly Gly Gly Ala Tyr Tyr Ala Thr Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Glu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 70
<211> LENGTH: 119
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 70
Gln Pro Val Leu Thr Gln Ser Pro Ser Leu Ser Ala Ser Leu Gly Thr
1 5 10 15
Thr Ala Arg Leu Thr Cys Thr Leu Ser Thr Gly Tyr Ser Val Gly Glu
20 25 30
Tyr Pro Leu Val Trp Leu Gln Gln Val Pro Gly Arg Pro Pro Arg Tyr
35 40 45
Leu Leu Ser Phe Thr Ser Asp Glu Asp Lys His His Asp Ser Trp Gly
50 55 60
Pro Thr Arg Phe Ser Gly Ser Lys Asp Thr Ser Glu Asn Thr Phe Ile
65 70 75 80
Leu Ser Ile Ser Gly Leu Gln Pro Glu Asp Glu Ala Asp Tyr Tyr Cys
85 90 95
Ala Thr Ala His Gly Ser Asp Asn Ser Leu His Tyr Val Phe Gly Gly
100 105 110
Arg Thr Gln Leu Thr Val Thr
115
<210> SEQ ID NO 71
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 71
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ala Leu Asn Asn Tyr Asn
20 25 30
Ile His Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Gly Ser Ser Gly Ser Ala Tyr Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 72
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 72
Gln Pro Val Leu Thr Gln Ser Pro Ser Ala Ser Ala Ala Leu Gly Ser
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Ala His Lys Thr Tyr Tyr
20 25 30
Ile Glu Trp Tyr Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Ile
35 40 45
Gln Leu Lys Ser Asp Gly Ser Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Thr Asp Arg Tyr Leu Ile Ile Ser
65 70 75 80
Ser Val Gln Ala Glu Asp Glu Ala Asp Tyr Ser Cys Gly Ala Asp Tyr
85 90 95
Ser Gly Gly Phe Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 73
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 73
Val Gly Gly Gly Val Gln Gly Gly Gly Leu Val Lys Pro Gly Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Pro Leu Ser Ser Tyr Asp
20 25 30
Met Asn Trp Val Arg Gln Ala Pro Gly Glu Gly Leu Glu Trp Ile Gly
35 40 45
Trp Ile Thr Tyr Asp Gly Tyr Asn His Tyr Ala Ser Trp Ala Asn Gly
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Glu Asn Ala Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 74
<211> LENGTH: 107
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 74
Glu Leu Val Leu Thr Gln Thr Pro Pro Ser Leu Ser Ala Ser Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Leu Ala Ser Glu Asn Val Tyr Ser Ala
20 25 30
Val Ala Trp Tyr Gln Gln Lys Pro Gly Lys Pro Pro Thr Leu Leu Ile
35 40 45
Ser Gly Thr Ser Asn Leu Glu Ala Gly Val Pro Pro Arg Phe Ser Gly
50 55 60
Ser Gly Ser Gly Thr Asp Tyr Thr Leu Thr Ile Gly Gly Val Gln Ala
65 70 75 80
Glu Asp Ala Ala Thr Tyr Phe Cys Gln Gly Tyr Ser Ser Tyr Pro Leu
85 90 95
Thr Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105
<210> SEQ ID NO 75
<211> LENGTH: 804
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 75
cccagccggc catggctgag ctcgtgatga cccagactga atcgcccgtg tctgcagctg 60
tgggaagcac agtcaccatc aattgccagg ccagtcagag tgtttatagt aacaacaact 120
tagcctggtt tcagaagaaa ccagggcagc ctcccaagcg cctgatccat tctgcatcca 180
ctctggcatc tggggtccca tcgcggttca aaggcagtgg atctgggaca cagttcactc 240
tcaccatcag cgacctggag tgtgacgatg ctgccactta ctactgtgca ggcgttttta 300
gtggtagtat tagtgttttc ggcggaggga ccgaggtggt cgtcaaggtg gttcctctag 360
atcttcctcc tctggtggcg gtggctcggg cggtggtggg cagtcgctgg aggagtccgg 420
gggaggtctc ttcaagccaa cggataccct gacactcacc tgcacagtct ctggattctc 480
cctcagtaac tatggagtgg tctgggtccg ccaggctcca gggaacgggc tggaatggat 540
cggaatcatt gatcatcatg gtatcccata ctacgcaacc tgggcgaaaa gccgatccac 600
catcaccaga aacaccaacc tggacacggt gactctgaaa atgaccagtc tgacagccgc 660
ggacacggcc acctatttct gtgcgagagc ttacgttaat tttggctggg attatgctct 720
taacatctgg ggtccaggca ccctggtcac cgtctcctca gggcaaccta aggctccgtc 780
agtcactagt ggcccgggag gcca 804
<210> SEQ ID NO 76
<211> LENGTH: 803
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 76
ccggccatgg ctcagcctgt gctgactcag tcgccctctg tgtctgctgc cctgggatcc 60
tcggccaagc tcacctgcac tctgagcagt gctcacaaga cctactatat tgaatggtat 120
cagcaacaac aaggggaggc ccctcggtac ctgatgcaac ttgagagtga tggaagctac 180
accaagggga ccggggtccc tgatcgcttc tcgggctcca gctctggggc tgaccgctac 240
ttgatcatct ccagcgtcca ggctgaggac gaagccgact actattgtgg tgcagattat 300
agtggtgggt ttgtgttcgg cggagggacc cagctgaccg tcacaggtgg tggttcctct 360
agatcttcct cctctggtgg cggtggctcg ggcggtggtg ggcagtcggt gaaggagtcc 420
ggggaggtct cctcaagcca acggataccc tgacactcac ctgcacagtc tctggattct 480
ccctcaatag ctatgcagta ttctgggtcc gccaggctcc agggaacggg ctggaatgga 540
tcggaaccgt tagtagtgtt ggtgacacat acttcgcgac ctgggcgaaa agccgatcca 600
ccatcaccag aaacaccaac ctgaacacgg tgactctgaa aatgaccagt ctgacagccg 660
cggacacggc cacctatttt tgtgcgaggg gggttggtgt tagttattat cttgatgctt 720
ttgattcttg gggcccaggc accctggtca ccgtctcctc agggcaacca ggctccatca 780
gtcactagtg gcccgggagg cca 803
<210> SEQ ID NO 77
<211> LENGTH: 809
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 77
ccggccatgg ctgagctcgt gatgacccag actgaacccc ccgtgtctgc acctgtggga 60
ggcacagtca ccatcaattg ccaggccagt cagaacattg gtagtagcta cttatcctgg 120
tatcagcaga aaccagggca gcctcccaag ctcctgatct accaggcttc cactctggca 180
tctggggtcc catcgcggtt caaaggcggt ggatctggga cagactacag tctcaccatc 240
agcggcgtgc agtgtgccga tgccgccact tattactgtc aaagtacttt ttatagtagt 300
ggtactggtt atgctttcgg cggagggacc gagctggaga tcctggtggt tcctctagat 360
cttcctcctc tggtggcggt ggctcgggcg gtggtgggca gtcggtggag gagtccgggg 420
gaggtctctt caagccaacg gataccctga cactcacctg cacagtctct ggattctccc 480
tcagtggcta tggagtgagc tgggtccgcc aggctgcagg gaacgggctg gaatggatcg 540
gagccattag tagtggtggt agcgcatact acgcgagatg ggcgaaaagc cgatccacca 600
tcaccagaaa caccaacctg aacacggtga ctctgaaaat gaccagtctg acagccgcgg 660
acacggccac ctatttctgt gcgagaggtt actatactgc tattggtggt acttatgaca 720
atgcttttga tccctggggc ccaggcaccc tggtcaccgt ctcctcaggg caacctaagg 780
ccatcagtca ctagtggccc gggaggcca 809
<210> SEQ ID NO 78
<211> LENGTH: 806
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (750)..(750)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (763)..(763)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (766)..(766)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (772)..(772)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (774)..(775)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<400> SEQUENCE: 78
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgtgt ctgccgccct 60
gggagcctct gccaagctca cctgcaccct gagcagtggc cacaagacct acaccattga 120
ctggtatcag cagcagcagc aaggggaggc ccctcggtac ctgatgcaga ttgggagtga 180
tggaagctac accaagggga ccggggtccc tgatcgcttc tcgggctcca gctctgggac 240
tgaccgctac ttgatcatct ccagcgtcca ggctgaggac gaagccgact actattgtgg 300
tgcagattat agtggtgggt ttgtgttcgg cggagggacc cagctgaccg tcacaggtgg 360
tggttcctct agatcttcct cctctggtgg cggtggctcg ggcggtggtg ggcagtcggt 420
gaaggagtcc gagggaggtc tcttcaagcc aacggatacc ctgacactca cctgcacagc 480
ctccgaattc accatcggta gttatagtag tggctgggtc cgccaggctc cagggaagga 540
gctggagtgg atcggaaccc ttagttctac tggtagcgca cactacgcga actgggcgaa 600
aggccgttcc accatcacca gaaacaccaa cgagaacacg gtgactctga agatggccag 660
tctgacagcc gcggacacgg ccacctattt ctgtgcgaga gctgattatg ggccctgtta 720
ttttgacatc tggggcccag gcaccctggn caccgttttc tcnggnaacc tnannctcca 780
tcagtcacta gtggcccggg aggcca 806
<210> SEQ ID NO 79
<211> LENGTH: 794
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 79
ccggccatgg ctgagctcgt gatgacccag actccatcct ctgtgtctgc agctgtggga 60
ggcacagtca ccatcaattg ccaggccagt cagactatta acaacctctt agcctggtat 120
cagcagaaac cagggcagcc tcccaagctc ctgatttatg gtgcatccac tctggcatct 180
ggggtcccat cgcgtttcag cggcagtgga tctgggacac agttcattct caccatcagt 240
ggcatgaagg ctgaagatgc tgccacttat tactgtcaaa gtgcttatta taatgctggt 300
gcgacttttg gagctggcac caatgtggaa atcaaggtgg ttcctctaga tcttcctcct 360
ctggtggcgg tggctcgggc ggtggtgggc agtcggtgga ggagtccggg ggaggtctct 420
tcaagccaac ggataccctg acactcacct gcacagtctc tggaatcgac ctcagtagaa 480
atggagtgac ctgggtccgc caggctccag ggagcgggct ggaatggatc ggagtcatta 540
atagtcatgg tgacagtgat tacgcgacct gggcgaacag ccgatccacc atcaccagaa 600
acaccaacct gaacacggtg actctgaaaa tgaccagtct gacagccgcg gacacggcca 660
cctatttctg tgcgagtact tatgatagtt attatgatta tgcttggcct aattttggca 720
tctggggccc aggcaccctg gtcaccgtct cctcagggca acctaaggcc agtcactagt 780
ggcccgggag gcca 794
<210> SEQ ID NO 80
<211> LENGTH: 810
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 80
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgtgt ctgccgccct 60
gggagcctct gccaagttca cctgcaccct gagcagtggc cacaagacct acaccattga 120
ctggtatcag cagcagcagc aaggggaggc ccctcggtac ctgatgcaga ttgggagtga 180
tggaagctac accaagggga ccggggtccc tgatcgcttc tcgggctcca gctctgggac 240
tgaccgctac ttgatcatct ccagcgtcca ggctgaggac gaagctgact acatctgtgg 300
tgtaactggt agtaatgttt atgcacagga cccagctgac cgtcacaggt ggtggttcct 360
ctagatcttc ccctggtggc ggtggccggg cggtggtggg cagtcgctgg aggagtccgg 420
gggaggtctc ttcaagccaa cggataccct gacactcacc tgcacagtct ctggattctc 480
cctcagtaac agtgcaatga gctgggtccg ccaggctcca gggaacgggc tggaatggat 540
cggagacatt gatagtagtg gtagcgcata ctacgcgagc tgggcgaaaa gccgatccac 600
catcaccaga aacaccaacc tgaacacggt gactctgaaa atgaccagtc tgacagccgc 660
ggacacggcc acctatttct gtgcgagagg gggttatggt aatgctggta ctccttacta 720
tggcatggac ctctggggcc cagggaccct cgtcaccgtc tcctcagggc aacctaaggc 780
tccatcagtc actagtggcc cgggaggcca 810
<210> SEQ ID NO 81
<211> LENGTH: 762
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (705)..(705)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<400> SEQUENCE: 81
ccggccatgg ctgagctcgt gatgacccag actccatcct ctgtgtctgc agctgtggga 60
ggcacagtca ccatcaattg ccaggccagt gaaagcatta gcaactactt agcctggtat 120
cagcagaaac cagggcagcc tcccaagctc ctgacctatg atgcatctga tctggcatct 180
ggggtcccat cgcggttcag cggcagtgga tatgggacag agttcactct caccattagt 240
ggcgtgaagg ctgaagatgc tgccacttat tattgtcaaa gtggttatgt tagtgctggg 300
acttttggag ctggcaccaa tgtggaaatc aaggtggttc ctctagatct tcctcctctg 360
gtggggcggt ggtgggcagt cgttggagga gtccggggga ggtctcttca agccaacgga 420
taccctgaca ctcacctgca cagtctctgg attcgacatt agtggcgttt acatgagctg 480
ggtccgccag gctccaggga acgggctgga gtggatcgga gccattgatc gtggtggtgg 540
cacttactac gcgagctggg cgataggccg atccaccatc accagaaaca ccaacgacaa 600
cacggtgact ctggaaatga ccagtctgac agccgcggac acggccacct atttctgtgc 660
gaaaggatat agtgttcttg atccctgggg cccaggcacc ctggncaccg tctcctcagg 720
gcaacctaag gctccatcag tcactagtgg cccgggaggc ca 762
<210> SEQ ID NO 82
<211> LENGTH: 810
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 82
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgtgt ctgccgccct 60
gggagcctct gccaagctca cctgcaccct gagcagtgcc cacaagacct acaccattga 120
ctggtatcag cagcagcaag gggaggcccc tcgatacctg atgcatctta agagtgatgg 180
aacctacacc aaggggaccg gggtccctga tcgcttctcg ggctccagct ctggggctga 240
ccgctacttg atcatcccca gcgtccgaac tgatgacgaa gccgactact attgtggtac 300
agattacagc ggtgggtatg tattcggcgg agggacccag ctgaccgtca caggtggtgg 360
ttcctctaga tcttcctcct ctggtggcgg tggctcgggc ggtggtgggc agtcgctgga 420
ggagtccggg ggaggcctga tcaagccaac ggatatgttg acactcacct gcacagtctc 480
tggattctcc ctcagtaact atggagtgat gtgggtccgc caggctccag ggaacggact 540
ggagtcgatc ggatatattg gtagtggtgg tgacacatcc tacgcgagct gggcgaaaag 600
ccgatccacc atcgccagaa acaccaacga gaacacggtg tctctgctca tgaatggtct 660
gacagccgcg gacacggcca cctatttctg tgcgagagat cctggttata gtgctggtag 720
tgcttttgat ccctggggcc caggcaccct ggtcaccgtc ttctcagggc aacctaaggc 780
tccatcagtc actagtggcc cgggaggcca 810
<210> SEQ ID NO 83
<211> LENGTH: 820
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 83
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgcat ctgctgccct 60
gggatcctcg gccaagctca cctgcactct gagcagtgct cacaagacct actatattga 120
ctggtatcag cagcagcaag gggaggcccc tcggtacctg atgcaggtta agagtgatgg 180
aagctacacc agggggaccg gggtccctga tcgcttctcg ggctccagct ctggggctga 240
ccgctacttg atcatcccca gcgtccaggc tgatgacgaa gccgactact attgtggttc 300
agattatagc ggtgggtatg tgttcggcgg agggacccag ctgaccgtca caggtggtgg 360
ttcctctaga tcttcctcct ctggtggcgg tggctcgggc ggtggtgggc agtcgttgga 420
ggagtccggg ggaggtctct tcaagccaac ggataccctg acactcacct gcacagtctc 480
tggattctcc ctcagtatct atggagtgag ctgggtccgc caggctccgg ggaatgggct 540
ggaatgggtc ggagccattg gtagtggtgg tagcgcatac tacgcgacct gggcgaaaag 600
ccgatccacc atcaccagaa acaccaacct gaacacggtg actctgaaaa tggccagtct 660
gacagccgcg gacacggcca cctatttctg tgcgagaggt tactatactg ctattggtgg 720
tacttatgac aatgcttttg atccctgggg cccaggcacc ctggtcaccg tctcctcagg 780
gcaacctaag tccatcagtc actagtggcc cgggaggcca 820
<210> SEQ ID NO 84
<211> LENGTH: 799
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (754)..(754)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (763)..(763)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (767)..(767)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (788)..(788)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<400> SEQUENCE: 84
ccggccatgg ctgagctcga tctgacccag actccatcct ctgtgtctgc agctgtggga 60
ggcacagtca ccatcaattg ccaggccagt cagagtgtta gcaacctctt agcctggtat 120
cagcagaaac cagggcagcc tcccaagctc ctgatttatg gtgcatccaa tctggaatct 180
ggggtcccat cgcgtttccg tggcagtgga tctgggacag agttcactct caccatcagc 240
gatgtggtgt gtgacgatgc tgccacttac tactgtgcag gacataaaag tagtagtact 300
gatggtactg ctttcggcgg agggaccgag ctggagatcc tggtggttcc tctagatctt 360
cctcctctgg tggcggtggc tcgggcggtg gtgggcagtc ggtggaggag tccaggggag 420
gtctcttcaa gccaacggat accctgacac tcacctgtac agtctctgga ttctccctta 480
gtacctacaa catacaatgg gtccgccagg ctccagggaa cgggctggaa tatatcggaa 540
ccattggtag tagtggtagc gcatactacg cgagccgggc gaaaagccga tccaccatca 600
ccagaaacac cgccctgaac acggtgtctc tgcaagtgga cagtctgaca gacgcggaca 660
cggccaccta tttctgtgcg agaggaggga cttggtatac agatggtctt gcttatgttg 720
atgcttttga tctctggggc ccaggcaccc tggncaccgc ctnctcnggc aacctagtca 780
ctagtggncc gggaggcca 799
<210> SEQ ID NO 85
<211> LENGTH: 807
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 85
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgcat ctgctgccct 60
gggatcctcg gccaagctca cctgcactct gagcagtgct cacaagacct actatattga 120
ctggtatcag cagcagcaag gggaggcccc tcggtatctg atgcaggtta agagtgatgg 180
aagctacacc aaggggaccg gggtccctga tcgcttctcg ggctccagct ctggggctga 240
ccgctacttg atcatcccca gcgtccaggc tgatgacgaa gccgactact attgtggttc 300
agattatagc ggtgggtatg tgttcggcgg aggggcccag ctgaccgtca caggtggtgg 360
ttcctctaga tcttcctcct ctggtggcgg tggctcgggc ggtggtgggc agtcggtgaa 420
ggagtccgag ggaggtctct tcaagccaac ggataccctg acactcacct gcacagtctc 480
tggattcacc gtcagtaaca atgcaataag ctgggtccgc caggctccag ggaatgggct 540
ggaatggatc ggagccatta gttacggtgg taacacatac tacgcgaact ggccgaaaag 600
ccgatccacc atcaccagaa acaccaacct gaacacggtg actctgaaaa tgaccagtct 660
gacagccgcg gacacggcca cctatttctg tgcgagattc tactatggtg ctggttatgc 720
ctatgacatc tggggcccag gcaccctggt caccgtcttc tcagggcaac ctaaggctcc 780
gtcagtcact agtggcccgg gaggcca 807
<210> SEQ ID NO 86
<211> LENGTH: 792
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (729)..(729)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (755)..(755)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (762)..(763)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<400> SEQUENCE: 86
ccggccatgg ctgagctcga tatgacccag actccatcct ctgtgtctgc agctgtggga 60
gacacagtca ccatcaattg tcaggccagt cagagtgtta ccaacctctt agcctggtat 120
cagcagaaac caaggcagcc tcccaaactc ctgatttatg atgcatccaa tctagaatct 180
ggagtcccat cgcgtttccg tggcagtgga tctgggacag agttcactct caccatcagt 240
ggcatgaagg ctgaagatgc tgccacttat tactgtcaaa gtggttatta tagtgctggt 300
gcgacttttg gagctggcac caatgtggaa atcaaggtgg ttcctctaga tcttcctcct 360
ctggtggcgg tggctcgggc ggtggtgggc agtcggtgaa ggagtccgag ggaggtctct 420
tcaagccaac ggataccctg acactcacct gcacagtctc tggattctcc ctcagtaact 480
atggagtgag ctgggtccgc caggctccag ggaaggaggt ggagtggatc ggatacatta 540
acagtggtgg tagtactaat tacgcgagct gggcgaaaag ccgatccacc atcaccagaa 600
acaccaattt gaacacggtg actctgaaaa tgaccagcct gacagccgcg gacacggcca 660
cctatttctg tgcgagaggt taccgtggtt ataatgttgg tatggatgct tttgatgtct 720
ggggcccang caatctggtc accgtctcct caggnaacct annctctcag tcactagtgg 780
cccgggaggc ca 792
<210> SEQ ID NO 87
<211> LENGTH: 804
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 87
ccggccatgg ctgagctcgt gctgacccag actccatccc cagtgtctgc ggctgttgga 60
ggcacagtca ccatcaattg ccagtccagt cagagtgttt atagtaacaa ccgcttagcc 120
tggtatcagc agaaaccagg gcagcctccc aagcaactga tctattatgc atccactctg 180
gcatctgggg tctcatcgcg gttcaaaggc agtggatctg ggacacagtt cactctcacc 240
atcagcgatg tggtgtgtga cgatgctgcc acttactact gtgcaggata taaaaatagt 300
ggtattgatg aacatgcttt cggcggaggg accgagctgg agatcctggt ggttcctcta 360
gacttctcct ctggtggcgg tggctcgggc ggtggtgggc agtcggtgaa ggagtccgag 420
ggaggtctct tcaagccaat ggatagcatg acactcacct gcacagtctc tggattctcc 480
