Patent application title: Yeast Display Systems
Inventors:
Andreas Loew (Cambridge, MA, US)
Assignees:
NOVARTIS AG
IPC8 Class: AC40B3004FI
USPC Class:
506 9
Class name: Combinatorial chemistry technology: method, library, apparatus method of screening a library by measuring the ability to specifically bind a target molecule (e.g., antibody-antigen binding, receptor-ligand binding, etc.)
Publication date: 2011-11-10
Patent application number: 20110275535
Abstract:
The present invention relates to the field of protein display libraries
and library screening. In preferred embodiments, the present invention
provides a three component system for display comprising a cell surface
molecule, an adapter molecule and a display molecule.Claims:
1. A library of host cells, wherein each host cell comprising: (a) a cell
surface molecule attached to the surface of the cell, (b) an adapter
molecule comprising a first binding site and a second binding site, and
(c) a display molecule comprising a modified polypeptide; wherein the
first binding site binds specifically to the cell surface molecule and
cannot bind to the display molecule and the second binding site binds
specifically to the display molecule and cannot bind to the cell surface
molecule, and wherein the adapter molecule is not a component of the
modified polypeptide.
2. The host cells of claim 1, further comprising a plurality of display molecules.
3. The host cells of claim 1, wherein the host cell surface molecule is covalently linked to the first binding site.
4. The host cells of claim 1, wherein the host cell surface molecule is covalently linked to the first binding site through a disulfide bond.
5. The host cells of claim 1, wherein the host cell surface molecule comprises a first agglutinin that is Aga1p, and wherein the first binding site comprises a second agglutinin that is Aga2p.
6. (canceled)
7. The host cells of claim 1, wherein the host cell surface molecule is attached to the cell membrane via a GPI anchor.
8. (canceled)
9. (canceled)
10. The host cells of claim 1, wherein the second binding site is covalently linked to the display molecule.
11. The host cells of claim 1, wherein the second binding site is covalently linked to the display molecule through disulfide bonds.
12. The host cells of claim 1, wherein the second binding site comprises a PDZ domain of InaD.
13. (canceled)
14. The host cells of claim 12, wherein the display molecule comprises a C-terminal NorpA ligand.
15. The host cells of claim 1, wherein the display molecule comprises a PDZ domain of InaD.
16. (canceled)
17. The host cells of claim 15, wherein the second binding site comprises a C-terminal NorpA ligand.
18. The host cells of claim 1, wherein the modified polypeptide is selected from the group consisting of: a scaffold protein, a signal transduction protein, an antibody, an immunoglobulin, an immunoadhesin, a receptor, a ligand, an oncoprotein, a transcription factor, an enzyme, and a fibronectin polypeptide.
19. The host cells of claim 18, wherein the display molecule is a fibronectin polypeptide.
20. The host cells of claim 19, wherein the fibronectin polypeptide comprises an F10 polypeptide.
21. The host cells of claim 1, wherein the display molecule comprises a secretion signal peptide.
22. The host cells of claim 21, wherein the secretion signal peptide comprises an MFalpha/HSA hybrid leader peptide, or an MFalpha leader peptide.
23. (canceled)
24. The host cells of claim 1, wherein expression of the display molecule is under the control of a first inducible promoter selected from the group consisting of an AOX1 promoter, a CUP 1 promoter, and a Gal 1 promoter.
25. (canceled)
26. (canceled)
27. The host cells of claim 1, wherein the expression of the adapter molecule is under the control of a second inducible promoter selected from the group consisting of an AOX1 promoter, a CUP 1 promoter, and a Gal 1 promoter.
28. (canceled)
29. (canceled)
30. The host cells of claim 1, wherein the host cell is a yeast cell.
31. (canceled)
32. (canceled)
33. A method for displaying a modified polypeptide comprising: (a) providing a host cell comprising a cell surface molecule attached to the surface of the cell and a first nucleic acid encoding a display polypeptide comprising a modified polypeptide, (b) contacting the host cell with an adapter molecule comprising a first binding site and a second binding site under conditions wherein the first binding site binds to the cell surface molecule, and (c) incubating the host cell under conditions wherein the host cell exports the display polypeptide outside the host cell under conditions wherein the second binding site binds to the display polypeptide, wherein the first binding site binds specifically to the cell surface molecule and cannot bind to the display molecule and the second binding site binds specifically to the display polypeptide and cannot bind to the cell surface molecule, and wherein the adapter molecule is not a component of the modified polypeptide.
34. The method of claim 33, wherein the host cell displays at least 10.sup.2, at least 10.sup.3, at least 10.sup.4, or at least 10.sup.5 modified polypeptides.
35. (canceled)
36. (canceled)
37. (canceled)
38. (canceled)
39. (canceled)
40. (canceled)
41. (canceled)
42. (canceled)
43. (canceled)
44. (canceled)
45. (canceled)
46. (canceled)
47. (canceled)
48. (canceled)
49. (canceled)
50. (canceled)
51. (canceled)
52. (canceled)
53. (canceled)
54. (cancelled)
55. (canceled)
56. (canceled)
57. (canceled)
58. (cancelled)
59. (canceled)
60. (canceled)
61. (canceled)
62. (canceled)
63. (canceled)
64. A method for generating a host cell display library comprising: introducing into a plurality of host cells a display library of first nucleic acids each encoding a display polypeptide comprising a modified polypeptide, wherein at least two of the introduced first nucleic acids encode different modified polypeptides, wherein each host cell comprises a second nucleic acid which encodes a cell surface polypeptide and a third nucleic acid which encodes an adapter molecule comprising a first binding site and a second binding site, wherein the first binding site binds to the cell surface molecule but not the display polypeptide and the second binding site binds to the display polypeptide but not the cell surface molecule, and wherein the adapter molecule is not a component of the modified polypeptide.