ctcagtagct atggagtgag ctgggtccgc caggctccag ggaacgggct ggaatggatc 540
ggagccatta gtagtggtgg tagcgcatac tacgcgagat gggcgaaaag ccgagccacc 600
atcaccagaa acaccaacct gaacacggtg actctgaaaa tggccagtct gacagccgcg 660
gacacggcca cctatttctg tgcgagaggt tactatactg ctattggtgg tacttatgac 720
aatgcttttg atccctgggg cccaggcacc ctggtcaccg tctcctcagg gcaacctaac 780
agtcactagt ggcccgggag gcca 804
<210> SEQ ID NO 88
<211> LENGTH: 812
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 88
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgtgt ctgccgccct 60
gggagcctct gccaagctca cctgcaccct gagcagtggc cacaagacct acaccattga 120
ctggtatcag cagcagcaag gggaggcccc tcggtacctg atgcagcttg ggagtgatgg 180
aagctacacc aagcagaccg gggtccctga tcgcttctcg ggctccagct ctggggctga 240
ccgctacttg atcatctcca gcgtccaggc tgatgacgaa gccgactact attgtggtgc 300
ggattatagt ggtgggtttg tgttcggcgg agggacccag ctgaccgtca caggtggtgg 360
cctctagatc ttcctcctct ggtggcggtg gctcgggcgg tggtgggcag tcgttggagg 420
agtccggggg aggtctcttc aagccaacgg ataccctgac actcacctgc acagtctctg 480
gattctccct caacaggtac gacatgagtt gggtccgcca ggctccaggg aacgggctgg 540
aatggatcgg agtcattaat agtggtgggt tcacatacta cgcgagctgg gcgaaaagcc 600
gatccaccat caccagaaac accaacgaga acacggtgac tctgaaaatg accagtctga 660
cagccgcgga cacggccacc tatttctgtg cgagaggtta ccgtggttat aatgttggta 720
tggatgcttt tgatgtctgg ggcccaggca atctggtcac cgtctcctca gggcaaccta 780
agtccgtcag tcactagtgg cccgggaggc ca 812
<210> SEQ ID NO 89
<211> LENGTH: 818
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 89
ggcccagccg gccatggctg agctcgtgct gacccagact ccatcgtccg tgtctgcagc 60
tgtgggaggc acagtcagca tcagttgcca gtccagtcag agtgtttata gtaactactt 120
agcctggtat cagcagaaac cagggcagcc tcccaagctc ctgatctatt atgcatccac 180
tctggcatct ggggtctcat cgcggttcaa aggcagtgga tctgggacac agttcactct 240
caccatcaac ggcgtgcagt gtgacgatgc tgccacttac tactgtcaag gcacttttga 300
tgatggtttg tacaaggctt tcggcggagg gaccgagctg gagatcctgg tggttcctct 360
agatcttcct cctctggtgg cggtggctcg ggcggtgtgg gcagtcggtg aaggagtccg 420
agggaggtct cttcaagcca acggataccc tgacactcac ctgcacagtc tctggattct 480
ccctcagtaa caatgcaata aactgggtcc gccaggctcc agggaacggg ctggagtgga 540
tcggagccgt tggtagtggt ggtagggcat actacgcggg ctgggcgaaa agccgatcca 600
ccatcaccag aaacaccaac ctgaacacgg tgactctgaa aatgacgaat ctgacagccg 660
cggacacggc cacctatttc tgtgcgagag tcggatttta ctatggcaat ggtctttctt 720
atggtattgg cgcttttgat ccctggggcc caggcaccct ggtcaccgtc tcctcagggc 780
aaccaggctc cgtcagtcac tagtggcccg ggaggcca 818
<210> SEQ ID NO 90
<211> LENGTH: 794
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 90
ccggccatgg ctgagctcgt gatgacccag actccatcct ctgtgtctgc agctgtggga 60
ggcacagtca ccatcaattg ccaggccagt cagagtgttt acaacctctt agcctggtat 120
cagcagaaac cagggcagcc tcccaagctc ctgactcatg gtacatccaa tctggaatct 180
ggggtcccat cgcgtttccg tggcagtgga tctgggacag agttcactct caccatcagt 240
ggcatgaagg ctgaagatgc tgccacttat tactgtcaaa gtggttatta tagtactggt 300
gcgacttttg gagctggcac caatgtggaa atcaaggtgg ttcctctaga tcttcctcct 360
ccggtggcgg tggctcgggc ggtggtgggc agtcgctgga ggagtccggg ggaggtctct 420
tcaagccaac ggataccctg acactcacct gcacagtctc tggattctcc ctcagtaact 480
atggaatggg ctgggtccgc caggctccag ggaacgggct ggaatacatc ggattcatta 540
gtagtggtgg taatacatac tacgcgagct gggcgaaaag ccgatccacc atcaccagag 600
acaccaacct gaacacggtg actctgaaaa tgagcagtct gacagccgcg gacacggcca 660
cctatttctg tgcgagaggt taccgtggtt ataatgttgg tatggatgct tttgatgtct 720
ggggcccagg caatctggtc accgtctcct cagggcaaca aggctccatc agtcactagt 780
ggcccgggag gcca 794
<210> SEQ ID NO 91
<211> LENGTH: 784
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (686)..(686)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<400> SEQUENCE: 91
ccggccatgg ctgagctcga tctgacccag actccatcct ccgtgtctgc agctgtggga 60
ggcacagtca ccatcaattg ccagtccagt cagagtgttg atagtaacaa ttacttatcc 120
tggtatcagc agaaaccagg gcagcctccc aagctcctga tctatgatgc atccactctg 180
gcatctgggg tcccatcgcg gttcagcggc agtggatctg ggacacagtt cactctcacc 240
atcagcgaag tacagtgtga cgatgctgcc acttactact gtcaaggcag ttattatagt 300
ggtgattggt atggggcttt cggcggaggg accgagctgg agatcctggt ggttcctcta 360
gatcttcctc ctctggtggc ggtggctcgg gcggtggtgg gcagtcgttg gaggagtccg 420
ggggaggtct cttcaagcca acggatcccc tgacactcac ctgcacagtc tctggattct 480
ccatcaatga ctacaacatg caatgggtcc gccaggctcc agggatcggg ctggaatgga 540
tcggagccat taatgcttgg ggtgatacat actatacgag ctgggcgaaa agccgatcca 600
ccatcaccag agacaccaac ctgaacacgg tgactctgaa aatgaccagt ctgacagccg 660
cggacacggc cacctatttc tgtgcnagag gttacagtct tgacatctgg ggcccaggca 720
ccctggtcac cgtctcctca gggcaaccta aggctccgtc agtcactagt ggcccgggag 780
gcca 784
<210> SEQ ID NO 92
<211> LENGTH: 807
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 92
cccagccggc catggctgag ctcgtgatga cccagactcc agcctccgtg tctgaacctg 60
tgggaggcac agtcaccatc agttgccagg ccagtcaggg tgtttatagc gaccgcctag 120
cctggtatca acagaaacca gggcagcctc ccaagctcct gatgtattat gcatccgatc 180
tgtcatctgg ggtcccatcg cggttcaaag gcagtggatc tgggacagag ttcactctca 240
ccatcagcga cctggagtgt gccgatgctg ccacttacta ctgtcaaagc aattatggta 300
gtcttagtag tagttatact ttcggcggag ggaccgaggt ggtcgtcaag gtggttcctc 360
tagatcttcc tcctctggtg gcggtggctc gggcggtggt gggcagtcgt tggaggagtc 420
cgggggaggt ctcttcaagc caacggatac cctgacactc acctgcacag cctccggatt 480
caccgtcact agcaacgcaa taagctgggt ccgccaggct ccagggaacg ggctggaata 540
tatcggattc attggtgctg ctggtaatgc aaactacgcg agctgggcga aaagccgctc 600
caccatcacc agaaacacca acctgaacac ggtgactctg aaaatgacca gtctgacagc 660
cgcggacacg gccacctatt tctgtgcgag agagggtggt tggggtacat tgtttggtgc 720
ttttgattcc tggggcccag gcaccctggt caccgtctcc tcagggcaac ctaaggctcc 780
atcagtcact agtggcccgg gaggcca 807
<210> SEQ ID NO 93
<211> LENGTH: 797
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 93
ggcccagccg gccatggctg agctcgtgat gacccagact ccaccctccc tgtctgcatc 60
tgtgggagaa actgtcagga ttaggtgcct ggcgagtgag aacgtttaca gtgctgtagc 120
ctggtatcaa cagaagccag ggaaacctcc tacactcctg atctctggtg catccaattt 180
agaatctggg gtcccaccac ggttcagtgg cagtggatct gggacagatt acaccctcac 240
catcggcggc gtgcaggctg aagatgctgc cacttacttc tgtcaagggt atagcagtta 300
cctgactttt ggagctggca ccaatgtgga aatcaaggtg gttcctctag atcttcctcc 360
tctggtggcg gtggctcggg cggtggtggg cagtcggtgg aggagtccag gggaggtctc 420
ttcaagccaa cggataccct gacactcacc tgcacagtct ctggatttac catcgatacc 480
tatggagtga cctgggtccg ccaggctcca gggaacgggc tggaatatat cggattcatt 540
agtagtggtg gtgccgcata ctacgcgagc tgggcgaaaa gccgatccac catcaccaga 600
aacaccaatc tgaacacggt gactctgaaa atgaccagtc tgacagccgc ggacacggcc 660
acctatttct gtgcgagaga tcgtggctat gtttatggtt atggtgatgg tactgacatc 720
tggggcccag gcaccctggt caccgtctcc tcagggcaac ctaaggctcc atcagtcact 780
agtggcccgg gaggcca 797
<210> SEQ ID NO 94
<211> LENGTH: 794
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 94
cccagccggc catggctcag cctgtgctga ctcagtcgcc ctctgcgtct gctgccctga 60
gatcctcggc caagctcacc tgcaccctga gcagtgccca caagagttac gacattgact 120
ggtatcagca gcagtcaggg gaggcccctc ggtacctaat gcgtcttagg agtgatggaa 180
agtacaccaa ggggaccggg gtccctgatc gcttctcggg ctccagctct ggggctgacc 240
gctacttgat catccccagc gtccaggctg atgacggagc cgactattat tgtggtacag 300
attatagcgg tggatatgtg ttcggcggag ggacccagct gaccgtcaca ggtggtggtt 360
cctctagatc ttcctcctgg tggcggtggc tcgggcggtg gtgggcagtc gctggaggag 420
tccgggggag gcctgatcaa gccaacggat accctgacac tcacctgcac agtctctgga 480
ttctccctca gtatctacga cataagctgg gtccgccagg ctccagggaa cgggctggaa 540
tggatcggag ccattggtag tggtgatacc acatactacg cgagctgggc gaaaagccga 600
tccaccatca ccagaaacac ctacctgaac acggtgactc tgaaaatgac cagtctgaca 660
gccgcggaca cggccaccta tttctgtgcg agaggggggt tatcctggtt caacatctgg 720
ggcccaggca ccctggtcac cgtctcctca gggcaaccta aggctccgtc agtcactagt 780
ggcccgggag gcca 794
<210> SEQ ID NO 95
<211> LENGTH: 793
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 95
ccggccatgg ctgagctcgt gatgacccag actgaatccc ccgtgtctgc agctgtggga 60
ggcacagtca ccatcaattg ccaggccagt cagagcatta gcagttggtt ggcctggtat 120
caacagaagc cagggaaacc tcctacactc ctgatctctg gtgcatccaa tttagaatct 180
ggggtcccac cacggttcag tggcagtgga tctgggacag attacaccct caccattggc 240
ggcgtgcagg ctgaagatgc tgccacctac tattgtctag gcggttatag ttacagtagt 300
atcggtacga cttttggagc tggcaccaat gtggaaatca aggtggttcc tctagatctt 360
cctcctctgg tggcggtggc tcgggcggtg gtgggcagga gcagctggtg gagtccgagg 420
gaggtctctt caagccaacg gataccctga cactcacctg cacagtgtct ggattctccc 480
tcaataacta tggagtgacc tgggtccgcc aggctccagg gagggggctg gaatggatcg 540
gagccgtttg gagtggtgct accacagact atgcgagctg ggcgaaaagc cgatccacca 600
tcaccagaaa caccaacgag aacacggtga ctctgaaaat gtccagtctg acagccgcgg 660
acacggccac ctatttctgt gcgaattttc ctggttatac ttctggtacc gacatctggg 720
gccctggcac cctggtcacc gtctcctcag ggcaacctaa ggctccgtca gtcactagtg 780
gcccgggagg cca 793
<210> SEQ ID NO 96
<211> LENGTH: 799
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 96
ccggccatgg ctgagctcgt gatgacccag actccatcct ctgtgtctgc agctgtggga 60
ggcacagtca ccatcaattg tcaggccagt cagagtgtta acaacctctt agcctggtat 120
cagcagaaac cagggcagcc tcccaagctc ctgacttatg gtacatccaa tctggaatct 180
ggggtcccat cgcgtttccg tggcagtgga tctgggacag agttcactct caccatcagt 240
ggcatgaagg ctgaagatgc tgccacttat tactgtcaaa gtggttatta tagtgctggt 300
ttgacttttg gagctggcac caatgtggaa atcaaggtgg ttcctctaga tcttcctcct 360
ctggtggcgg tggctcgggc ggtggtgggc aggagcagct ggaggagtcc gggggaggcc 420
tggtccagcc tgggggatcc ctgaaactct cctgcaaagc ctctggattc gacttcatta 480
actatggagt aatctgggtc cgccaggctc ctgggaaggg gctggagtgg atcggataca 540
ttgatcctat ttttggtaac acaatctacg cgagctgggt gaatgaccga ttcaccatct 600
ccagccacaa cgcccagaac acgctgtatc tgcaactgaa cagtctgaca gccgcggaca 660
cggccaccta tttctgtgcg agatgcgggg atagacgtgg ctggggttat ggttttgatc 720
cctggggccc aggcaccctg gtcaccgtct cctcagggca acctaaggct ccgtcagtca 780
ctagtggccc gggaggcca 799
<210> SEQ ID NO 97
<211> LENGTH: 783
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (740)..(740)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (749)..(749)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (751)..(753)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<400> SEQUENCE: 97
ccggccatgg ctgagctcgt gctgacccag actccagcct ccgtgtctga acctgtggga 60
ggcacagtca ccatcaagtg ccaggccagt cagaacattt acagtggtat atcctggtac 120
caacagaagc cagagaaacc tcctacactc ctgatctctg gtgcatccaa tttagaacct 180
ggggtcccac cacggttcag tggcagtgga tctgggacag attacaccct caccattggc 240
ggcgtgcagg ctggagatgc tgccacctac tactgtctag gcgtttatag tttcggtagt 300
accgatttga cttttggagc tggcaccaat gtggaaatca aggtggttcc tctagatctt 360
cctcctctgg tggcggtggc tcgggcggtg gtgggcagtc gctggaggag tccgggggag 420
gcctcatcaa gccaacggat accctgacac tcacctgcac ggtctctgga ttctccctca 480
gtaccaatgg agtgagttgg gtccgccagg ctccagggag cgggctggaa tggatcggag 540
ccattgatct ttatggtgcc acatattacg cgacctgggc gaaaagccga tccaccatca 600
ccagaaacac caacctaaac acggtgactc tgaaaatgac cagtctgaca gccgcggaca 660
cggccaccta tttctgtgcg agagagggat atggttatcc aaacatctgg ggcccaggca 720
ccctggtcac cgtctcctcn ggcaacctna nnntccgtca gtcactagtg gcccgggagg 780
cca 783
<210> SEQ ID NO 98
<211> LENGTH: 806
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (725)..(725)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<400> SEQUENCE: 98
ggcccagccg gccatggctg agctcgatct gacccagact ccatcgtccg tgtctgcagc 60
tgtgggaggc acagtcagca tcagttgcca gtccagtcag agtgtttata ataactactt 120
agcctggtat cagcagaaac cagggcagcc tcccaagctc ctgatctatt atgcatccaa 180
actggcatct ggggtcccat cgcggttcaa aggcagtgga tctgggacac agttcactct 240
caccatcagc gacgtgcagt gtgacgatgc tgccacttac tactgtcaag gcacttttga 300
taatggtttg tacaaggctt tcggcggagg gaccgagctg gagatcctgg tggttcctct 360
agatcttcct cctctggtgg cggtggctcg ggcggtggtg ggcagtcgtt ggaggagtcc 420
gggggaggtc tcttcaagcc aacggatacc ctgacactca cctgcacagt ctctggattc 480
tccctcagta gctatgcaat aagctgggtc cgccaggctc cagggaacgg gctggaatgg 540
atcggataca ttaattacga tggtatcgca tactacgcga gctgggcgaa aagccgatcc 600
accatcacca gaaacaccaa cctgaacacg gtgactctga aaatgaccgg tctgacagcc 660
gcggacacgg ccacctattt ctgtgcgaga gatgactata ctactcctta tggttatcga 720
ttggntctct ggggccaggg caccctggtc accgtctcct cagggcaacc taaggctccg 780
tcagtcacta gtggcccggg aggcca 806
<210> SEQ ID NO 99
<211> LENGTH: 797
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 99
ggcccagccg gccatggctg agctcgatat gacccagact ccatcctctg tgtctgcagc 60
tgtgggaggc acagtcacca tcaattgcca ggccagtgaa agcattagca acctcttagc 120
ctggtatcag cagaaaccag ggcagcctcc caagctcctg atctattctg catccactct 180
ggcatctggg gtcccatcgc gtttccgtgg cagtggatct gggacagagt tcactctcac 240
catcagtggc atgaaggctg aagatgctgc cacttattac tgtcaaagtg gttattatag 300
tactggtgcg acttttggag ctggcaccaa tgtggaaatc aaggtggttc ctctagatct 360
tcctcctctg gtggcggtgg ctcgggcggt ggtgggcagt cgctggagga gtccggagga 420
ggcctggtcc agccgggggg atccctgaaa ctctcctgca aaggctctgg gttcgacctc 480
gatagcaatg caatgtgctg ggtccgccag gctccaggga gcgggctgga atggatcgga 540
accattacta gtggtggtag cgcatactac gcgagctggg cgaaaagccg atccaccatc 600
accagaaaca ccaacctaaa cacggtgact ctgaaaatga ccagtctgac agccgcggac 660
acggccacct atttctgtgc gagaggacct acttggggaa ttggagatac ttttcatccc 720
tggggcccag gcaccctggt caccgtctcc tcggggcaac ctaaggctcc gtcagtcact 780
agtggcccgg gaggcca 797
<210> SEQ ID NO 100
<211> LENGTH: 789
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 100
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgtgt ctgccgccct 60
gggagcctct gccaagctca cctgcaccct gagcagtgcc cacaagacct acaccattga 120
ctggtatcaa cagcagtcag gggaggcccc tcgatacctg atgcagctta agagtgatgg 180
aaactacacc aaggggaccg gggtccctga tcgcttctcg ggctccagct ctggggctga 240
ccgctacttg atcatcccca gcgtccaggc tgatgacgaa gccgactact attgtggtgc 300
agattatagc ggtgggtatg tgtttggcgg agggacccag ctgaccgtca caggtggtgg 360
ttcctctaga tcttcctcct ctggtggcgg tggctcgggc ggtggtgggc aggagcagct 420
ggaggagtcc gggggtcgcc tggtcaagcc tgacgaaacc ctgacactca cctgcacagt 480
ctctggactc tccctgaata attttggagt gagctgggtc cgccaggccc caggaaacgg 540
gctggaatgg atcagagcca ttgattttgg tagtggtagc gcatactacg cgaactgggc 600
gaaaagtcgg tccaccatca ccagcaacac tcgcctgaac acggtgactc tgaaaatgat 660
tagtctgaca gccgcggaca cggccaccta tttttgttcg agaggagaca tctggggccc 720
aggcaccctg gtcaccgtct tctcagggca acctaaggct ccgtcagtca ctagtggccc 780
gggaggcca 789
<210> SEQ ID NO 101
<400> SEQUENCE: 101
000
<210> SEQ ID NO 102
<211> LENGTH: 811
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 102
gcccagccgg ccatggctga gctcgatatg acccagactc catcctccgt gtctgcagct 60
gtgggaggca cagtcaccat cagttgccag gccagtcaga gtgtttataa taacaacaat 120
ttatcctggt atcagcaaaa accagggcag cctcccaagc tcttgatcta cgatgcatcc 180
aaattggcat ctggggtccc atcgcggttc aaaggcagtg gatctgggac acagttcact 240
ctcaccatta gcgacctgga gtgtgacaat gctgccactt acttctgtca acagggttat 300
gatggtagtg atgttgataa tgttttcggc ggagggaccg aggtggtggt caaggtggtt 360
cctctagatc ttcctcctct ggtggcggtg gctcgggcgg tggtgggcag tcggtgaagg 420
agtccgaggg aggtctcttc aagccaacgg ataccctgac actcacctgc acagtctctg 480
gattctccct cagtaactat gcaataaact gggtccgcca ggctccaggg gaggggctgg 540
agtggatcgg ctatattgat cctacttttg gtagcacgta ctacgcgagc tgggtgaatg 600
accgattcac catctccagc cacaacgccc agaacacgct gtatctgcaa ctgaacagtc 660
tgacacctgc ggacacggcc acctatttct gtgcgagaga tgatattagt attagtggtt 720
attcatttga catctggggc ccaggcaccc tggtcaccgt ctcctcaggg caacctaagg 780
ctccatcagt cactagtggc ccgggaggcc a 811
<210> SEQ ID NO 103
<211> LENGTH: 797
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 103
ggcccagccg gccatggctg agctcgtgct gacccagact ccaccctccc tatctgcatc 60
tgtgggagaa actgtcagga ttaggtgcct ggccagtgag ttccttttta atgctgtatc 120
ctggtatcaa cagaagccag agaaacctcc tacactcccg atctatggtg catccaattt 180
agaatctggg gtcccaccac ggttcagtgg cagtggatct gggacacagt tcactctcac 240
catcagcgac ctggagtgtg acgatgctgc cacttactac tgtgcaggcg attatagtga 300
ttggatttat gcttttggcg gggggaccga ggtggtggtc aaggtggttc ctctagatct 360
tcctcctctg gtggcggtgg ctcgggcggt ggtgggcagt cgttggagga gtccggggga 420
ggtctcttca agcctggagg atccctgaca ctcacctgca cagtctctgg attcaccatc 480
actagctacc acatgtgctg ggtccgccag gctccaggga acgggctggg atggatcgga 540
gccgttagtg ctagcggaca cacatattac gcgaactggg cgaaaagccg atccaccatc 600
accagagaca ccaacttaaa caccatgact ctgaaaatga ccagtctgac agccgcggac 660
acggccacct atttctgtgc gacaccatat cctggttatg atattgatcc ctttgacatc 720
tggggcccag gcaccctggt caccgtctcc tcagggcaac ctaaggctcc gtcagtcact 780
agtggcccgg gaggcca 797
<210> SEQ ID NO 104
<211> LENGTH: 800
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 104
ggcccagccg gccatggctg agctcgtgct gacccagact ccatcctccg tgcctgcagc 60
tgtgggaggc acagtcacca tcgattgcca gtccagtgag agtgtttata ataacaacaa 120
cttagcctgg tatcagcaga aaccagggca gcctcccaag ctcctgatct acggggcatc 180
cactctggca tctggggtct catcgcggtt caaaggcagt ggatctggga cagagttcac 240
tctcaccatc agcgacctgg agtgtgccga tgctgccact tactactgtc aacagggtta 300
tagtattggt aatgtagata atgctttcgg cggagggacc gagctggaga tcctggtggt 360
tcctctagat cttcctcctc tggtggcggt ggctcgggcg gtggtgggca gtcgctggag 420
gagtccgggg gaggtctctt caagccaacg gataccctga cactcacctg cacggtctct 480
ggattctccc tcagtagcta tggaattact tgggtccgcc aggctccagg gaacgggctg 540
gaatggatcg gcgccattgg tagtgatgct aaaacatact acgcgagctg ggcgaaaggc 600
cgatccacca tcaccggaga caccaacctg aacacggtga ctctgagaat gaccagtctg 660
acagccgcgg acacggccac ctatttctgt gcgagatatt ttgattggtt taatgtggac 720
atctggggcc caggcaccct ggtcaccgtc tcctcagggc aacctaaggc tccatcagtc 780
actagtggcc cgggaggcca 800
<210> SEQ ID NO 105
<211> LENGTH: 797
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 105
ggcccagccg gccatggctg agctcgtgat gacccagact ccagcctctg tggaggtagc 60
tgtgggaggc actgtcacca tcaagtgcca ggccagtcag agcattagta gctacttagc 120
ctggtatcaa cagaaaccag ggcagcctcc caagctcctg atctacaagg cttccactct 180
ggcatctggg gtcccgtcgc ggttcaaagg cagtggatct gggacacagt tcactctcac 240
catcagcgat gtggtgtgtg acgatgctgc cacttactac tgtgcaggat ataaaggtgg 300
tagtagtgat ggtagtgctt tcggcggagg gaccgagctg gagatcctgg tggttcctct 360
agatcttcct cctctggtgg cggtggctcg ggcggtggtg ggcagtcggt gaaggagtcc 420
gagggaggtc tcttcaagcc aacggatacc ctgacactca cctgcacagt ctctggattc 480
tccctcagta gctatggagt gagctgggtc cgccaggctc cagggaacgg gctggaatgg 540
atcggagcca ttagtagtgg tggtgacgca tactacgcga gctgggcgac cagccgatcc 600
accatcacca gaaacaccaa cctgaacacg gtgactctga aaatgaccag tctgacagcc 660
gcggacacgg ccacctattt ctgtgcgaga cattttggtt atggtactgc tgggggcatc 720
tggggcccag gcaccctcgt caccgtctct tcagggcaac ctaaggctcc gtcagtcact 780
agtggcccgg gaggcca 797
<210> SEQ ID NO 106
<211> LENGTH: 807
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 106
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgcat ctgctgccct 60
gggatcctcg gccaagctca cctgcactct gagcagtgct cacaagacct actatattga 120
atggtatcag cagcagcaag gggaggcccc tcggtacctg atgcaggtta agagtgatgg 180
aagctacacc aaggggaccg gggtccctga tcgcttctcg ggctccagct ctggggctga 240
ccgctacttg atcatcccca gcgtccaggc tgatgacgaa gccgactact attgtggtgc 300
agattatagc ggtgggtatg tgctcggcgg agggacccag ctgaccgtca caggtggtgg 360
ttcctctaga tcttcctcct ctggtggctc gggcggtggt gggcagtcgg tggaggagtc 420
cgggggaggt ctcttcaagc cagcggatac cctgacactc acctgcacag tctctggatt 480
ttccctcagt taccctggag tgagctgggt ccgccaggct ccagggaacg ggctggaata 540
catcggattc attaatgctg atggtgactc atactacccg acctgggcga aacgccgatc 600
caccatcacc agaaacacca acctgaacac ggtgactctg aaaatgacca gtctcacagc 660
cgcggacacg gccacctatt tctgtgcgag agagggtggc tggggtacat tgtttggtgc 720
ttttgattcc tggggcccag gcaccctagt caccgtcttc tcagggcaac ctaaggctcc 780
gtcagtcact agtggcccgg gaggcca 807
<210> SEQ ID NO 107
<211> LENGTH: 810
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 107
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgcat ctgctgccct 60
gggatcctcg gccaagctca cctgcactct gagcagtgct cacaagacct actatattga 120
ctggtatcag cagcagcaag gggaggcccc tcggtacctg atgcagcttg ggagtgatgg 180
aagttacacc aaggggaccg gggtccctga tcgcttctcg ggctccagct ctggggctga 240
ccgctacttg atcatcccca gcgtccaggc tgatgacgaa gccgactact attgtggttc 300
agattatagc ggtgggtatg tgttcggcgg agggacccag ctgaccgtca caggtggtgg 360
ttcctctaga tcttcctcct ctggtggcgg tggctcgggc ggtggtgggc agtcgctgga 420
ggagtccggg ggaggtctct tcaagccagc ggataccctg acactcgcct gcacagtctc 480
tggattctcc ctcagtactt atggagtgat ctgggtccgc caggctccag ggaaggggct 540
ggaatacatc gcatacatta attatagtgg tagtccatac tacgcgagct gggcgaaaag 600
ccgatccacc atcaccagaa acaccaacga gaaaacggtg actctgaaaa tgaccagtct 660
gacagccgcg gacacggcca cctatttctg tgcgaggggt gttcctggtt acaatgcgga 720
tatgggggac atctggggcc caggcaccct ggtcaccgtc ttctcagggc aacctaaggc 780
tccatcagtc actagtggcc cgggaggcca 810
<210> SEQ ID NO 108
<211> LENGTH: 818
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (766)..(766)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<400> SEQUENCE: 108
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgtgt ctgccgccct 60
gggagcctct gccaagctca cctgcaccct gagcagtgcc cacaagacct acaccattga 120
ttggtatcag cagcagcaag gggaggcccc tcggtacctg atgcagctta agagtgatgg 180
aagctacacc aaggggaccg gggtccctga tcgcttctcg ggctccagct ctggggctga 240
ccgctacttg atcatcccca gcgtccaggc tgatgacgaa gccgactact attgtggtgc 300
agattatagc ggtgggtatg tgttcggcgg agggacccag ctgaccgtca caggtggtgg 360
ttcctctaga tcttcctcct ctggtggcgg tggctcgggc ggtggtgggc agtcggtgga 420
ggagtccagg gggaggtctc ttcaagccaa cggataccct gacactcacc tgcacagtct 480
ctggattctc cctcagtggc tatggagtga gctgggtccg ccaggctcca gggaacgggc 540
tggaatggat cggagccatt agtagtggtg gtagcgcata ctacgcgaga tgggcgaaaa 600
gccgctccac catcaccaga aacaccaacc tgaacacggt gactctgaaa atgaccagtc 660
tgacagccgc ggacacggcc acctatttct gtgcgagagg ttactatact gctattggtg 720
gtacttatga caatgctttt gatccctggg gcccaggcac cctggncacc gtctcctcag 780
ggcaacctaa ggccagtcac tagtggcccg ggaggcca 818
<210> SEQ ID NO 109
<211> LENGTH: 810
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 109
ggcccagccg gccatggctg agctcgatat gacccagact ccaccctccc tgtctgcatc 60
tgtgggagaa actgtcagga ttaggtgcct ggccagtgag gacattggca gtgctatatc 120
ctggtaccaa cagaagccag ggaaacctcc tacactcctg atctatggtg tatttaattt 180
agaatctggg gtcccaccac gattcagtgg cagtggatct gggacagatt acaccctcac 240
cattggcggc gtgcaggctg aagatgctgc cacctactac tgtctaggcg gtgctagtga 300
cagtagtacc ggtttgactt ttggagctgg caccaatgtg gaaatcaagg tggttcctct 360
agatcttcct cctctggtgg cggtggctcg ggcggtggtg ggcagtcggt gaaggagtcc 420
gagggaggtc tcttcaagcc aacggatacc ctgacactca cctgcacagt ctctggattc 480
tccctcagta actatggagt gagctgggtc cgccaggctc cagggaacgg gctggaatac 540
atcggcttca ttagtaacgg tggtgccaca ttctacgcga cctgggcgag aagccgagcc 600
accatcacca gaaacaccgg cctgaacacg gtggctctga caatgaccag tctgacagcc 660
gcggacacgg ccacctattt ctgtgtgagg gattctgttg ctacttatgc tactgatgtt 720
gctgcttttg atccctgggg cccaggcacc ctggtcaccg tctcctcagg gcaacctaac 780
tccgtcagtc actagtggcc cgggaggcca 810
<210> SEQ ID NO 110
<211> LENGTH: 839
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 110
gcccagccgg ccatggctca gcctgtgctg actcagtcgc cctccctgtc tgcgtctctg 60
ggcacaacgg ccagactcac ctgcaccctg agcactggct acagtgttgg cgagtaccct 120
ttagtgtggc tccagcaggt gccagggagg cctcccaggt atctcctgag cttcacctca 180
gatgaagaca aacaccatga ctcttggggc cccacccgct tttctggatc caaagacacc 240
tcagagaata cctttatcct gagcatctct gggctgcagc ccgaggacga ggccgactat 300
tactgtgcta cagctcatgg tagtgataac agcctccatt atgtcttcgg cggaaggacc 360
cagctgaccg tcacaggtgg tggttcctct agatcttcct cctctggtgg cggtggctcg 420
ggcggtggtg ggcagtcggt gaaggagtcc gagggaggtc tcttcaagcc aacggatacc 480
cagacactca cctgcacagt ctctggattc tccctcagta gcaatgcaat aagctgggtc 540
cgccaggctc cagggaacgg gctgaaaagc atcggattca ttaatagtgg tggtggcgca 600
tattacgcga cctgggcgaa aagccgatcc accatcacca gaaacaccaa cgagaacacg 660
gtgactctga aaatgaccag tctgacagcc gcggatacgg ccacctattt ctgtgcgaga 720
acaccccatt attatgatac ttatgatacc tcatttaaca tatggggccc aggcaccctg 780
gtcaccgtct tctcagggca acctaaggct ccgtcagtca ctagtggccc gggaggcca 839
<210> SEQ ID NO 111
<211> LENGTH: 801
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 111
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgcat ctgctgccct 60
gggatcctcg gccaagctca cctgcactct gagcagtgct cacaagacct actatattga 120
atggtatcag cagcagcaag gggaggcccc tcggtacctg atacaactta agagtgatgg 180
aagctacacc aaggggaccg gggtccctga tcgcttctcg ggctccagct ctgggactga 240
ccgctacttg atcatctcca gcgtccaggc tgaggacgaa gccgactact cttgtggtgc 300
agattatagt ggtgggtttg tgttcggcgg agggacccag ctgaccgtca caggtggtgg 360
ttcctctaga tcttcctcct ctggtggcgg tggctcgggc ggtggtgggc agtcgctgga 420
ggagtccggg ggaggtctct tcaagccaac ggataccctg acactcacct gcacagtctc 480
tggattcgcc ctcaataact acaacataca ctgggtccgc caggctccag ggaacgggct 540
ggaatggatc ggagccattg gtagtagtgg tagcgcatac tacgcgagct gggcgaaaag 600
ccgatccacc atcaccagaa acaccaacct gaacacggtg actctgaaaa tgaccagtct 660
gacagccgcg gacacggcca cctatttctg tgcgagaggt tataattctg atgattctta 720
tctctggggc ccaggcaccc tggtcaccgt ctcctcaggg caacctaagg ctccatcagt 780
cactagtggc ccgggaggcc a 801
<210> SEQ ID NO 112
<211> LENGTH: 791
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 112
ccggccatgg ctgagctcgt gctgacccag actccaccct ccctgtctgc atctgtggga 60
ggcacagtca ccataaactg tctggcgagt gagaacgtct acagtgctgt agcctggtat 120
caacagaagc cagggaaacc tcctacactc ctgatctctg gtacatccaa tttagaggct 180
ggggtcccac cacggttcag tggcagtgga tctgggacag attacaccct caccatcggc 240
ggcgtgcagg ctgaagatgc tgccacttac ttctgtcaag ggtatagcag ttaccctttg 300
acttttggag ctggcaccaa tgtggaaatc aaggtggttc ctctagatct tcctcctcgg 360
tggcggtggc tcgggcggtg gtgggcagtc ggtggaggag tccagggggg aggcctggtc 420
aagcctgggg ataccctcac actcacctgc acagtctctg gattccccct cagcagctac 480
gacatgaact gggtccgcca ggctccaggg gaggggctgg aatggatcgg atggattact 540
tatgatggtt acaatcacta cgcgagctgg gcgaatggcc gatccaccat caccagaaac 600
accaacgaga acgcggtgac tctgaaaatg accagtctga cagccgcgga cacggccacc 660
tatttctgtg cgcgagatta ctataatggt gcttatgttt atgcctttaa catctggggc 720
ccaggcaccc tggtcaccgt ctcctcaggg caacctaagg ctccatcagt cactagtggc 780
ccgggaggcc a 791
<210> SEQ ID NO 113
<211> LENGTH: 75
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 113
ggtggttcct ctagatcttc ctcctctggt ggcggtggct cgggcggtgg tgggcagtcg 60
gtggaggagt ccrgg 75
<210> SEQ ID NO 114
<211> LENGTH: 75
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 114
ggtggttcct ctagatcttc ctcctctggt ggcggtggct cgggcggtgg tgggcagtcg 60
gtgaaggagt ccgag 75
<210> SEQ ID NO 115
<211> LENGTH: 75
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 115
ggtggttcct ctagatcttc ctcctctggt ggcggtggct cgggcggtgg tgggcagtcg 60
ytggaggagt ccggg 75
<210> SEQ ID NO 116
<211> LENGTH: 75
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 116
ggtggttcct ctagatcttc ctcctctggt ggcggtggct cgggcggtgg tgggcagsag 60
cagctggwgg agtcc 75
<210> SEQ ID NO 117
<211> LENGTH: 48
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 117
tggtgttggc ctcccgggcc actagtgact gayggagcct taggttgc 48
<210> SEQ ID NO 118
<211> LENGTH: 24
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 118
tggtgttggc ctcccgggcc acta 24
<210> SEQ ID NO 119
<211> LENGTH: 44
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 119
gggcccagcc ggccatggct gagctcgtgm tgacccagac tcca 44
<210> SEQ ID NO 120
<211> LENGTH: 44
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 120
gggcccagcc ggccatggct gagctcgatm tgacccagac tcca 44
<210> SEQ ID NO 121
<211> LENGTH: 44
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 121
gggcccagcc ggccatggct gagctcgtga tgacccagac tgaa 44
<210> SEQ ID NO 122
<211> LENGTH: 46
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 122
gggcccagcc ggccatggct gagctcgtgc tgactcagtc gccctc 46
<210> SEQ ID NO 123
<211> LENGTH: 41
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 123
gggcccagcc ggccatggct cagcctgtgc tgactcagtc g 41
<210> SEQ ID NO 124
<211> LENGTH: 28
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 124
tactcagggc ccagccggcc atggctga 28
<210> SEQ ID NO 125
<211> LENGTH: 41
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 125
ggaagatcta gaggaaccac caggatctcc agctcggtcc c 41
<210> SEQ ID NO 126
<211> LENGTH: 41
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 126
ggaagatcta gaggaaccac cttgatttcc acattggtgc c 41
<210> SEQ ID NO 127
<211> LENGTH: 41
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 127
ggaagatcta gaggaaccac cttgacsacc acctcggtcc c 41
<210> SEQ ID NO 128
<211> LENGTH: 44
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 128
ggaagatcta gaggaaccac cacctgtgac ggtcagctgg gtcc 44
<210> SEQ ID NO 129
<211> LENGTH: 43
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 129
taagcagaat tcggcccagc cggccgcggt gggaacacta gga 43
<210> SEQ ID NO 130
<211> LENGTH: 40
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 130
agcagaattc tggcccagcc ggccgcggtg ggaacactag 40
<210> SEQ ID NO 131
<211> LENGTH: 40
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 131
agcagaattc taggcccagc cggccgcggt gggaacacta 40
<210> SEQ ID NO 132
<211> LENGTH: 47
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 132
ctctagatct ggcctcccgg gcctttttat ataccacagc cagtttg 47
<210> SEQ ID NO 133
<211> LENGTH: 40
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 133
ctctagatct aggcctcccg ggccttttta tataccacag 40
<210> SEQ ID NO 134
<211> LENGTH: 40
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 134
ctctagatct atggcctccc gggccttttt atataccaca 40
<210> SEQ ID NO 135
<211> LENGTH: 20
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 135
aacataaaga aaggcccggc 20
<210> SEQ ID NO 136
<211> LENGTH: 21
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 136
gccttatgca gttgctctcc a 21
<210> SEQ ID NO 137
<211> LENGTH: 2793
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 137
atggggcacc atgctccttg ggatgttgat gatctgtagt gctgcagata aattgtgggt 60
cacagtctac tatggggtac ctgtgtggaa agaagcaacc accactctat tttgtgcatc 120
agatgctaaa gcatatgata cagaggtaca taatgtttgg gccacgcatg cctgtgtacc 180
cacagacccc aacccacaag aagtagtatt ggaaaatgtg acagaaaatt ttaacatgtg 240
gaaaaatgac atggtagaac aaatgcatga ggatataatc agtttatggg atcaaagcct 300
aaagccatgt gtaaaattaa ccccactctg tgtcacttta aattgcaatg atgtcaataa 360
taatagtact atcaacaatg gaactactaa tgccactagt catagtgggg gaaaaataga 420
gagaggagaa ataaaaaatt gctctttcaa tgtcaccaca aacataaaaa ataagctgca 480
gaaagaatat gcactgtttt ataagcttga tctagtacca acagatgata ataattctag 540
atataggttg atacattgta ataccttagt cattacacaa gcctgtccaa aggtatcctt 600
tgagccaatt cccatacatt attgtgcccc ggctggtttt gcgattctaa agtgcaaaga 660
taggaatttc acaggaaaag gacaatgtaa aaatgtcagc acagtacaat gtacacatgg 720
cattaggcca gtagtgtcaa ctcaactgct gttaaatggc agtctagcag aagatggggt 780
agtaattaga tctgccaata tcacagacaa tactaaaacc ataatagtac agttgaagga 840
agctgtagaa attaattgta caagacccaa taacaataca aggaaaagta taactatagg 900
accagggaga gcattttgga caacaggagg aataatagga gatataagac aagcacattg 960
taaccttagt agcacaaaat ggaataacac tttaagacag atagctacaa aattaagaga 1020
acaatttggt aacaaaacaa tagtttttaa tcaatcctca ggaggggacc aagaaattgt 1080
gatgcacact tttaattgtg gaggggaatt tttctactgt agtacaacac aactgtttaa 1140
tagtacttgg attgcaaata agactgggaa tgatactgga ggatcaaatg gaactattac 1200
acttccatgc agaataaaac aaattgtaaa catgtggcag gaagtaggaa aagcaatgta 1260
tgcccctccc atcaaaggac aaattagatg ttcatcaaac attacaggac tgctattatt 1320
aagagatggt ggtaagaata acgggacagg aaacatgaca gaaatcttca gacctggagg 1380
aggagatatg agggacaatt ggagaagtga attatataaa tataaagtag taaaaattga 1440
accattagga gtagcaccca ccaaggcaaa gagaagagtg gtgcagagag aaaaaagagc 1500
ggtgggaaca ctaggagcct tgttccttgg gttcttggga acagcaggaa gcactatggg 1560
cgcagcatca ctaacgctga cggtacaggc cagactatta ttgcctggta tagtgcaaca 1620
gcaaaacaat ttgctgagag ctattgaggc gcaacagcat ttgttgcaac tcacagtctg 1680
gggcatcaag cagctccagg caagagtcct ggctatggaa agatacctac aggatcaaca 1740
gctcctaggg atttggggtt gcgctggaaa actcatttgc accacagctg tgccttggaa 1800
tactagttgg agtaataaat ctctggatca gatttggaat aacatgacct ggatgcaatg 1860
ggaaagagaa attgacaatt acacacacac aatatacagc ttaattgaag aatcgcagaa 1920
ccaacaagaa aaaaatgaac aagaattatt ggaactagac aagtgggcaa gtttgtggaa 1980
ttggtttgac ataacaaact ggctgtggta tataaaaata ttcataatgg tagtaggagg 2040
cttagtaggt ttaagaatag tttttgctgt actttctata gtgaatagag ttaggcaggg 2100
atactcacca ttatcgttgc agacccgatt cccagtccag aggggacccg acaggcccga 2160
aggaatcgaa gaagaaggtg gagagagaga cagagacaga tccggtcgat tagtgaccgg 2220
attcttacct cttatctggg acgacctgcg gagcctgtgc ctcttcagct accgccgctt 2280
gagagactta ctcttgattg cagcgaggat tgtggaactt ctgggacgca gggggtggga 2340
actcctcaaa tattggtgga atctcctaaa atattggagt caggaactaa agaatagtgc 2400
tgtcagcttg tacaacgcca cagctatagc agtagctgag ggaacagata gggttataga 2460
aatagtaaga agaaccttta gagctattat ccacatacct agaagaataa gacagggctt 2520
ggaaagggct ttgctataag atgggtggca agtggtcaaa aagtagtgtg gttggatggc 2580
ctgagataag agaaagaatg agacgaaccg agccacgaac cgagccagca gcagaggggg 2640
tgggagcagc atctcgagac ctagaaaaac atggagcaat cacaagtagc aatacagcag 2700
ctactaatgc tgcttgtgcc tggctagaag cacaagaaga agaggaagtg ggttttccag 2760
tcagacctca ggtaccttta agaccaatga cct 2793
1
SEQUENCE LISTING
<160> NUMBER OF SEQ ID NOS: 137
<210> SEQ ID NO 1
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 1
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Asn Tyr Gly
20 25 30
Val Val Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ile Ile Asp His His Gly Ile Pro Tyr Tyr Ala Thr Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asp Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 2
<211> LENGTH: 110
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 2
Glu Leu Val Met Thr Gln Thr Glu Ser Pro Val Ser Ala Ala Val Gly