Description:
FIELD
[0001] The present invention relates to the field of protein display libraries and library screening. More specifically, the present invention relates to the production of proteins for display on cell surfaces.
BACKGROUND
[0002] Protein binding domains can be predicted from sequence data, however re-designing proteins with improved or altered binding affinities often requires testing of a number of variants of the re-designed protein. Currently the best method for obtaining proteins with desired binding affinities is to generate and screen a protein library including such variants that can include rationally redesigned proteins, randomly altered proteins, or a combination thereof. Libraries of many types of protein, such as immunoglobulins and scaffold proteins and receptors or receptor ligands have successfully been constructed and screened for binding affinity.
[0003] There are many methods to screen libraries, but one of the most common methods is the phage display method, which comprises fusion of a protein library to the coat proteins of filamentous phage e.g.,(Huse et al., '89; Clackson et al,, '91); Marks et al., '92). Fusions are made most commonly to a minor coat protein, called the gene III protein (pIII), which is present in three to the copies at the tip of the phage. The fused library is then displayed on the surface of the viral particle. The pap display library can then be screened against an immobilized target protein. However, one major drawback of this method is that target proteins that bind the library with very high affinity are not always identified because the conditions required to elute the bound phase usually denature the phage particle such that it becomes impossible to identify the protein of interest. Another draw back of phage display libraries is the requirement that the target protein be immobilized on a solid surface, which can lead to difficulties in determining the actual affinity of a target protein for the phage display protein. Furthermore, some proteins of interest require post-translational modifications, such as glycosylation, methylation, or disulfide binding, that cannot be achieved when expressed in a phage particle.
[0004] An alternative method for screening protein libraries is to display the library on the surface of bacterial cells. This method solves many of the drawbacks associated with phage display but has its own problems. One problem with bacterial display is that the bacterial capsule can cause steric hindrance to proteins displayed on the bacterial surface. Also, bacteria do not contain the machinery to properly fold eukaryotic proteins, so the protein of interest may not always be expressed within the bacterium. Similar to the problem in phage, bacteria cannot provide post-translational modifications, like disulfide binding, to a eukaryotic protein.
[0005] Wittrup et al. (U.S. Pat. Nos. 6,699,558 and 5,696,251) have developed a method for a yeast cell display library. This is a two component system, wherein the first component involves expressing one subunit of the yeast mating adhesion protein, agglutinin, which is anchored to the yeast cell wall. The second component involves expressing a protein library fused to a second subunit of the agglutinin protein which forms high affinity disulfide bonds to the first agglutinin subunit. The protein library fused to the agglutinin is thus displayed on the surface of the cell. The library can then be screened. This method allows for the proper folding and post-translational modification of eukaryotic proteins.
[0006] Rakestraw et al. (PCT/US20081003978) have developed a three component system for displaying a protein library on the surface of yeast cells. The first component involves expressing a protein library fused to a biotin-binding peptide, the second component involves modifying the yeast cell wall to express biotin, and the third component involves binding avidin to the biotin expressed on the cell surface. The fused protein library is then biotinylated and secreted from the yeast cell and binds to the avidin on the yeast cell surface, thus displaying the protein library on the surface of the yeast cell. One potential drawback of this system is that avidin non-specifically binds all biotin. Another potential drawback is that avidin contains four binding sites, which may cause steric hindrance thus preventing the biotinylated protein library from binding to the cell surface bound avidin. Similarly, the avidin molecule may bind the biotin) fated protein library before binding the biotinylated yeast cell wall, thereby hindering the binding of the avidin to the yeast cell wall. Additionally, this method contains the added complication of having to biotinylate the protein library within the yeast cell. This necessary extra step requires further modification to the yeast cell. It is well established that the more modifications are made to a biological system, the less likely it is that the system will behave as designed. In addition, since avidin/streptavidin is multivalent, care must be taken to not cross-link the biotinylated cells. Finally, biotin/streptavidin and biotin/avidin are used in a number of commercially available labeling kits. Such kits would be difficult to use in such a biotin/avidin display system.
[0007] The prior art lacks a simple, efficient system capable of specifically binding a secreted protein library using an adapter molecule that binds to the protein library and to the surface of a eukaryotic cell through different binding moieties.
SUMMARY OF THE INVENTION
[0008] The present invention meets this need by providing methods and compositions as disclosed through out the specification. One aspect includes host cells with a cell surface molecule attached to the surface of the cell, an adapter molecule comprising a first binding site and a second binding site and a display molecule comprising a modified polypeptide where the first binding site binds specifically to the cell surface molecule and cannot bind to the display molecule, the second binding site binds specifically to the display molecule and cannot bind to the cell surface molecule, and adapter molecule is not a component of the modified polypeptide. In certain embodiments, the host cell has a plurality of display molecules. In other embodiments which may be combined with the preceding embodiments, the host cell surface molecule may be covalently linked to the first binding, site. In other embodiments which may be combined with the preceding embodiments, the host cell surface molecule may be covalently linked to the first binding site through a disulfide bond. In other embodiments which