1 5 10 15
Ser Thr Val Thr Ile Asn Cys Gln Ala Ser Gln Ser Val Tyr Ser Asn
20 25 30
Asn Asn Leu Ala Trp Phe Gln Lys Lys Pro Gly Gln Pro Pro Lys Arg
35 40 45
Leu Ile His Ser Ala Ser Thr Leu Ala Ser Gly Val Pro Ser Arg Phe
50 55 60
Lys Gly Ser Gly Ser Gly Thr Gln Phe Thr Leu Thr Ile Ser Asp Leu
65 70 75 80
Glu Cys Asp Asp Ala Ala Thr Tyr Tyr Cys Ala Gly Val Phe Ser Gly
85 90 95
Ser Ile Ser Val Phe Gly Gly Gly Thr Glu Val Val Val Lys
100 105 110
<210> SEQ ID NO 3
<211> LENGTH: 94
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 3
Val Gly Glu Gly Val Arg Gly Gly Leu Leu Lys Pro Thr Asp Thr Leu
1 5 10 15
Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Asn Ser Tyr Ala Val
20 25 30
Phe Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly Thr
35 40 45
Val Ser Ser Val Gly Asp Thr Tyr Phe Ala Thr Trp Ala Lys Ser Arg
50 55 60
Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys Met
65 70 75 80
Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala
85 90
<210> SEQ ID NO 4
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 4
Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala Leu Gly Ser
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Ala His Lys Thr Tyr Tyr
20 25 30
Ile Glu Trp Tyr Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Gln Leu Glu Ser Asp Gly Ser Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Ser
65 70 75 80
Ser Val Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Gly Ala Asp Tyr
85 90 95
Ser Gly Gly Phe Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 5
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 5
Gln Ser Val Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Gly Tyr Gly
20 25 30
Val Ser Trp Val Arg Gln Ala Ala Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Ser Ser Gly Gly Ser Ala Tyr Tyr Ala Arg Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 6
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 6
Glu Leu Val Met Thr Gln Thr Glu Pro Pro Val Ser Ala Pro Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ala Ser Gln Asn Ile Gly Ser Ser
20 25 30
Tyr Leu Ser Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu
35 40 45
Ile Tyr Gln Ala Ser Thr Leu Ala Ser Gly Val Pro Ser Arg Phe Lys
50 55 60
Gly Gly Gly Ser Gly Thr Asp Tyr Ser Leu Thr Ile Ser Gly Val Gln
65 70 75 80
Cys Ala Asp Ala Ala Thr Tyr Tyr Cys Gln Ser Thr Phe Tyr Ser Ser
85 90 95
Gly Thr Gly Tyr Ala Phe Gly Gly Gly Thr Glu Leu Glu Ile Leu
100 105 110
<210> SEQ ID NO 7
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 7
Gln Ser Val Lys Glu Ser Glu Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Ala Ser Glu Phe Thr Ile Gly Ser Tyr Ser
20 25 30
Ser Gly Trp Val Arg Gln Ala Pro Gly Lys Glu Leu Glu Trp Ile Gly
35 40 45
Thr Leu Ser Ser Thr Gly Ser Ala His Tyr Ala Asn Trp Ala Lys Gly
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Glu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Ala Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 8
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 8
Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala Leu Gly Ala Ser
1 5 10 15
Ala Lys Leu Thr Cys Thr Leu Ser Ser Gly His Lys Thr Tyr Thr Ile
20 25 30
Asp Trp Tyr Gln Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Gln Ile Gly Ser Asp Gly Ser Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Thr Asp Arg Tyr Leu Ile Ile Ser
65 70 75 80
Ser Val Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Gly Ala Asp Tyr
85 90 95
Ser Gly Gly Phe Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 9
<211> LENGTH: 95
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 9
Gln Ser Val Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Ile Asp Leu Ser Arg Asn Gly
20 25 30
Val Thr Trp Val Arg Gln Ala Pro Gly Ser Gly Leu Glu Trp Ile Gly
35 40 45
Val Ile Asn Ser His Gly Asp Ser Asp Tyr Ala Thr Trp Ala Asn Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala
85 90 95
<210> SEQ ID NO 10
<211> LENGTH: 108
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 10
Glu Leu Val Met Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ala Ser Gln Thr Ile Asn Asn Leu
20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu Ile
35 40 45
Tyr Gly Ala Ser Thr Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly
50 55 60
Ser Gly Ser Gly Thr Gln Phe Ile Leu Thr Ile Ser Gly Met Lys Ala
65 70 75 80
Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Ser Ala Tyr Tyr Asn Ala Gly
85 90 95
Ala Thr Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105
<210> SEQ ID NO 11
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 11
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Asn Ser Ala
20 25 30
Met Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Asp Ile Asp Ser Ser Gly Ser Ala Tyr Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 12
<211> LENGTH: 108
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 12
Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala Leu Gly Ala Ser
1 5 10 15
Ala Lys Phe Thr Cys Thr Leu Ser Ser Gly His Lys Thr Tyr Thr Ile
20 25 30
Asp Trp Tyr Gln Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Gln Ile Gly Ser Asp Gly Ser Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Thr Asp Arg Tyr Leu Ile Ile Ser
65 70 75 80
Ser Val Gln Ala Glu Asp Glu Ala Asp Tyr Ile Cys Gly Val Thr Gly
85 90 95
Ser Asn Val Tyr Ala Gln Asp Pro Ala Asp Arg His
100 105
<210> SEQ ID NO 13
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 13
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Asp Ile Ser Gly Val Tyr
20 25 30
Met Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Asp Arg Gly Gly Gly Thr Tyr Tyr Ala Ser Trp Ala Ile Gly
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Asp Asn Thr Val Thr Leu Glu
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Lys
85 90 95
<210> SEQ ID NO 14
<211> LENGTH: 107
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 14
Glu Leu Val Met Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ala Ser Glu Ser Ile Ser Asn Tyr
20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu Thr
35 40 45
Tyr Asp Ala Ser Asp Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly
50 55 60
Ser Gly Tyr Gly Thr Glu Phe Thr Leu Thr Ile Ser Gly Val Lys Ala
65 70 75 80
Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Ser Gly Tyr Val Ser Ala Gly
85 90 95
Thr Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105
<210> SEQ ID NO 15
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 15
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Ile Lys Pro Thr Asp Met
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Asn Tyr Gly
20 25 30
Val Met Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Ser Ile Gly
35 40 45
Tyr Ile Gly Ser Gly Gly Asp Thr Ser Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Ala Arg Asn Thr Asn Glu Asn Thr Val Ser Leu Leu
65 70 75 80
Met Asn Gly Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 16
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 16
Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala Leu Gly Ala
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Ala His Lys Thr Tyr Thr
20 25 30
Ile Asp Trp Tyr Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
His Leu Lys Ser Asp Gly Thr Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Pro
65 70 75 80
Ser Val Arg Thr Asp Asp Glu Ala Asp Tyr Tyr Cys Gly Thr Asp Tyr
85 90 95
Ser Gly Gly Tyr Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 17
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 17
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Ile Tyr Gly
20 25 30
Val Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Val Gly
35 40 45
Ala Ile Gly Ser Gly Gly Ser Ala Tyr Tyr Ala Thr Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Ala Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 18
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 18
Gln Pro Val Leu Thr Gln Ser Pro Ser Ala Ser Ala Ala Leu Gly Ser
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Ala His Lys Thr Tyr Tyr
20 25 30
Ile Asp Trp Tyr Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Gln Val Lys Ser Asp Gly Ser Tyr Thr Arg Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Pro
65 70 75 80
Ser Val Gln Ala Asp Asp Glu Ala Asp Tyr Tyr Cys Gly Ser Asp Tyr
85 90 95
Ser Gly Gly Tyr Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 19
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 19
Gln Ser Val Glu Glu Ser Arg Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Thr Tyr Asn
20 25 30
Ile Gln Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Tyr Ile Gly
35 40 45
Thr Ile Gly Ser Ser Gly Ser Ala Tyr Tyr Ala Ser Arg Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Ala Leu Asn Thr Val Ser Leu Gln
65 70 75 80
Val Asp Ser Leu Thr Asp Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 20
<211> LENGTH: 110
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 20
Glu Leu Asp Leu Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ala Ser Gln Ser Val Ser Asn Leu
20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu Ile
35 40 45
Tyr Gly Ala Ser Asn Leu Glu Ser Gly Val Pro Ser Arg Phe Arg Gly
50 55 60
Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Asp Val Val Cys
65 70 75 80
Asp Asp Ala Ala Thr Tyr Tyr Cys Ala Gly His Lys Ser Ser Ser Thr
85 90 95
Asp Gly Thr Ala Phe Gly Gly Gly Thr Glu Leu Glu Ile Leu
100 105 110
<210> SEQ ID NO 21
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 21
Gln Ser Val Lys Glu Ser Glu Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Thr Val Ser Asn Asn Ala
20 25 30
Ile Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Ser Tyr Gly Gly Asn Thr Tyr Tyr Ala Asn Trp Pro Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 22
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 22
Gln Pro Val Leu Thr Gln Ser Pro Ser Ala Ser Ala Ala Leu Gly Ser
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Ala His Lys Thr Tyr Tyr
20 25 30
Ile Asp Trp Tyr Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Gln Val Lys Ser Asp Gly Ser Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Pro
65 70 75 80
Ser Val Gln Ala Asp Asp Glu Ala Asp Tyr Tyr Cys Gly Ser Asp Tyr
85 90 95
Ser Gly Gly Tyr Val Phe Gly Gly Gly Ala Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 23
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 23
Gln Ser Val Lys Glu Ser Glu Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Asn Tyr Gly
20 25 30
Val Ser Trp Val Arg Gln Ala Pro Gly Lys Glu Val Glu Trp Ile Gly
35 40 45
Tyr Ile Asn Ser Gly Gly Ser Thr Asn Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 24
<211> LENGTH: 108
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 24
Glu Leu Asp Met Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Asp Thr Val Thr Ile Asn Cys Gln Ala Ser Gln Ser Val Thr Asn Leu
20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Arg Gln Pro Pro Lys Leu Leu Ile
35 40 45
Tyr Asp Ala Ser Asn Leu Glu Ser Gly Val Pro Ser Arg Phe Arg Gly
50 55 60
Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Gly Met Lys Ala
65 70 75 80
Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Ser Gly Tyr Tyr Ser Ala Gly
85 90 95
Ala Thr Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105
<210> SEQ ID NO 25
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 25
Gln Ser Val Lys Glu Ser Glu Gly Gly Leu Phe Lys Pro Met Asp Ser
1 5 10 15
Met Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Ser Tyr Gly
20 25 30
Val Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Ser Ser Gly Gly Ser Ala Tyr Tyr Ala Arg Trp Ala Lys Ser
50 55 60
Arg Ala Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Ala Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 26
<211> LENGTH: 112
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 26
Glu Leu Val Leu Thr Gln Thr Pro Ser Pro Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ser Ser Gln Ser Val Tyr Ser Asn
20 25 30
Asn Arg Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Gln
35 40 45
Leu Ile Tyr Tyr Ala Ser Thr Leu Ala Ser Gly Val Ser Ser Arg Phe
50 55 60
Lys Gly Ser Gly Ser Gly Thr Gln Phe Thr Leu Thr Ile Ser Asp Val
65 70 75 80
Val Cys Asp Asp Ala Ala Thr Tyr Tyr Cys Ala Gly Tyr Lys Asn Ser
85 90 95
Gly Ile Asp Glu His Ala Phe Gly Gly Gly Thr Glu Leu Glu Ile Leu
100 105 110
<210> SEQ ID NO 27
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 27
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Asn Arg Tyr Asp
20 25 30
Met Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Val Ile Asn Ser Gly Gly Phe Thr Tyr Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Glu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 28
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 28
Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala Leu Gly Ala
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Gly His Lys Thr Tyr Thr
20 25 30
Ile Asp Trp Tyr Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Gln Leu Gly Ser Asp Gly Ser Tyr Thr Lys Gln Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Ser
65 70 75 80
Ser Val Gln Ala Asp Asp Glu Ala Asp Tyr Tyr Cys Gly Ala Asp Tyr
85 90 95
Ser Gly Gly Phe Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 29
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 29
Gln Ser Val Lys Glu Ser Glu Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Asn Asn Ala
20 25 30
Ile Asn Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ala Val Gly Ser Gly Gly Arg Ala Tyr Tyr Ala Gly Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Asn Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 30
<211> LENGTH: 110
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 30
Glu Leu Val Leu Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Ser Ile Ser Cys Gln Ser Ser Gln Ser Val Tyr Ser Asn
20 25 30
Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu
35 40 45
Ile Tyr Tyr Ala Ser Thr Leu Ala Ser Gly Val Ser Ser Arg Phe Lys
50 55 60
Gly Ser Gly Ser Gly Thr Gln Phe Thr Leu Thr Ile Asn Gly Val Gln
65 70 75 80
Cys Asp Asp Ala Ala Thr Tyr Tyr Cys Gln Gly Thr Phe Asp Asp Gly
85 90 95
Leu Tyr Lys Ala Phe Gly Gly Gly Thr Glu Leu Glu Ile Leu
100 105 110
<210> SEQ ID NO 31
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 31
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Asn Tyr Gly
20 25 30
Met Gly Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Tyr Ile Gly
35 40 45
Phe Ile Ser Ser Gly Gly Asn Thr Tyr Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asp Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Ser Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 32
<211> LENGTH: 108
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 32
Glu Leu Val Met Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ala Ser Gln Ser Val Tyr Asn Leu
20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu Thr
35 40 45
His Gly Thr Ser Asn Leu Glu Ser Gly Val Pro Ser Arg Phe Arg Gly
50 55 60
Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Gly Met Lys Ala
65 70 75 80
Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Ser Gly Tyr Tyr Ser Thr Gly
85 90 95
Ala Thr Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105
<210> SEQ ID NO 33
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 33
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Pro
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Ile Asn Asp Tyr Asn
20 25 30
Met Gln Trp Val Arg Gln Ala Pro Gly Ile Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Asn Ala Trp Gly Asp Thr Tyr Tyr Thr Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asp Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 34
<211> LENGTH: 112
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 34
Glu Leu Asp Leu Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ser Ser Gln Ser Val Asp Ser Asn
20 25 30
Asn Tyr Leu Ser Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu
35 40 45
Leu Ile Tyr Asp Ala Ser Thr Leu Ala Ser Gly Val Pro Ser Arg Phe
50 55 60
Ser Gly Ser Gly Ser Gly Thr Gln Phe Thr Leu Thr Ile Ser Glu Val
65 70 75 80
Gln Cys Asp Asp Ala Ala Thr Tyr Tyr Cys Gln Gly Ser Tyr Tyr Ser
85 90 95
Gly Asp Trp Tyr Gly Ala Phe Gly Gly Gly Thr Glu Leu Glu Ile Leu
100 105 110
<210> SEQ ID NO 35
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 35
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Ala Ser Gly Phe Thr Val Thr Ser Asn Ala
20 25 30
Ile Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Tyr Ile Gly
35 40 45
Phe Ile Gly Ala Ala Gly Asn Ala Asn Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 36
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 36
Glu Leu Val Met Thr Gln Thr Pro Ala Ser Val Ser Glu Pro Val Gly
1 5 10 15
Gly Thr Val Thr Ile Ser Cys Gln Ala Ser Gln Gly Val Tyr Ser Asp
20 25 30
Arg Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu
35 40 45
Met Tyr Tyr Ala Ser Asp Leu Ser Ser Gly Val Pro Ser Arg Phe Lys
50 55 60
Gly Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Asp Leu Glu
65 70 75 80
Cys Ala Asp Ala Ala Thr Tyr Tyr Cys Gln Ser Asn Tyr Gly Ser Leu
85 90 95
Ser Ser Ser Tyr Thr Phe Gly Gly Gly Thr Glu Val Val Val Lys
100 105 110
<210> SEQ ID NO 37
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 37
Gln Ser Val Glu Glu Ser Arg Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Thr Ile Asp Thr Tyr Gly
20 25 30
Val Thr Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Tyr Ile Gly
35 40 45
Phe Ile Ser Ser Gly Gly Ala Ala Tyr Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 38
<211> LENGTH: 106
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 38
Glu Leu Val Met Thr Gln Thr Pro Pro Ser Leu Ser Ala Ser Val Gly
1 5 10 15
Glu Thr Val Arg Ile Arg Cys Leu Ala Ser Glu Asn Val Tyr Ser Ala
20 25 30
Val Ala Trp Tyr Gln Gln Lys Pro Gly Lys Pro Pro Thr Leu Leu Ile
35 40 45
Ser Gly Ala Ser Asn Leu Glu Ser Gly Val Pro Pro Arg Phe Ser Gly
50 55 60
Ser Gly Ser Gly Thr Asp Tyr Thr Leu Thr Ile Gly Gly Val Gln Ala
65 70 75 80
Glu Asp Ala Ala Thr Tyr Phe Cys Gln Gly Tyr Ser Ser Tyr Leu Thr
85 90 95
Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105
<210> SEQ ID NO 39
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 39
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Ile Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Ile Tyr Asp
20 25 30
Ile Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Gly Ser Gly Asp Thr Thr Tyr Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Tyr Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 40
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 40
Gln Pro Val Leu Thr Gln Ser Pro Ser Ala Ser Ala Ala Leu Arg Ser
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Ala His Lys Ser Tyr Asp
20 25 30
Ile Asp Trp Tyr Gln Gln Gln Ser Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Arg Leu Arg Ser Asp Gly Lys Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Pro
65 70 75 80
Ser Val Gln Ala Asp Asp Gly Ala Asp Tyr Tyr Cys Gly Thr Asp Tyr
85 90 95
Ser Gly Gly Tyr Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 41
<211> LENGTH: 95
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 41
Glu Gln Leu Val Glu Ser Glu Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Asn Asn Tyr Gly
20 25 30
Val Thr Trp Val Arg Gln Ala Pro Gly Arg Gly Leu Glu Trp Ile Gly
35 40 45
Ala Val Trp Ser Gly Ala Thr Thr Asp Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Glu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Ser Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala
85 90 95
<210> SEQ ID NO 42
<211> LENGTH: 110
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 42
Glu Leu Val Met Thr Gln Thr Glu Ser Pro Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ala Ser Gln Ser Ile Ser Ser Trp
20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Pro Pro Thr Leu Leu Ile
35 40 45
Ser Gly Ala Ser Asn Leu Glu Ser Gly Val Pro Pro Arg Phe Ser Gly
50 55 60
Ser Gly Ser Gly Thr Asp Tyr Thr Leu Thr Ile Gly Gly Val Gln Ala
65 70 75 80
Glu Asp Ala Ala Thr Tyr Tyr Cys Leu Gly Gly Tyr Ser Tyr Ser Ser
85 90 95
Ile Gly Thr Thr Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105 110
<210> SEQ ID NO 43
<211> LENGTH: 98
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 43
Gln Glu Gln Leu Glu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Lys Leu Ser Cys Lys Ala Ser Gly Phe Asp Phe Ile Asn Tyr
20 25 30
Gly Val Ile Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Ile
35 40 45
Gly Tyr Ile Asp Pro Ile Phe Gly Asn Thr Ile Tyr Ala Ser Trp Val
50 55 60
Asn Asp Arg Phe Thr Ile Ser Ser His Asn Ala Gln Asn Thr Leu Tyr
65 70 75 80
Leu Gln Leu Asn Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys
85 90 95
Ala Arg
<210> SEQ ID NO 44
<211> LENGTH: 108
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 44
Glu Leu Val Met Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ala Ser Gln Ser Val Asn Asn Leu
20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu Thr
35 40 45
Tyr Gly Thr Ser Asn Leu Glu Ser Gly Val Pro Ser Arg Phe Arg Gly
50 55 60
Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Gly Met Lys Ala
65 70 75 80
Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Ser Gly Tyr Tyr Ser Ala Gly
85 90 95
Leu Thr Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105
<210> SEQ ID NO 45
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 45
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Ile Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Thr Asn Gly
20 25 30
Val Ser Trp Val Arg Gln Ala Pro Gly Ser Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Asp Leu Tyr Gly Ala Thr Tyr Tyr Ala Thr Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 46
<211> LENGTH: 110
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 46
Glu Leu Val Leu Thr Gln Thr Pro Ala Ser Val Ser Glu Pro Val Gly
1 5 10 15
Gly Thr Val Thr Ile Lys Cys Gln Ala Ser Gln Asn Ile Tyr Ser Gly
20 25 30
Ile Ser Trp Tyr Gln Gln Lys Pro Glu Lys Pro Pro Thr Leu Leu Ile
35 40 45
Ser Gly Ala Ser Asn Leu Glu Pro Gly Val Pro Pro Arg Phe Ser Gly
50 55 60
Ser Gly Ser Gly Thr Asp Tyr Thr Leu Thr Ile Gly Gly Val Gln Ala
65 70 75 80
Gly Asp Ala Ala Thr Tyr Tyr Cys Leu Gly Val Tyr Ser Phe Gly Ser
85 90 95
Thr Asp Leu Thr Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105 110
<210> SEQ ID NO 47
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 47
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Ser Tyr Ala
20 25 30
Ile Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Tyr Ile Asn Tyr Asp Gly Ile Ala Tyr Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Gly Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 48
<211> LENGTH: 110
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 48
Glu Leu Asp Leu Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Ser Ile Ser Cys Gln Ser Ser Gln Ser Val Tyr Asn Asn
20 25 30
Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu
35 40 45
Ile Tyr Tyr Ala Ser Lys Leu Ala Ser Gly Val Pro Ser Arg Phe Lys
50 55 60
Gly Ser Gly Ser Gly Thr Gln Phe Thr Leu Thr Ile Ser Asp Val Gln
65 70 75 80
Cys Asp Asp Ala Ala Thr Tyr Tyr Cys Gln Gly Thr Phe Asp Asn Gly
85 90 95
Leu Tyr Lys Ala Phe Gly Gly Gly Thr Glu Leu Glu Ile Leu
100 105 110
<210> SEQ ID NO 49
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 49
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser
1 5 10 15
Leu Lys Leu Ser Cys Lys Gly Ser Gly Phe Asp Leu Asp Ser Asn Ala
20 25 30
Met Cys Trp Val Arg Gln Ala Pro Gly Ser Gly Leu Glu Trp Ile Gly
35 40 45
Thr Ile Thr Ser Gly Gly Ser Ala Tyr Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 50
<211> LENGTH: 108
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 50
Glu Leu Asp Met Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Gln Ala Ser Glu Ser Ile Ser Asn Leu
20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu Ile
35 40 45
Tyr Ser Ala Ser Thr Leu Ala Ser Gly Val Pro Ser Arg Phe Arg Gly
50 55 60
Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Gly Met Lys Ala
65 70 75 80
Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Ser Gly Tyr Tyr Ser Thr Gly
85 90 95
Ala Thr Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105
<210> SEQ ID NO 51
<211> LENGTH: 98
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 51
Gln Glu Gln Leu Glu Glu Ser Gly Gly Arg Leu Val Lys Pro Asp Glu
1 5 10 15
Thr Leu Thr Leu Thr Cys Thr Val Ser Gly Leu Ser Leu Asn Asn Phe
20 25 30
Gly Val Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile
35 40 45
Arg Ala Ile Asp Phe Gly Ser Gly Ser Ala Tyr Tyr Ala Asn Trp Ala
50 55 60
Lys Ser Arg Ser Thr Ile Thr Ser Asn Thr Arg Leu Asn Thr Val Thr
65 70 75 80
Leu Lys Met Ile Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys
85 90 95
Ser Arg
<210> SEQ ID NO 52
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 52
Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala Leu Gly Ala
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Ala His Lys Thr Tyr Thr
20 25 30
Ile Asp Trp Tyr Gln Gln Gln Ser Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Gln Leu Lys Ser Asp Gly Asn Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Pro
65 70 75 80
Ser Val Gln Ala Asp Asp Glu Ala Asp Tyr Tyr Cys Gly Ala Asp Tyr
85 90 95
Ser Gly Gly Tyr Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 53
<211> LENGTH: 97
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 53
Gln Ser Val Lys Glu Ser Glu Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Asn Tyr Ala
20 25 30
Ile Asn Trp Val Arg Gln Ala Pro Gly Glu Gly Leu Glu Trp Ile Gly
35 40 45
Tyr Ile Asp Pro Thr Phe Gly Ser Thr Tyr Tyr Ala Ser Trp Val Asn
50 55 60
Asp Arg Phe Thr Ile Ser Ser His Asn Ala Gln Asn Thr Leu Tyr Leu
65 70 75 80
Gln Leu Asn Ser Leu Thr Pro Ala Asp Thr Ala Thr Tyr Phe Cys Ala
85 90 95
Arg
<210> SEQ ID NO 54
<211> LENGTH: 112
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 54
Glu Leu Asp Met Thr Gln Thr Pro Ser Ser Val Ser Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Ser Cys Gln Ala Ser Gln Ser Val Tyr Asn Asn
20 25 30
Asn Asn Leu Ser Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu
35 40 45
Leu Ile Tyr Asp Ala Ser Lys Leu Ala Ser Gly Val Pro Ser Arg Phe
50 55 60
Lys Gly Ser Gly Ser Gly Thr Gln Phe Thr Leu Thr Ile Ser Asp Leu
65 70 75 80
Glu Cys Asp Asn Ala Ala Thr Tyr Phe Cys Gln Gln Gly Tyr Asp Gly
85 90 95
Ser Asp Val Asp Asn Val Phe Gly Gly Gly Thr Glu Val Val Val Lys
100 105 110
<210> SEQ ID NO 55
<211> LENGTH: 95
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 55
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Gly Gly Ser
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Thr Ile Thr Ser Tyr His
20 25 30
Met Cys Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Gly Trp Ile Gly
35 40 45
Ala Val Ser Ala Ser Gly His Thr Tyr Tyr Ala Asn Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asp Thr Asn Leu Asn Thr Met Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala
85 90 95
<210> SEQ ID NO 56
<211> LENGTH: 108
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 56
Glu Leu Val Leu Thr Gln Thr Pro Pro Ser Leu Ser Ala Ser Val Gly
1 5 10 15
Glu Thr Val Arg Ile Arg Cys Leu Ala Ser Glu Phe Leu Phe Asn Ala
20 25 30
Val Ser Trp Tyr Gln Gln Lys Pro Glu Lys Pro Pro Thr Leu Pro Ile
35 40 45
Tyr Gly Ala Ser Asn Leu Glu Ser Gly Val Pro Pro Arg Phe Ser Gly
50 55 60
Ser Gly Ser Gly Thr Gln Phe Thr Leu Thr Ile Ser Asp Leu Glu Cys
65 70 75 80
Asp Asp Ala Ala Thr Tyr Tyr Cys Ala Gly Asp Tyr Ser Asp Trp Ile
85 90 95
Tyr Ala Phe Gly Gly Gly Thr Glu Val Val Val Lys
100 105
<210> SEQ ID NO 57
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 57
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Ser Tyr Gly
20 25 30
Ile Thr Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Gly Ser Asp Ala Lys Thr Tyr Tyr Ala Ser Trp Ala Lys Gly
50 55 60
Arg Ser Thr Ile Thr Gly Asp Thr Asn Leu Asn Thr Val Thr Leu Arg
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 58
<211> LENGTH: 112
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 58
Glu Leu Val Leu Thr Gln Thr Pro Ser Ser Val Pro Ala Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asp Cys Gln Ser Ser Glu Ser Val Tyr Asn Asn
20 25 30
Asn Asn Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu
35 40 45
Leu Ile Tyr Gly Ala Ser Thr Leu Ala Ser Gly Val Ser Ser Arg Phe
50 55 60
Lys Gly Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Asp Leu
65 70 75 80
Glu Cys Ala Asp Ala Ala Thr Tyr Tyr Cys Gln Gln Gly Tyr Ser Ile
85 90 95
Gly Asn Val Asp Asn Ala Phe Gly Gly Gly Thr Glu Leu Glu Ile Leu
100 105 110
<210> SEQ ID NO 59
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 59
Gln Ser Val Lys Glu Ser Glu Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Ser Tyr Gly
20 25 30
Val Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Ser Ser Gly Gly Asp Ala Tyr Tyr Ala Ser Trp Ala Thr Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 60
<211> LENGTH: 110
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 60
Glu Leu Val Met Thr Gln Thr Pro Ala Ser Val Glu Val Ala Val Gly
1 5 10 15
Gly Thr Val Thr Ile Lys Cys Gln Ala Ser Gln Ser Ile Ser Ser Tyr
20 25 30
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu Ile
35 40 45
Tyr Lys Ala Ser Thr Leu Ala Ser Gly Val Pro Ser Arg Phe Lys Gly
50 55 60
Ser Gly Ser Gly Thr Gln Phe Thr Leu Thr Ile Ser Asp Val Val Cys
65 70 75 80
Asp Asp Ala Ala Thr Tyr Tyr Cys Ala Gly Tyr Lys Gly Gly Ser Ser
85 90 95
Asp Gly Ser Ala Phe Gly Gly Gly Thr Glu Leu Glu Ile Leu
100 105 110
<210> SEQ ID NO 61
<211> LENGTH: 95
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 61
Gln Ser Val Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Ala Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Tyr Pro Gly
20 25 30
Val Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Tyr Ile Gly
35 40 45
Phe Ile Asn Ala Asp Gly Asp Ser Tyr Tyr Pro Thr Trp Ala Lys Arg
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala
85 90 95
<210> SEQ ID NO 62
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 62
Gln Pro Val Leu Thr Gln Ser Pro Ser Ala Ser Ala Ala Leu Gly Ser
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Ala His Lys Thr Tyr Tyr
20 25 30
Ile Glu Trp Tyr Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Gln Val Lys Ser Asp Gly Ser Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Pro
65 70 75 80
Ser Val Gln Ala Asp Asp Glu Ala Asp Tyr Tyr Cys Gly Ala Asp Tyr
85 90 95
Ser Gly Gly Tyr Val Leu Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 63
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 63
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Ala Asp Thr
1 5 10 15
Leu Thr Leu Ala Cys Thr Val Ser Gly Phe Ser Leu Ser Thr Tyr Gly
20 25 30
Val Ile Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Tyr Ile Ala
35 40 45
Tyr Ile Asn Tyr Ser Gly Ser Pro Tyr Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Glu Lys Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 64
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 64
Gln Pro Val Leu Thr Gln Ser Pro Ser Ala Ser Ala Ala Leu Gly Ser
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Ala His Lys Thr Tyr Tyr
20 25 30
Ile Asp Trp Tyr Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Gln Leu Gly Ser Asp Gly Ser Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Pro
65 70 75 80
Ser Val Gln Ala Asp Asp Glu Ala Asp Tyr Tyr Cys Gly Ser Asp Tyr
85 90 95
Ser Gly Gly Tyr Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 65
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 65
Ser Arg Trp Arg Ser Pro Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Gly Tyr Gly
20 25 30
Val Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Ser Ser Gly Gly Ser Ala Tyr Tyr Ala Arg Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 66
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 66
Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala Leu Gly Ala
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Ala His Lys Thr Tyr Thr
20 25 30
Ile Asp Trp Tyr Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Met
35 40 45
Gln Leu Lys Ser Asp Gly Ser Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Ala Asp Arg Tyr Leu Ile Ile Pro
65 70 75 80
Ser Val Gln Ala Asp Asp Glu Ala Asp Tyr Tyr Cys Gly Ala Asp Tyr
85 90 95
Ser Gly Gly Tyr Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 67
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 67
Gln Ser Val Lys Glu Ser Glu Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Asn Tyr Gly
20 25 30
Val Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Tyr Ile Gly
35 40 45
Phe Ile Ser Asn Gly Gly Ala Thr Phe Tyr Ala Thr Trp Ala Arg Ser
50 55 60
Arg Ala Thr Ile Thr Arg Asn Thr Gly Leu Asn Thr Val Ala Leu Thr
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Val Arg
85 90 95
<210> SEQ ID NO 68
<211> LENGTH: 110
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 68
Glu Leu Asp Met Thr Gln Thr Pro Pro Ser Leu Ser Ala Ser Val Gly
1 5 10 15
Glu Thr Val Arg Ile Arg Cys Leu Ala Ser Glu Asp Ile Gly Ser Ala
20 25 30
Ile Ser Trp Tyr Gln Gln Lys Pro Gly Lys Pro Pro Thr Leu Leu Ile
35 40 45
Tyr Gly Val Phe Asn Leu Glu Ser Gly Val Pro Pro Arg Phe Ser Gly
50 55 60
Ser Gly Ser Gly Thr Asp Tyr Thr Leu Thr Ile Gly Gly Val Gln Ala
65 70 75 80
Glu Asp Ala Ala Thr Tyr Tyr Cys Leu Gly Gly Ala Ser Asp Ser Ser
85 90 95
Thr Gly Leu Thr Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105 110
<210> SEQ ID NO 69
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 69
Gln Ser Val Lys Glu Ser Glu Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Gln Thr Leu Thr Cys Thr Val Ser Gly Phe Ser Leu Ser Ser Asn Ala
20 25 30
Ile Ser Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Lys Ser Ile Gly
35 40 45
Phe Ile Asn Ser Gly Gly Gly Ala Tyr Tyr Ala Thr Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Glu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 70
<211> LENGTH: 119
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 70
Gln Pro Val Leu Thr Gln Ser Pro Ser Leu Ser Ala Ser Leu Gly Thr
1 5 10 15
Thr Ala Arg Leu Thr Cys Thr Leu Ser Thr Gly Tyr Ser Val Gly Glu
20 25 30
Tyr Pro Leu Val Trp Leu Gln Gln Val Pro Gly Arg Pro Pro Arg Tyr
35 40 45
Leu Leu Ser Phe Thr Ser Asp Glu Asp Lys His His Asp Ser Trp Gly
50 55 60
Pro Thr Arg Phe Ser Gly Ser Lys Asp Thr Ser Glu Asn Thr Phe Ile
65 70 75 80
Leu Ser Ile Ser Gly Leu Gln Pro Glu Asp Glu Ala Asp Tyr Tyr Cys
85 90 95
Ala Thr Ala His Gly Ser Asp Asn Ser Leu His Tyr Val Phe Gly Gly
100 105 110
Arg Thr Gln Leu Thr Val Thr
115
<210> SEQ ID NO 71
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 71
Gln Ser Leu Glu Glu Ser Gly Gly Gly Leu Phe Lys Pro Thr Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Ala Leu Asn Asn Tyr Asn
20 25 30
Ile His Trp Val Arg Gln Ala Pro Gly Asn Gly Leu Glu Trp Ile Gly
35 40 45
Ala Ile Gly Ser Ser Gly Ser Ala Tyr Tyr Ala Ser Trp Ala Lys Ser
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Leu Asn Thr Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 72
<211> LENGTH: 111
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 72
Gln Pro Val Leu Thr Gln Ser Pro Ser Ala Ser Ala Ala Leu Gly Ser
1 5 10 15
Ser Ala Lys Leu Thr Cys Thr Leu Ser Ser Ala His Lys Thr Tyr Tyr
20 25 30
Ile Glu Trp Tyr Gln Gln Gln Gln Gly Glu Ala Pro Arg Tyr Leu Ile
35 40 45
Gln Leu Lys Ser Asp Gly Ser Tyr Thr Lys Gly Thr Gly Val Pro Asp
50 55 60
Arg Phe Ser Gly Ser Ser Ser Gly Thr Asp Arg Tyr Leu Ile Ile Ser
65 70 75 80
Ser Val Gln Ala Glu Asp Glu Ala Asp Tyr Ser Cys Gly Ala Asp Tyr
85 90 95
Ser Gly Gly Phe Val Phe Gly Gly Gly Thr Gln Leu Thr Val Thr
100 105 110
<210> SEQ ID NO 73
<211> LENGTH: 96
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 73
Val Gly Gly Gly Val Gln Gly Gly Gly Leu Val Lys Pro Gly Asp Thr
1 5 10 15
Leu Thr Leu Thr Cys Thr Val Ser Gly Phe Pro Leu Ser Ser Tyr Asp
20 25 30
Met Asn Trp Val Arg Gln Ala Pro Gly Glu Gly Leu Glu Trp Ile Gly
35 40 45
Trp Ile Thr Tyr Asp Gly Tyr Asn His Tyr Ala Ser Trp Ala Asn Gly
50 55 60
Arg Ser Thr Ile Thr Arg Asn Thr Asn Glu Asn Ala Val Thr Leu Lys
65 70 75 80
Met Thr Ser Leu Thr Ala Ala Asp Thr Ala Thr Tyr Phe Cys Ala Arg
85 90 95
<210> SEQ ID NO 74
<211> LENGTH: 107
<212> TYPE: PRT
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polypeptide
<400> SEQUENCE: 74
Glu Leu Val Leu Thr Gln Thr Pro Pro Ser Leu Ser Ala Ser Val Gly
1 5 10 15
Gly Thr Val Thr Ile Asn Cys Leu Ala Ser Glu Asn Val Tyr Ser Ala
20 25 30
Val Ala Trp Tyr Gln Gln Lys Pro Gly Lys Pro Pro Thr Leu Leu Ile
35 40 45
Ser Gly Thr Ser Asn Leu Glu Ala Gly Val Pro Pro Arg Phe Ser Gly
50 55 60
Ser Gly Ser Gly Thr Asp Tyr Thr Leu Thr Ile Gly Gly Val Gln Ala
65 70 75 80
Glu Asp Ala Ala Thr Tyr Phe Cys Gln Gly Tyr Ser Ser Tyr Pro Leu
85 90 95
Thr Phe Gly Ala Gly Thr Asn Val Glu Ile Lys
100 105
<210> SEQ ID NO 75
<211> LENGTH: 804
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 75
cccagccggc catggctgag ctcgtgatga cccagactga atcgcccgtg tctgcagctg 60
tgggaagcac agtcaccatc aattgccagg ccagtcagag tgtttatagt aacaacaact 120
tagcctggtt tcagaagaaa ccagggcagc ctcccaagcg cctgatccat tctgcatcca 180
ctctggcatc tggggtccca tcgcggttca aaggcagtgg atctgggaca cagttcactc 240
tcaccatcag cgacctggag tgtgacgatg ctgccactta ctactgtgca ggcgttttta 300
gtggtagtat tagtgttttc ggcggaggga ccgaggtggt cgtcaaggtg gttcctctag 360
atcttcctcc tctggtggcg gtggctcggg cggtggtggg cagtcgctgg aggagtccgg 420
gggaggtctc ttcaagccaa cggataccct gacactcacc tgcacagtct ctggattctc 480
cctcagtaac tatggagtgg tctgggtccg ccaggctcca gggaacgggc tggaatggat 540
cggaatcatt gatcatcatg gtatcccata ctacgcaacc tgggcgaaaa gccgatccac 600
catcaccaga aacaccaacc tggacacggt gactctgaaa atgaccagtc tgacagccgc 660
ggacacggcc acctatttct gtgcgagagc ttacgttaat tttggctggg attatgctct 720
taacatctgg ggtccaggca ccctggtcac cgtctcctca gggcaaccta aggctccgtc 780
agtcactagt ggcccgggag gcca 804
<210> SEQ ID NO 76
<211> LENGTH: 803
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 76
ccggccatgg ctcagcctgt gctgactcag tcgccctctg tgtctgctgc cctgggatcc 60
tcggccaagc tcacctgcac tctgagcagt gctcacaaga cctactatat tgaatggtat 120
cagcaacaac aaggggaggc ccctcggtac ctgatgcaac ttgagagtga tggaagctac 180
accaagggga ccggggtccc tgatcgcttc tcgggctcca gctctggggc tgaccgctac 240
ttgatcatct ccagcgtcca ggctgaggac gaagccgact actattgtgg tgcagattat 300
agtggtgggt ttgtgttcgg cggagggacc cagctgaccg tcacaggtgg tggttcctct 360
agatcttcct cctctggtgg cggtggctcg ggcggtggtg ggcagtcggt gaaggagtcc 420
ggggaggtct cctcaagcca acggataccc tgacactcac ctgcacagtc tctggattct 480
ccctcaatag ctatgcagta ttctgggtcc gccaggctcc agggaacggg ctggaatgga 540
tcggaaccgt tagtagtgtt ggtgacacat acttcgcgac ctgggcgaaa agccgatcca 600
ccatcaccag aaacaccaac ctgaacacgg tgactctgaa aatgaccagt ctgacagccg 660
cggacacggc cacctatttt tgtgcgaggg gggttggtgt tagttattat cttgatgctt 720
ttgattcttg gggcccaggc accctggtca ccgtctcctc agggcaacca ggctccatca 780
gtcactagtg gcccgggagg cca 803
<210> SEQ ID NO 77
<211> LENGTH: 809
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 77
ccggccatgg ctgagctcgt gatgacccag actgaacccc ccgtgtctgc acctgtggga 60
ggcacagtca ccatcaattg ccaggccagt cagaacattg gtagtagcta cttatcctgg 120
tatcagcaga aaccagggca gcctcccaag ctcctgatct accaggcttc cactctggca 180
tctggggtcc catcgcggtt caaaggcggt ggatctggga cagactacag tctcaccatc 240
agcggcgtgc agtgtgccga tgccgccact tattactgtc aaagtacttt ttatagtagt 300
ggtactggtt atgctttcgg cggagggacc gagctggaga tcctggtggt tcctctagat 360
cttcctcctc tggtggcggt ggctcgggcg gtggtgggca gtcggtggag gagtccgggg 420
gaggtctctt caagccaacg gataccctga cactcacctg cacagtctct ggattctccc 480
tcagtggcta tggagtgagc tgggtccgcc aggctgcagg gaacgggctg gaatggatcg 540
gagccattag tagtggtggt agcgcatact acgcgagatg ggcgaaaagc cgatccacca 600
tcaccagaaa caccaacctg aacacggtga ctctgaaaat gaccagtctg acagccgcgg 660
acacggccac ctatttctgt gcgagaggtt actatactgc tattggtggt acttatgaca 720
atgcttttga tccctggggc ccaggcaccc tggtcaccgt ctcctcaggg caacctaagg 780
ccatcagtca ctagtggccc gggaggcca 809
<210> SEQ ID NO 78
<211> LENGTH: 806
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (750)..(750)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (763)..(763)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (766)..(766)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (772)..(772)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (774)..(775)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<400> SEQUENCE: 78
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgtgt ctgccgccct 60
gggagcctct gccaagctca cctgcaccct gagcagtggc cacaagacct acaccattga 120
ctggtatcag cagcagcagc aaggggaggc ccctcggtac ctgatgcaga ttgggagtga 180
tggaagctac accaagggga ccggggtccc tgatcgcttc tcgggctcca gctctgggac 240
tgaccgctac ttgatcatct ccagcgtcca ggctgaggac gaagccgact actattgtgg 300
tgcagattat agtggtgggt ttgtgttcgg cggagggacc cagctgaccg tcacaggtgg 360
tggttcctct agatcttcct cctctggtgg cggtggctcg ggcggtggtg ggcagtcggt 420
gaaggagtcc gagggaggtc tcttcaagcc aacggatacc ctgacactca cctgcacagc 480
ctccgaattc accatcggta gttatagtag tggctgggtc cgccaggctc cagggaagga 540
gctggagtgg atcggaaccc ttagttctac tggtagcgca cactacgcga actgggcgaa 600
aggccgttcc accatcacca gaaacaccaa cgagaacacg gtgactctga agatggccag 660
tctgacagcc gcggacacgg ccacctattt ctgtgcgaga gctgattatg ggccctgtta 720
ttttgacatc tggggcccag gcaccctggn caccgttttc tcnggnaacc tnannctcca 780
tcagtcacta gtggcccggg aggcca 806
<210> SEQ ID NO 79
<211> LENGTH: 794
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 79
ccggccatgg ctgagctcgt gatgacccag actccatcct ctgtgtctgc agctgtggga 60
ggcacagtca ccatcaattg ccaggccagt cagactatta acaacctctt agcctggtat 120
cagcagaaac cagggcagcc tcccaagctc ctgatttatg gtgcatccac tctggcatct 180
ggggtcccat cgcgtttcag cggcagtgga tctgggacac agttcattct caccatcagt 240
ggcatgaagg ctgaagatgc tgccacttat tactgtcaaa gtgcttatta taatgctggt 300
gcgacttttg gagctggcac caatgtggaa atcaaggtgg ttcctctaga tcttcctcct 360
ctggtggcgg tggctcgggc ggtggtgggc agtcggtgga ggagtccggg ggaggtctct 420
tcaagccaac ggataccctg acactcacct gcacagtctc tggaatcgac ctcagtagaa 480
atggagtgac ctgggtccgc caggctccag ggagcgggct ggaatggatc ggagtcatta 540
atagtcatgg tgacagtgat tacgcgacct gggcgaacag ccgatccacc atcaccagaa 600
acaccaacct gaacacggtg actctgaaaa tgaccagtct gacagccgcg gacacggcca 660
cctatttctg tgcgagtact tatgatagtt attatgatta tgcttggcct aattttggca 720
tctggggccc aggcaccctg gtcaccgtct cctcagggca acctaaggcc agtcactagt 780
ggcccgggag gcca 794
<210> SEQ ID NO 80
<211> LENGTH: 810
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 80
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgtgt ctgccgccct 60
gggagcctct gccaagttca cctgcaccct gagcagtggc cacaagacct acaccattga 120
ctggtatcag cagcagcagc aaggggaggc ccctcggtac ctgatgcaga ttgggagtga 180
tggaagctac accaagggga ccggggtccc tgatcgcttc tcgggctcca gctctgggac 240
tgaccgctac ttgatcatct ccagcgtcca ggctgaggac gaagctgact acatctgtgg 300
tgtaactggt agtaatgttt atgcacagga cccagctgac cgtcacaggt ggtggttcct 360
ctagatcttc ccctggtggc ggtggccggg cggtggtggg cagtcgctgg aggagtccgg 420
gggaggtctc ttcaagccaa cggataccct gacactcacc tgcacagtct ctggattctc 480
cctcagtaac agtgcaatga gctgggtccg ccaggctcca gggaacgggc tggaatggat 540
cggagacatt gatagtagtg gtagcgcata ctacgcgagc tgggcgaaaa gccgatccac 600
catcaccaga aacaccaacc tgaacacggt gactctgaaa atgaccagtc tgacagccgc 660
ggacacggcc acctatttct gtgcgagagg gggttatggt aatgctggta ctccttacta 720
tggcatggac ctctggggcc cagggaccct cgtcaccgtc tcctcagggc aacctaaggc 780
tccatcagtc actagtggcc cgggaggcca 810
<210> SEQ ID NO 81
<211> LENGTH: 762
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (705)..(705)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<400> SEQUENCE: 81
ccggccatgg ctgagctcgt gatgacccag actccatcct ctgtgtctgc agctgtggga 60
ggcacagtca ccatcaattg ccaggccagt gaaagcatta gcaactactt agcctggtat 120
cagcagaaac cagggcagcc tcccaagctc ctgacctatg atgcatctga tctggcatct 180
ggggtcccat cgcggttcag cggcagtgga tatgggacag agttcactct caccattagt 240
ggcgtgaagg ctgaagatgc tgccacttat tattgtcaaa gtggttatgt tagtgctggg 300
acttttggag ctggcaccaa tgtggaaatc aaggtggttc ctctagatct tcctcctctg 360
gtggggcggt ggtgggcagt cgttggagga gtccggggga ggtctcttca agccaacgga 420
taccctgaca ctcacctgca cagtctctgg attcgacatt agtggcgttt acatgagctg 480
ggtccgccag gctccaggga acgggctgga gtggatcgga gccattgatc gtggtggtgg 540
cacttactac gcgagctggg cgataggccg atccaccatc accagaaaca ccaacgacaa 600
cacggtgact ctggaaatga ccagtctgac agccgcggac acggccacct atttctgtgc 660
gaaaggatat agtgttcttg atccctgggg cccaggcacc ctggncaccg tctcctcagg 720
gcaacctaag gctccatcag tcactagtgg cccgggaggc ca 762
<210> SEQ ID NO 82
<211> LENGTH: 810
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 82
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgtgt ctgccgccct 60
gggagcctct gccaagctca cctgcaccct gagcagtgcc cacaagacct acaccattga 120
ctggtatcag cagcagcaag gggaggcccc tcgatacctg atgcatctta agagtgatgg 180
aacctacacc aaggggaccg gggtccctga tcgcttctcg ggctccagct ctggggctga 240
ccgctacttg atcatcccca gcgtccgaac tgatgacgaa gccgactact attgtggtac 300
agattacagc ggtgggtatg tattcggcgg agggacccag ctgaccgtca caggtggtgg 360
ttcctctaga tcttcctcct ctggtggcgg tggctcgggc ggtggtgggc agtcgctgga 420
ggagtccggg ggaggcctga tcaagccaac ggatatgttg acactcacct gcacagtctc 480
tggattctcc ctcagtaact atggagtgat gtgggtccgc caggctccag ggaacggact 540
ggagtcgatc ggatatattg gtagtggtgg tgacacatcc tacgcgagct gggcgaaaag 600
ccgatccacc atcgccagaa acaccaacga gaacacggtg tctctgctca tgaatggtct 660
gacagccgcg gacacggcca cctatttctg tgcgagagat cctggttata gtgctggtag 720
tgcttttgat ccctggggcc caggcaccct ggtcaccgtc ttctcagggc aacctaaggc 780
tccatcagtc actagtggcc cgggaggcca 810
<210> SEQ ID NO 83
<211> LENGTH: 820
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 83
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgcat ctgctgccct 60
gggatcctcg gccaagctca cctgcactct gagcagtgct cacaagacct actatattga 120
ctggtatcag cagcagcaag gggaggcccc tcggtacctg atgcaggtta agagtgatgg 180
aagctacacc agggggaccg gggtccctga tcgcttctcg ggctccagct ctggggctga 240
ccgctacttg atcatcccca gcgtccaggc tgatgacgaa gccgactact attgtggttc 300
agattatagc ggtgggtatg tgttcggcgg agggacccag ctgaccgtca caggtggtgg 360
ttcctctaga tcttcctcct ctggtggcgg tggctcgggc ggtggtgggc agtcgttgga 420
ggagtccggg ggaggtctct tcaagccaac ggataccctg acactcacct gcacagtctc 480
tggattctcc ctcagtatct atggagtgag ctgggtccgc caggctccgg ggaatgggct 540
ggaatgggtc ggagccattg gtagtggtgg tagcgcatac tacgcgacct gggcgaaaag 600
ccgatccacc atcaccagaa acaccaacct gaacacggtg actctgaaaa tggccagtct 660
gacagccgcg gacacggcca cctatttctg tgcgagaggt tactatactg ctattggtgg 720
tacttatgac aatgcttttg atccctgggg cccaggcacc ctggtcaccg tctcctcagg 780
gcaacctaag tccatcagtc actagtggcc cgggaggcca 820
<210> SEQ ID NO 84
<211> LENGTH: 799
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (754)..(754)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (763)..(763)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (767)..(767)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (788)..(788)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<400> SEQUENCE: 84
ccggccatgg ctgagctcga tctgacccag actccatcct ctgtgtctgc agctgtggga 60
ggcacagtca ccatcaattg ccaggccagt cagagtgtta gcaacctctt agcctggtat 120
cagcagaaac cagggcagcc tcccaagctc ctgatttatg gtgcatccaa tctggaatct 180
ggggtcccat cgcgtttccg tggcagtgga tctgggacag agttcactct caccatcagc 240
gatgtggtgt gtgacgatgc tgccacttac tactgtgcag gacataaaag tagtagtact 300
gatggtactg ctttcggcgg agggaccgag ctggagatcc tggtggttcc tctagatctt 360
cctcctctgg tggcggtggc tcgggcggtg gtgggcagtc ggtggaggag tccaggggag 420
gtctcttcaa gccaacggat accctgacac tcacctgtac agtctctgga ttctccctta 480
gtacctacaa catacaatgg gtccgccagg ctccagggaa cgggctggaa tatatcggaa 540
ccattggtag tagtggtagc gcatactacg cgagccgggc gaaaagccga tccaccatca 600
ccagaaacac cgccctgaac acggtgtctc tgcaagtgga cagtctgaca gacgcggaca 660
cggccaccta tttctgtgcg agaggaggga cttggtatac agatggtctt gcttatgttg 720
atgcttttga tctctggggc ccaggcaccc tggncaccgc ctnctcnggc aacctagtca 780
ctagtggncc gggaggcca 799
<210> SEQ ID NO 85
<211> LENGTH: 807
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 85
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgcat ctgctgccct 60
gggatcctcg gccaagctca cctgcactct gagcagtgct cacaagacct actatattga 120
ctggtatcag cagcagcaag gggaggcccc tcggtatctg atgcaggtta agagtgatgg 180
aagctacacc aaggggaccg gggtccctga tcgcttctcg ggctccagct ctggggctga 240
ccgctacttg atcatcccca gcgtccaggc tgatgacgaa gccgactact attgtggttc 300
agattatagc ggtgggtatg tgttcggcgg aggggcccag ctgaccgtca caggtggtgg 360
ttcctctaga tcttcctcct ctggtggcgg tggctcgggc ggtggtgggc agtcggtgaa 420
ggagtccgag ggaggtctct tcaagccaac ggataccctg acactcacct gcacagtctc 480
tggattcacc gtcagtaaca atgcaataag ctgggtccgc caggctccag ggaatgggct 540
ggaatggatc ggagccatta gttacggtgg taacacatac tacgcgaact ggccgaaaag 600
ccgatccacc atcaccagaa acaccaacct gaacacggtg actctgaaaa tgaccagtct 660
gacagccgcg gacacggcca cctatttctg tgcgagattc tactatggtg ctggttatgc 720
ctatgacatc tggggcccag gcaccctggt caccgtcttc tcagggcaac ctaaggctcc 780
gtcagtcact agtggcccgg gaggcca 807
<210> SEQ ID NO 86
<211> LENGTH: 792
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (729)..(729)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (755)..(755)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (762)..(763)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<400> SEQUENCE: 86
ccggccatgg ctgagctcga tatgacccag actccatcct ctgtgtctgc agctgtggga 60
gacacagtca ccatcaattg tcaggccagt cagagtgtta ccaacctctt agcctggtat 120
cagcagaaac caaggcagcc tcccaaactc ctgatttatg atgcatccaa tctagaatct 180
ggagtcccat cgcgtttccg tggcagtgga tctgggacag agttcactct caccatcagt 240
ggcatgaagg ctgaagatgc tgccacttat tactgtcaaa gtggttatta tagtgctggt 300
gcgacttttg gagctggcac caatgtggaa atcaaggtgg ttcctctaga tcttcctcct 360
ctggtggcgg tggctcgggc ggtggtgggc agtcggtgaa ggagtccgag ggaggtctct 420
tcaagccaac ggataccctg acactcacct gcacagtctc tggattctcc ctcagtaact 480
atggagtgag ctgggtccgc caggctccag ggaaggaggt ggagtggatc ggatacatta 540
acagtggtgg tagtactaat tacgcgagct gggcgaaaag ccgatccacc atcaccagaa 600
acaccaattt gaacacggtg actctgaaaa tgaccagcct gacagccgcg gacacggcca 660
cctatttctg tgcgagaggt taccgtggtt ataatgttgg tatggatgct tttgatgtct 720
ggggcccang caatctggtc accgtctcct caggnaacct annctctcag tcactagtgg 780
cccgggaggc ca 792
<210> SEQ ID NO 87
<211> LENGTH: 804
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 87
ccggccatgg ctgagctcgt gctgacccag actccatccc cagtgtctgc ggctgttgga 60
ggcacagtca ccatcaattg ccagtccagt cagagtgttt atagtaacaa ccgcttagcc 120
tggtatcagc agaaaccagg gcagcctccc aagcaactga tctattatgc atccactctg 180
gcatctgggg tctcatcgcg gttcaaaggc agtggatctg ggacacagtt cactctcacc 240
atcagcgatg tggtgtgtga cgatgctgcc acttactact gtgcaggata taaaaatagt 300
ggtattgatg aacatgcttt cggcggaggg accgagctgg agatcctggt ggttcctcta 360
gacttctcct ctggtggcgg tggctcgggc ggtggtgggc agtcggtgaa ggagtccgag 420
ggaggtctct tcaagccaat ggatagcatg acactcacct gcacagtctc tggattctcc 480
ctcagtagct atggagtgag ctgggtccgc caggctccag ggaacgggct ggaatggatc 540
ggagccatta gtagtggtgg tagcgcatac tacgcgagat gggcgaaaag ccgagccacc 600
atcaccagaa acaccaacct gaacacggtg actctgaaaa tggccagtct gacagccgcg 660
gacacggcca cctatttctg tgcgagaggt tactatactg ctattggtgg tacttatgac 720
aatgcttttg atccctgggg cccaggcacc ctggtcaccg tctcctcagg gcaacctaac 780
agtcactagt ggcccgggag gcca 804
<210> SEQ ID NO 88
<211> LENGTH: 812
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 88
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgtgt ctgccgccct 60
gggagcctct gccaagctca cctgcaccct gagcagtggc cacaagacct acaccattga 120
ctggtatcag cagcagcaag gggaggcccc tcggtacctg atgcagcttg ggagtgatgg 180
aagctacacc aagcagaccg gggtccctga tcgcttctcg ggctccagct ctggggctga 240
ccgctacttg atcatctcca gcgtccaggc tgatgacgaa gccgactact attgtggtgc 300
ggattatagt ggtgggtttg tgttcggcgg agggacccag ctgaccgtca caggtggtgg 360
cctctagatc ttcctcctct ggtggcggtg gctcgggcgg tggtgggcag tcgttggagg 420
agtccggggg aggtctcttc aagccaacgg ataccctgac actcacctgc acagtctctg 480
gattctccct caacaggtac gacatgagtt gggtccgcca ggctccaggg aacgggctgg 540
aatggatcgg agtcattaat agtggtgggt tcacatacta cgcgagctgg gcgaaaagcc 600
gatccaccat caccagaaac accaacgaga acacggtgac tctgaaaatg accagtctga 660
cagccgcgga cacggccacc tatttctgtg cgagaggtta ccgtggttat aatgttggta 720
tggatgcttt tgatgtctgg ggcccaggca atctggtcac cgtctcctca gggcaaccta 780
agtccgtcag tcactagtgg cccgggaggc ca 812
<210> SEQ ID NO 89
<211> LENGTH: 818
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 89
ggcccagccg gccatggctg agctcgtgct gacccagact ccatcgtccg tgtctgcagc 60
tgtgggaggc acagtcagca tcagttgcca gtccagtcag agtgtttata gtaactactt 120
agcctggtat cagcagaaac cagggcagcc tcccaagctc ctgatctatt atgcatccac 180
tctggcatct ggggtctcat cgcggttcaa aggcagtgga tctgggacac agttcactct 240
caccatcaac ggcgtgcagt gtgacgatgc tgccacttac tactgtcaag gcacttttga 300
tgatggtttg tacaaggctt tcggcggagg gaccgagctg gagatcctgg tggttcctct 360
agatcttcct cctctggtgg cggtggctcg ggcggtgtgg gcagtcggtg aaggagtccg 420
agggaggtct cttcaagcca acggataccc tgacactcac ctgcacagtc tctggattct 480
ccctcagtaa caatgcaata aactgggtcc gccaggctcc agggaacggg ctggagtgga 540
tcggagccgt tggtagtggt ggtagggcat actacgcggg ctgggcgaaa agccgatcca 600
ccatcaccag aaacaccaac ctgaacacgg tgactctgaa aatgacgaat ctgacagccg 660
cggacacggc cacctatttc tgtgcgagag tcggatttta ctatggcaat ggtctttctt 720
atggtattgg cgcttttgat ccctggggcc caggcaccct ggtcaccgtc tcctcagggc 780
aaccaggctc cgtcagtcac tagtggcccg ggaggcca 818
<210> SEQ ID NO 90
<211> LENGTH: 794
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 90
ccggccatgg ctgagctcgt gatgacccag actccatcct ctgtgtctgc agctgtggga 60
ggcacagtca ccatcaattg ccaggccagt cagagtgttt acaacctctt agcctggtat 120
cagcagaaac cagggcagcc tcccaagctc ctgactcatg gtacatccaa tctggaatct 180
ggggtcccat cgcgtttccg tggcagtgga tctgggacag agttcactct caccatcagt 240
ggcatgaagg ctgaagatgc tgccacttat tactgtcaaa gtggttatta tagtactggt 300
gcgacttttg gagctggcac caatgtggaa atcaaggtgg ttcctctaga tcttcctcct 360
ccggtggcgg tggctcgggc ggtggtgggc agtcgctgga ggagtccggg ggaggtctct 420
tcaagccaac ggataccctg acactcacct gcacagtctc tggattctcc ctcagtaact 480
atggaatggg ctgggtccgc caggctccag ggaacgggct ggaatacatc ggattcatta 540
gtagtggtgg taatacatac tacgcgagct gggcgaaaag ccgatccacc atcaccagag 600
acaccaacct gaacacggtg actctgaaaa tgagcagtct gacagccgcg gacacggcca 660
cctatttctg tgcgagaggt taccgtggtt ataatgttgg tatggatgct tttgatgtct 720
ggggcccagg caatctggtc accgtctcct cagggcaaca aggctccatc agtcactagt 780
ggcccgggag gcca 794
<210> SEQ ID NO 91
<211> LENGTH: 784
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (686)..(686)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<400> SEQUENCE: 91
ccggccatgg ctgagctcga tctgacccag actccatcct ccgtgtctgc agctgtggga 60
ggcacagtca ccatcaattg ccagtccagt cagagtgttg atagtaacaa ttacttatcc 120
tggtatcagc agaaaccagg gcagcctccc aagctcctga tctatgatgc atccactctg 180
gcatctgggg tcccatcgcg gttcagcggc agtggatctg ggacacagtt cactctcacc 240
atcagcgaag tacagtgtga cgatgctgcc acttactact gtcaaggcag ttattatagt 300
ggtgattggt atggggcttt cggcggaggg accgagctgg agatcctggt ggttcctcta 360
gatcttcctc ctctggtggc ggtggctcgg gcggtggtgg gcagtcgttg gaggagtccg 420
ggggaggtct cttcaagcca acggatcccc tgacactcac ctgcacagtc tctggattct 480
ccatcaatga ctacaacatg caatgggtcc gccaggctcc agggatcggg ctggaatgga 540
tcggagccat taatgcttgg ggtgatacat actatacgag ctgggcgaaa agccgatcca 600
ccatcaccag agacaccaac ctgaacacgg tgactctgaa aatgaccagt ctgacagccg 660
cggacacggc cacctatttc tgtgcnagag gttacagtct tgacatctgg ggcccaggca 720
ccctggtcac cgtctcctca gggcaaccta aggctccgtc agtcactagt ggcccgggag 780
gcca 784
<210> SEQ ID NO 92
<211> LENGTH: 807
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 92
cccagccggc catggctgag ctcgtgatga cccagactcc agcctccgtg tctgaacctg 60
tgggaggcac agtcaccatc agttgccagg ccagtcaggg tgtttatagc gaccgcctag 120
cctggtatca acagaaacca gggcagcctc ccaagctcct gatgtattat gcatccgatc 180
tgtcatctgg ggtcccatcg cggttcaaag gcagtggatc tgggacagag ttcactctca 240
ccatcagcga cctggagtgt gccgatgctg ccacttacta ctgtcaaagc aattatggta 300
gtcttagtag tagttatact ttcggcggag ggaccgaggt ggtcgtcaag gtggttcctc 360
tagatcttcc tcctctggtg gcggtggctc gggcggtggt gggcagtcgt tggaggagtc 420
cgggggaggt ctcttcaagc caacggatac cctgacactc acctgcacag cctccggatt 480
caccgtcact agcaacgcaa taagctgggt ccgccaggct ccagggaacg ggctggaata 540
tatcggattc attggtgctg ctggtaatgc aaactacgcg agctgggcga aaagccgctc 600
caccatcacc agaaacacca acctgaacac ggtgactctg aaaatgacca gtctgacagc 660
cgcggacacg gccacctatt tctgtgcgag agagggtggt tggggtacat tgtttggtgc 720
ttttgattcc tggggcccag gcaccctggt caccgtctcc tcagggcaac ctaaggctcc 780
atcagtcact agtggcccgg gaggcca 807
<210> SEQ ID NO 93
<211> LENGTH: 797
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 93
ggcccagccg gccatggctg agctcgtgat gacccagact ccaccctccc tgtctgcatc 60
tgtgggagaa actgtcagga ttaggtgcct ggcgagtgag aacgtttaca gtgctgtagc 120
ctggtatcaa cagaagccag ggaaacctcc tacactcctg atctctggtg catccaattt 180
agaatctggg gtcccaccac ggttcagtgg cagtggatct gggacagatt acaccctcac 240
catcggcggc gtgcaggctg aagatgctgc cacttacttc tgtcaagggt atagcagtta 300
cctgactttt ggagctggca ccaatgtgga aatcaaggtg gttcctctag atcttcctcc 360
tctggtggcg gtggctcggg cggtggtggg cagtcggtgg aggagtccag gggaggtctc 420
ttcaagccaa cggataccct gacactcacc tgcacagtct ctggatttac catcgatacc 480
tatggagtga cctgggtccg ccaggctcca gggaacgggc tggaatatat cggattcatt 540
agtagtggtg gtgccgcata ctacgcgagc tgggcgaaaa gccgatccac catcaccaga 600
aacaccaatc tgaacacggt gactctgaaa atgaccagtc tgacagccgc ggacacggcc 660
acctatttct gtgcgagaga tcgtggctat gtttatggtt atggtgatgg tactgacatc 720
tggggcccag gcaccctggt caccgtctcc tcagggcaac ctaaggctcc atcagtcact 780
agtggcccgg gaggcca 797
<210> SEQ ID NO 94
<211> LENGTH: 794
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 94
cccagccggc catggctcag cctgtgctga ctcagtcgcc ctctgcgtct gctgccctga 60
gatcctcggc caagctcacc tgcaccctga gcagtgccca caagagttac gacattgact 120
ggtatcagca gcagtcaggg gaggcccctc ggtacctaat gcgtcttagg agtgatggaa 180
agtacaccaa ggggaccggg gtccctgatc gcttctcggg ctccagctct ggggctgacc 240
gctacttgat catccccagc gtccaggctg atgacggagc cgactattat tgtggtacag 300
attatagcgg tggatatgtg ttcggcggag ggacccagct gaccgtcaca ggtggtggtt 360
cctctagatc ttcctcctgg tggcggtggc tcgggcggtg gtgggcagtc gctggaggag 420
tccgggggag gcctgatcaa gccaacggat accctgacac tcacctgcac agtctctgga 480
ttctccctca gtatctacga cataagctgg gtccgccagg ctccagggaa cgggctggaa 540
tggatcggag ccattggtag tggtgatacc acatactacg cgagctgggc gaaaagccga 600
tccaccatca ccagaaacac ctacctgaac acggtgactc tgaaaatgac cagtctgaca 660
gccgcggaca cggccaccta tttctgtgcg agaggggggt tatcctggtt caacatctgg 720
ggcccaggca ccctggtcac cgtctcctca gggcaaccta aggctccgtc agtcactagt 780
ggcccgggag gcca 794
<210> SEQ ID NO 95
<211> LENGTH: 793
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 95
ccggccatgg ctgagctcgt gatgacccag actgaatccc ccgtgtctgc agctgtggga 60
ggcacagtca ccatcaattg ccaggccagt cagagcatta gcagttggtt ggcctggtat 120
caacagaagc cagggaaacc tcctacactc ctgatctctg gtgcatccaa tttagaatct 180
ggggtcccac cacggttcag tggcagtgga tctgggacag attacaccct caccattggc 240
ggcgtgcagg ctgaagatgc tgccacctac tattgtctag gcggttatag ttacagtagt 300
atcggtacga cttttggagc tggcaccaat gtggaaatca aggtggttcc tctagatctt 360
cctcctctgg tggcggtggc tcgggcggtg gtgggcagga gcagctggtg gagtccgagg 420
gaggtctctt caagccaacg gataccctga cactcacctg cacagtgtct ggattctccc 480
tcaataacta tggagtgacc tgggtccgcc aggctccagg gagggggctg gaatggatcg 540
gagccgtttg gagtggtgct accacagact atgcgagctg ggcgaaaagc cgatccacca 600
tcaccagaaa caccaacgag aacacggtga ctctgaaaat gtccagtctg acagccgcgg 660
acacggccac ctatttctgt gcgaattttc ctggttatac ttctggtacc gacatctggg 720
gccctggcac cctggtcacc gtctcctcag ggcaacctaa ggctccgtca gtcactagtg 780
gcccgggagg cca 793
<210> SEQ ID NO 96
<211> LENGTH: 799
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 96
ccggccatgg ctgagctcgt gatgacccag actccatcct ctgtgtctgc agctgtggga 60
ggcacagtca ccatcaattg tcaggccagt cagagtgtta acaacctctt agcctggtat 120
cagcagaaac cagggcagcc tcccaagctc ctgacttatg gtacatccaa tctggaatct 180
ggggtcccat cgcgtttccg tggcagtgga tctgggacag agttcactct caccatcagt 240
ggcatgaagg ctgaagatgc tgccacttat tactgtcaaa gtggttatta tagtgctggt 300
ttgacttttg gagctggcac caatgtggaa atcaaggtgg ttcctctaga tcttcctcct 360
ctggtggcgg tggctcgggc ggtggtgggc aggagcagct ggaggagtcc gggggaggcc 420
tggtccagcc tgggggatcc ctgaaactct cctgcaaagc ctctggattc gacttcatta 480
actatggagt aatctgggtc cgccaggctc ctgggaaggg gctggagtgg atcggataca 540
ttgatcctat ttttggtaac acaatctacg cgagctgggt gaatgaccga ttcaccatct 600
ccagccacaa cgcccagaac acgctgtatc tgcaactgaa cagtctgaca gccgcggaca 660
cggccaccta tttctgtgcg agatgcgggg atagacgtgg ctggggttat ggttttgatc 720
cctggggccc aggcaccctg gtcaccgtct cctcagggca acctaaggct ccgtcagtca 780
ctagtggccc gggaggcca 799
<210> SEQ ID NO 97
<211> LENGTH: 783
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (740)..(740)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (749)..(749)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (751)..(753)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<400> SEQUENCE: 97
ccggccatgg ctgagctcgt gctgacccag actccagcct ccgtgtctga acctgtggga 60
ggcacagtca ccatcaagtg ccaggccagt cagaacattt acagtggtat atcctggtac 120
caacagaagc cagagaaacc tcctacactc ctgatctctg gtgcatccaa tttagaacct 180
ggggtcccac cacggttcag tggcagtgga tctgggacag attacaccct caccattggc 240
ggcgtgcagg ctggagatgc tgccacctac tactgtctag gcgtttatag tttcggtagt 300
accgatttga cttttggagc tggcaccaat gtggaaatca aggtggttcc tctagatctt 360
cctcctctgg tggcggtggc tcgggcggtg gtgggcagtc gctggaggag tccgggggag 420
gcctcatcaa gccaacggat accctgacac tcacctgcac ggtctctgga ttctccctca 480
gtaccaatgg agtgagttgg gtccgccagg ctccagggag cgggctggaa tggatcggag 540
ccattgatct ttatggtgcc acatattacg cgacctgggc gaaaagccga tccaccatca 600
ccagaaacac caacctaaac acggtgactc tgaaaatgac cagtctgaca gccgcggaca 660
cggccaccta tttctgtgcg agagagggat atggttatcc aaacatctgg ggcccaggca 720
ccctggtcac cgtctcctcn ggcaacctna nnntccgtca gtcactagtg gcccgggagg 780
cca 783
<210> SEQ ID NO 98
<211> LENGTH: 806
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (725)..(725)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<400> SEQUENCE: 98
ggcccagccg gccatggctg agctcgatct gacccagact ccatcgtccg tgtctgcagc 60
tgtgggaggc acagtcagca tcagttgcca gtccagtcag agtgtttata ataactactt 120
agcctggtat cagcagaaac cagggcagcc tcccaagctc ctgatctatt atgcatccaa 180
actggcatct ggggtcccat cgcggttcaa aggcagtgga tctgggacac agttcactct 240
caccatcagc gacgtgcagt gtgacgatgc tgccacttac tactgtcaag gcacttttga 300
taatggtttg tacaaggctt tcggcggagg gaccgagctg gagatcctgg tggttcctct 360
agatcttcct cctctggtgg cggtggctcg ggcggtggtg ggcagtcgtt ggaggagtcc 420
gggggaggtc tcttcaagcc aacggatacc ctgacactca cctgcacagt ctctggattc 480
tccctcagta gctatgcaat aagctgggtc cgccaggctc cagggaacgg gctggaatgg 540
atcggataca ttaattacga tggtatcgca tactacgcga gctgggcgaa aagccgatcc 600
accatcacca gaaacaccaa cctgaacacg gtgactctga aaatgaccgg tctgacagcc 660
gcggacacgg ccacctattt ctgtgcgaga gatgactata ctactcctta tggttatcga 720
ttggntctct ggggccaggg caccctggtc accgtctcct cagggcaacc taaggctccg 780
tcagtcacta gtggcccggg aggcca 806
<210> SEQ ID NO 99
<211> LENGTH: 797
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 99
ggcccagccg gccatggctg agctcgatat gacccagact ccatcctctg tgtctgcagc 60
tgtgggaggc acagtcacca tcaattgcca ggccagtgaa agcattagca acctcttagc 120
ctggtatcag cagaaaccag ggcagcctcc caagctcctg atctattctg catccactct 180
ggcatctggg gtcccatcgc gtttccgtgg cagtggatct gggacagagt tcactctcac 240
catcagtggc atgaaggctg aagatgctgc cacttattac tgtcaaagtg gttattatag 300
tactggtgcg acttttggag ctggcaccaa tgtggaaatc aaggtggttc ctctagatct 360
tcctcctctg gtggcggtgg ctcgggcggt ggtgggcagt cgctggagga gtccggagga 420
ggcctggtcc agccgggggg atccctgaaa ctctcctgca aaggctctgg gttcgacctc 480
gatagcaatg caatgtgctg ggtccgccag gctccaggga gcgggctgga atggatcgga 540
accattacta gtggtggtag cgcatactac gcgagctggg cgaaaagccg atccaccatc 600
accagaaaca ccaacctaaa cacggtgact ctgaaaatga ccagtctgac agccgcggac 660
acggccacct atttctgtgc gagaggacct acttggggaa ttggagatac ttttcatccc 720
tggggcccag gcaccctggt caccgtctcc tcggggcaac ctaaggctcc gtcagtcact 780
agtggcccgg gaggcca 797
<210> SEQ ID NO 100
<211> LENGTH: 789
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 100
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgtgt ctgccgccct 60
gggagcctct gccaagctca cctgcaccct gagcagtgcc cacaagacct acaccattga 120
ctggtatcaa cagcagtcag gggaggcccc tcgatacctg atgcagctta agagtgatgg 180
aaactacacc aaggggaccg gggtccctga tcgcttctcg ggctccagct ctggggctga 240
ccgctacttg atcatcccca gcgtccaggc tgatgacgaa gccgactact attgtggtgc 300
agattatagc ggtgggtatg tgtttggcgg agggacccag ctgaccgtca caggtggtgg 360
ttcctctaga tcttcctcct ctggtggcgg tggctcgggc ggtggtgggc aggagcagct 420
ggaggagtcc gggggtcgcc tggtcaagcc tgacgaaacc ctgacactca cctgcacagt 480
ctctggactc tccctgaata attttggagt gagctgggtc cgccaggccc caggaaacgg 540
gctggaatgg atcagagcca ttgattttgg tagtggtagc gcatactacg cgaactgggc 600
gaaaagtcgg tccaccatca ccagcaacac tcgcctgaac acggtgactc tgaaaatgat 660
tagtctgaca gccgcggaca cggccaccta tttttgttcg agaggagaca tctggggccc 720
aggcaccctg gtcaccgtct tctcagggca acctaaggct ccgtcagtca ctagtggccc 780
gggaggcca 789
<210> SEQ ID NO 101
<400> SEQUENCE: 101
000
<210> SEQ ID NO 102
<211> LENGTH: 811
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 102
gcccagccgg ccatggctga gctcgatatg acccagactc catcctccgt gtctgcagct 60
gtgggaggca cagtcaccat cagttgccag gccagtcaga gtgtttataa taacaacaat 120
ttatcctggt atcagcaaaa accagggcag cctcccaagc tcttgatcta cgatgcatcc 180
aaattggcat ctggggtccc atcgcggttc aaaggcagtg gatctgggac acagttcact 240
ctcaccatta gcgacctgga gtgtgacaat gctgccactt acttctgtca acagggttat 300
gatggtagtg atgttgataa tgttttcggc ggagggaccg aggtggtggt caaggtggtt 360
cctctagatc ttcctcctct ggtggcggtg gctcgggcgg tggtgggcag tcggtgaagg 420
agtccgaggg aggtctcttc aagccaacgg ataccctgac actcacctgc acagtctctg 480
gattctccct cagtaactat gcaataaact gggtccgcca ggctccaggg gaggggctgg 540
agtggatcgg ctatattgat cctacttttg gtagcacgta ctacgcgagc tgggtgaatg 600
accgattcac catctccagc cacaacgccc agaacacgct gtatctgcaa ctgaacagtc 660
tgacacctgc ggacacggcc acctatttct gtgcgagaga tgatattagt attagtggtt 720
attcatttga catctggggc ccaggcaccc tggtcaccgt ctcctcaggg caacctaagg 780
ctccatcagt cactagtggc ccgggaggcc a 811
<210> SEQ ID NO 103
<211> LENGTH: 797
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 103
ggcccagccg gccatggctg agctcgtgct gacccagact ccaccctccc tatctgcatc 60
tgtgggagaa actgtcagga ttaggtgcct ggccagtgag ttccttttta atgctgtatc 120
ctggtatcaa cagaagccag agaaacctcc tacactcccg atctatggtg catccaattt 180
agaatctggg gtcccaccac ggttcagtgg cagtggatct gggacacagt tcactctcac 240
catcagcgac ctggagtgtg acgatgctgc cacttactac tgtgcaggcg attatagtga 300
ttggatttat gcttttggcg gggggaccga ggtggtggtc aaggtggttc ctctagatct 360
tcctcctctg gtggcggtgg ctcgggcggt ggtgggcagt cgttggagga gtccggggga 420
ggtctcttca agcctggagg atccctgaca ctcacctgca cagtctctgg attcaccatc 480
actagctacc acatgtgctg ggtccgccag gctccaggga acgggctggg atggatcgga 540
gccgttagtg ctagcggaca cacatattac gcgaactggg cgaaaagccg atccaccatc 600
accagagaca ccaacttaaa caccatgact ctgaaaatga ccagtctgac agccgcggac 660
acggccacct atttctgtgc gacaccatat cctggttatg atattgatcc ctttgacatc 720
tggggcccag gcaccctggt caccgtctcc tcagggcaac ctaaggctcc gtcagtcact 780
agtggcccgg gaggcca 797
<210> SEQ ID NO 104
<211> LENGTH: 800
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 104
ggcccagccg gccatggctg agctcgtgct gacccagact ccatcctccg tgcctgcagc 60
tgtgggaggc acagtcacca tcgattgcca gtccagtgag agtgtttata ataacaacaa 120
cttagcctgg tatcagcaga aaccagggca gcctcccaag ctcctgatct acggggcatc 180
cactctggca tctggggtct catcgcggtt caaaggcagt ggatctggga cagagttcac 240
tctcaccatc agcgacctgg agtgtgccga tgctgccact tactactgtc aacagggtta 300
tagtattggt aatgtagata atgctttcgg cggagggacc gagctggaga tcctggtggt 360
tcctctagat cttcctcctc tggtggcggt ggctcgggcg gtggtgggca gtcgctggag 420
gagtccgggg gaggtctctt caagccaacg gataccctga cactcacctg cacggtctct 480
ggattctccc tcagtagcta tggaattact tgggtccgcc aggctccagg gaacgggctg 540
gaatggatcg gcgccattgg tagtgatgct aaaacatact acgcgagctg ggcgaaaggc 600
cgatccacca tcaccggaga caccaacctg aacacggtga ctctgagaat gaccagtctg 660
acagccgcgg acacggccac ctatttctgt gcgagatatt ttgattggtt taatgtggac 720
atctggggcc caggcaccct ggtcaccgtc tcctcagggc aacctaaggc tccatcagtc 780
actagtggcc cgggaggcca 800
<210> SEQ ID NO 105
<211> LENGTH: 797
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 105
ggcccagccg gccatggctg agctcgtgat gacccagact ccagcctctg tggaggtagc 60
tgtgggaggc actgtcacca tcaagtgcca ggccagtcag agcattagta gctacttagc 120
ctggtatcaa cagaaaccag ggcagcctcc caagctcctg atctacaagg cttccactct 180
ggcatctggg gtcccgtcgc ggttcaaagg cagtggatct gggacacagt tcactctcac 240
catcagcgat gtggtgtgtg acgatgctgc cacttactac tgtgcaggat ataaaggtgg 300
tagtagtgat ggtagtgctt tcggcggagg gaccgagctg gagatcctgg tggttcctct 360
agatcttcct cctctggtgg cggtggctcg ggcggtggtg ggcagtcggt gaaggagtcc 420
gagggaggtc tcttcaagcc aacggatacc ctgacactca cctgcacagt ctctggattc 480
tccctcagta gctatggagt gagctgggtc cgccaggctc cagggaacgg gctggaatgg 540
atcggagcca ttagtagtgg tggtgacgca tactacgcga gctgggcgac cagccgatcc 600
accatcacca gaaacaccaa cctgaacacg gtgactctga aaatgaccag tctgacagcc 660
gcggacacgg ccacctattt ctgtgcgaga cattttggtt atggtactgc tgggggcatc 720
tggggcccag gcaccctcgt caccgtctct tcagggcaac ctaaggctcc gtcagtcact 780
agtggcccgg gaggcca 797
<210> SEQ ID NO 106
<211> LENGTH: 807
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 106
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgcat ctgctgccct 60
gggatcctcg gccaagctca cctgcactct gagcagtgct cacaagacct actatattga 120
atggtatcag cagcagcaag gggaggcccc tcggtacctg atgcaggtta agagtgatgg 180
aagctacacc aaggggaccg gggtccctga tcgcttctcg ggctccagct ctggggctga 240
ccgctacttg atcatcccca gcgtccaggc tgatgacgaa gccgactact attgtggtgc 300
agattatagc ggtgggtatg tgctcggcgg agggacccag ctgaccgtca caggtggtgg 360
ttcctctaga tcttcctcct ctggtggctc gggcggtggt gggcagtcgg tggaggagtc 420
cgggggaggt ctcttcaagc cagcggatac cctgacactc acctgcacag tctctggatt 480
ttccctcagt taccctggag tgagctgggt ccgccaggct ccagggaacg ggctggaata 540
catcggattc attaatgctg atggtgactc atactacccg acctgggcga aacgccgatc 600
caccatcacc agaaacacca acctgaacac ggtgactctg aaaatgacca gtctcacagc 660
cgcggacacg gccacctatt tctgtgcgag agagggtggc tggggtacat tgtttggtgc 720
ttttgattcc tggggcccag gcaccctagt caccgtcttc tcagggcaac ctaaggctcc 780
gtcagtcact agtggcccgg gaggcca 807
<210> SEQ ID NO 107
<211> LENGTH: 810
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 107
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgcat ctgctgccct 60
gggatcctcg gccaagctca cctgcactct gagcagtgct cacaagacct actatattga 120
ctggtatcag cagcagcaag gggaggcccc tcggtacctg atgcagcttg ggagtgatgg 180
aagttacacc aaggggaccg gggtccctga tcgcttctcg ggctccagct ctggggctga 240
ccgctacttg atcatcccca gcgtccaggc tgatgacgaa gccgactact attgtggttc 300
agattatagc ggtgggtatg tgttcggcgg agggacccag ctgaccgtca caggtggtgg 360
ttcctctaga tcttcctcct ctggtggcgg tggctcgggc ggtggtgggc agtcgctgga 420
ggagtccggg ggaggtctct tcaagccagc ggataccctg acactcgcct gcacagtctc 480
tggattctcc ctcagtactt atggagtgat ctgggtccgc caggctccag ggaaggggct 540
ggaatacatc gcatacatta attatagtgg tagtccatac tacgcgagct gggcgaaaag 600
ccgatccacc atcaccagaa acaccaacga gaaaacggtg actctgaaaa tgaccagtct 660
gacagccgcg gacacggcca cctatttctg tgcgaggggt gttcctggtt acaatgcgga 720
tatgggggac atctggggcc caggcaccct ggtcaccgtc ttctcagggc aacctaaggc 780
tccatcagtc actagtggcc cgggaggcca 810
<210> SEQ ID NO 108
<211> LENGTH: 818
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<220> FEATURE:
<221> NAME/KEY: modified_base
<222> LOCATION: (766)..(766)
<223> OTHER INFORMATION: a, c, t, g, unknown or other
<400> SEQUENCE: 108
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgtgt ctgccgccct 60
gggagcctct gccaagctca cctgcaccct gagcagtgcc cacaagacct acaccattga 120
ttggtatcag cagcagcaag gggaggcccc tcggtacctg atgcagctta agagtgatgg 180
aagctacacc aaggggaccg gggtccctga tcgcttctcg ggctccagct ctggggctga 240
ccgctacttg atcatcccca gcgtccaggc tgatgacgaa gccgactact attgtggtgc 300
agattatagc ggtgggtatg tgttcggcgg agggacccag ctgaccgtca caggtggtgg 360
ttcctctaga tcttcctcct ctggtggcgg tggctcgggc ggtggtgggc agtcggtgga 420
ggagtccagg gggaggtctc ttcaagccaa cggataccct gacactcacc tgcacagtct 480
ctggattctc cctcagtggc tatggagtga gctgggtccg ccaggctcca gggaacgggc 540
tggaatggat cggagccatt agtagtggtg gtagcgcata ctacgcgaga tgggcgaaaa 600
gccgctccac catcaccaga aacaccaacc tgaacacggt gactctgaaa atgaccagtc 660
tgacagccgc ggacacggcc acctatttct gtgcgagagg ttactatact gctattggtg 720
gtacttatga caatgctttt gatccctggg gcccaggcac cctggncacc gtctcctcag 780
ggcaacctaa ggccagtcac tagtggcccg ggaggcca 818
<210> SEQ ID NO 109
<211> LENGTH: 810
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 109
ggcccagccg gccatggctg agctcgatat gacccagact ccaccctccc tgtctgcatc 60
tgtgggagaa actgtcagga ttaggtgcct ggccagtgag gacattggca gtgctatatc 120
ctggtaccaa cagaagccag ggaaacctcc tacactcctg atctatggtg tatttaattt 180
agaatctggg gtcccaccac gattcagtgg cagtggatct gggacagatt acaccctcac 240
cattggcggc gtgcaggctg aagatgctgc cacctactac tgtctaggcg gtgctagtga 300
cagtagtacc ggtttgactt ttggagctgg caccaatgtg gaaatcaagg tggttcctct 360
agatcttcct cctctggtgg cggtggctcg ggcggtggtg ggcagtcggt gaaggagtcc 420
gagggaggtc tcttcaagcc aacggatacc ctgacactca cctgcacagt ctctggattc 480
tccctcagta actatggagt gagctgggtc cgccaggctc cagggaacgg gctggaatac 540
atcggcttca ttagtaacgg tggtgccaca ttctacgcga cctgggcgag aagccgagcc 600
accatcacca gaaacaccgg cctgaacacg gtggctctga caatgaccag tctgacagcc 660
gcggacacgg ccacctattt ctgtgtgagg gattctgttg ctacttatgc tactgatgtt 720
gctgcttttg atccctgggg cccaggcacc ctggtcaccg tctcctcagg gcaacctaac 780
tccgtcagtc actagtggcc cgggaggcca 810
<210> SEQ ID NO 110
<211> LENGTH: 839
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 110
gcccagccgg ccatggctca gcctgtgctg actcagtcgc cctccctgtc tgcgtctctg 60
ggcacaacgg ccagactcac ctgcaccctg agcactggct acagtgttgg cgagtaccct 120
ttagtgtggc tccagcaggt gccagggagg cctcccaggt atctcctgag cttcacctca 180
gatgaagaca aacaccatga ctcttggggc cccacccgct tttctggatc caaagacacc 240
tcagagaata cctttatcct gagcatctct gggctgcagc ccgaggacga ggccgactat 300
tactgtgcta cagctcatgg tagtgataac agcctccatt atgtcttcgg cggaaggacc 360
cagctgaccg tcacaggtgg tggttcctct agatcttcct cctctggtgg cggtggctcg 420
ggcggtggtg ggcagtcggt gaaggagtcc gagggaggtc tcttcaagcc aacggatacc 480
cagacactca cctgcacagt ctctggattc tccctcagta gcaatgcaat aagctgggtc 540
cgccaggctc cagggaacgg gctgaaaagc atcggattca ttaatagtgg tggtggcgca 600
tattacgcga cctgggcgaa aagccgatcc accatcacca gaaacaccaa cgagaacacg 660
gtgactctga aaatgaccag tctgacagcc gcggatacgg ccacctattt ctgtgcgaga 720
acaccccatt attatgatac ttatgatacc tcatttaaca tatggggccc aggcaccctg 780
gtcaccgtct tctcagggca acctaaggct ccgtcagtca ctagtggccc gggaggcca 839
<210> SEQ ID NO 111
<211> LENGTH: 801
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 111
ggcccagccg gccatggctc agcctgtgct gactcagtcg ccctctgcat ctgctgccct 60
gggatcctcg gccaagctca cctgcactct gagcagtgct cacaagacct actatattga 120
atggtatcag cagcagcaag gggaggcccc tcggtacctg atacaactta agagtgatgg 180
aagctacacc aaggggaccg gggtccctga tcgcttctcg ggctccagct ctgggactga 240
ccgctacttg atcatctcca gcgtccaggc tgaggacgaa gccgactact cttgtggtgc 300
agattatagt ggtgggtttg tgttcggcgg agggacccag ctgaccgtca caggtggtgg 360
ttcctctaga tcttcctcct ctggtggcgg tggctcgggc ggtggtgggc agtcgctgga 420
ggagtccggg ggaggtctct tcaagccaac ggataccctg acactcacct gcacagtctc 480
tggattcgcc ctcaataact acaacataca ctgggtccgc caggctccag ggaacgggct 540
ggaatggatc ggagccattg gtagtagtgg tagcgcatac tacgcgagct gggcgaaaag 600
ccgatccacc atcaccagaa acaccaacct gaacacggtg actctgaaaa tgaccagtct 660
gacagccgcg gacacggcca cctatttctg tgcgagaggt tataattctg atgattctta 720
tctctggggc ccaggcaccc tggtcaccgt ctcctcaggg caacctaagg ctccatcagt 780
cactagtggc ccgggaggcc a 801
<210> SEQ ID NO 112
<211> LENGTH: 791
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 112
ccggccatgg ctgagctcgt gctgacccag actccaccct ccctgtctgc atctgtggga 60
ggcacagtca ccataaactg tctggcgagt gagaacgtct acagtgctgt agcctggtat 120
caacagaagc cagggaaacc tcctacactc ctgatctctg gtacatccaa tttagaggct 180
ggggtcccac cacggttcag tggcagtgga tctgggacag attacaccct caccatcggc 240
ggcgtgcagg ctgaagatgc tgccacttac ttctgtcaag ggtatagcag ttaccctttg 300
acttttggag ctggcaccaa tgtggaaatc aaggtggttc ctctagatct tcctcctcgg 360
tggcggtggc tcgggcggtg gtgggcagtc ggtggaggag tccagggggg aggcctggtc 420
aagcctgggg ataccctcac actcacctgc acagtctctg gattccccct cagcagctac 480
gacatgaact gggtccgcca ggctccaggg gaggggctgg aatggatcgg atggattact 540
tatgatggtt acaatcacta cgcgagctgg gcgaatggcc gatccaccat caccagaaac 600
accaacgaga acgcggtgac tctgaaaatg accagtctga cagccgcgga cacggccacc 660
tatttctgtg cgcgagatta ctataatggt gcttatgttt atgcctttaa catctggggc 720
ccaggcaccc tggtcaccgt ctcctcaggg caacctaagg ctccatcagt cactagtggc 780
ccgggaggcc a 791
<210> SEQ ID NO 113
<211> LENGTH: 75
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 113
ggtggttcct ctagatcttc ctcctctggt ggcggtggct cgggcggtgg tgggcagtcg 60
gtggaggagt ccrgg 75
<210> SEQ ID NO 114
<211> LENGTH: 75
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 114
ggtggttcct ctagatcttc ctcctctggt ggcggtggct cgggcggtgg tgggcagtcg 60
gtgaaggagt ccgag 75
<210> SEQ ID NO 115
<211> LENGTH: 75
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 115
ggtggttcct ctagatcttc ctcctctggt ggcggtggct cgggcggtgg tgggcagtcg 60
ytggaggagt ccggg 75
<210> SEQ ID NO 116
<211> LENGTH: 75
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 116
ggtggttcct ctagatcttc ctcctctggt ggcggtggct cgggcggtgg tgggcagsag 60
cagctggwgg agtcc 75
<210> SEQ ID NO 117
<211> LENGTH: 48
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 117
tggtgttggc ctcccgggcc actagtgact gayggagcct taggttgc 48
<210> SEQ ID NO 118
<211> LENGTH: 24
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 118
tggtgttggc ctcccgggcc acta 24
<210> SEQ ID NO 119
<211> LENGTH: 44
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 119
gggcccagcc ggccatggct gagctcgtgm tgacccagac tcca 44
<210> SEQ ID NO 120
<211> LENGTH: 44
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 120
gggcccagcc ggccatggct gagctcgatm tgacccagac tcca 44
<210> SEQ ID NO 121
<211> LENGTH: 44
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 121
gggcccagcc ggccatggct gagctcgtga tgacccagac tgaa 44
<210> SEQ ID NO 122
<211> LENGTH: 46
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 122
gggcccagcc ggccatggct gagctcgtgc tgactcagtc gccctc 46
<210> SEQ ID NO 123
<211> LENGTH: 41
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 123
gggcccagcc ggccatggct cagcctgtgc tgactcagtc g 41
<210> SEQ ID NO 124
<211> LENGTH: 28
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 124
tactcagggc ccagccggcc atggctga 28
<210> SEQ ID NO 125
<211> LENGTH: 41
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 125
ggaagatcta gaggaaccac caggatctcc agctcggtcc c 41
<210> SEQ ID NO 126
<211> LENGTH: 41
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 126
ggaagatcta gaggaaccac cttgatttcc acattggtgc c 41
<210> SEQ ID NO 127
<211> LENGTH: 41
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 127
ggaagatcta gaggaaccac cttgacsacc acctcggtcc c 41
<210> SEQ ID NO 128
<211> LENGTH: 44
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 128
ggaagatcta gaggaaccac cacctgtgac ggtcagctgg gtcc 44
<210> SEQ ID NO 129
<211> LENGTH: 43
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 129
taagcagaat tcggcccagc cggccgcggt gggaacacta gga 43
<210> SEQ ID NO 130
<211> LENGTH: 40
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 130
agcagaattc tggcccagcc ggccgcggtg ggaacactag 40
<210> SEQ ID NO 131
<211> LENGTH: 40
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 131
agcagaattc taggcccagc cggccgcggt gggaacacta 40
<210> SEQ ID NO 132
<211> LENGTH: 47
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 132
ctctagatct ggcctcccgg gcctttttat ataccacagc cagtttg 47
<210> SEQ ID NO 133
<211> LENGTH: 40
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 133
ctctagatct aggcctcccg ggccttttta tataccacag 40
<210> SEQ ID NO 134
<211> LENGTH: 40
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 134
ctctagatct atggcctccc gggccttttt atataccaca 40
<210> SEQ ID NO 135
<211> LENGTH: 20
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 135
aacataaaga aaggcccggc 20
<210> SEQ ID NO 136
<211> LENGTH: 21
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
primer
<400> SEQUENCE: 136
gccttatgca gttgctctcc a 21
<210> SEQ ID NO 137
<211> LENGTH: 2793
<212> TYPE: DNA
<213> ORGANISM: Artificial Sequence
<220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic
polynucleotide
<400> SEQUENCE: 137
atggggcacc atgctccttg ggatgttgat gatctgtagt gctgcagata aattgtgggt 60
cacagtctac tatggggtac ctgtgtggaa agaagcaacc accactctat tttgtgcatc 120
agatgctaaa gcatatgata cagaggtaca taatgtttgg gccacgcatg cctgtgtacc 180
cacagacccc aacccacaag aagtagtatt ggaaaatgtg acagaaaatt ttaacatgtg 240
gaaaaatgac atggtagaac aaatgcatga ggatataatc agtttatggg atcaaagcct 300
aaagccatgt gtaaaattaa ccccactctg tgtcacttta aattgcaatg atgtcaataa 360
taatagtact atcaacaatg gaactactaa tgccactagt catagtgggg gaaaaataga 420
gagaggagaa ataaaaaatt gctctttcaa tgtcaccaca aacataaaaa ataagctgca 480
gaaagaatat gcactgtttt ataagcttga tctagtacca acagatgata ataattctag 540
atataggttg atacattgta ataccttagt cattacacaa gcctgtccaa aggtatcctt 600
tgagccaatt cccatacatt attgtgcccc ggctggtttt gcgattctaa agtgcaaaga 660
taggaatttc acaggaaaag gacaatgtaa aaatgtcagc acagtacaat gtacacatgg 720
cattaggcca gtagtgtcaa ctcaactgct gttaaatggc agtctagcag aagatggggt 780
agtaattaga tctgccaata tcacagacaa tactaaaacc ataatagtac agttgaagga 840
agctgtagaa attaattgta caagacccaa taacaataca aggaaaagta taactatagg 900
accagggaga gcattttgga caacaggagg aataatagga gatataagac aagcacattg 960
taaccttagt agcacaaaat ggaataacac tttaagacag atagctacaa aattaagaga 1020
acaatttggt aacaaaacaa tagtttttaa tcaatcctca ggaggggacc aagaaattgt 1080
gatgcacact tttaattgtg gaggggaatt tttctactgt agtacaacac aactgtttaa 1140
tagtacttgg attgcaaata agactgggaa tgatactgga ggatcaaatg gaactattac 1200
acttccatgc agaataaaac aaattgtaaa catgtggcag gaagtaggaa aagcaatgta 1260
tgcccctccc atcaaaggac aaattagatg ttcatcaaac attacaggac tgctattatt 1320
aagagatggt ggtaagaata acgggacagg aaacatgaca gaaatcttca gacctggagg 1380
aggagatatg agggacaatt ggagaagtga attatataaa tataaagtag taaaaattga 1440
accattagga gtagcaccca ccaaggcaaa gagaagagtg gtgcagagag aaaaaagagc 1500
ggtgggaaca ctaggagcct tgttccttgg gttcttggga acagcaggaa gcactatggg 1560
cgcagcatca ctaacgctga cggtacaggc cagactatta ttgcctggta tagtgcaaca 1620
gcaaaacaat ttgctgagag ctattgaggc gcaacagcat ttgttgcaac tcacagtctg 1680
gggcatcaag cagctccagg caagagtcct ggctatggaa agatacctac aggatcaaca 1740
gctcctaggg atttggggtt gcgctggaaa actcatttgc accacagctg tgccttggaa 1800
tactagttgg agtaataaat ctctggatca gatttggaat aacatgacct ggatgcaatg 1860
ggaaagagaa attgacaatt acacacacac aatatacagc ttaattgaag aatcgcagaa 1920
ccaacaagaa aaaaatgaac aagaattatt ggaactagac aagtgggcaa gtttgtggaa 1980
ttggtttgac ataacaaact ggctgtggta tataaaaata ttcataatgg tagtaggagg 2040
cttagtaggt ttaagaatag tttttgctgt actttctata gtgaatagag ttaggcaggg 2100
atactcacca ttatcgttgc agacccgatt cccagtccag aggggacccg acaggcccga 2160
aggaatcgaa gaagaaggtg gagagagaga cagagacaga tccggtcgat tagtgaccgg 2220
attcttacct cttatctggg acgacctgcg gagcctgtgc ctcttcagct accgccgctt 2280
gagagactta ctcttgattg cagcgaggat tgtggaactt ctgggacgca gggggtggga 2340
actcctcaaa tattggtgga atctcctaaa atattggagt caggaactaa agaatagtgc 2400
tgtcagcttg tacaacgcca cagctatagc agtagctgag ggaacagata gggttataga 2460
aatagtaaga agaaccttta gagctattat ccacatacct agaagaataa gacagggctt 2520
ggaaagggct ttgctataag atgggtggca agtggtcaaa aagtagtgtg gttggatggc 2580
ctgagataag agaaagaatg agacgaaccg agccacgaac cgagccagca gcagaggggg 2640
tgggagcagc atctcgagac ctagaaaaac atggagcaat cacaagtagc aatacagcag 2700
ctactaatgc tgcttgtgcc tggctagaag cacaagaaga agaggaagtg ggttttccag 2760
tcagacctca ggtaccttta agaccaatga cct 2793
User Contributions:
Comment about this patent or add new information about this topic: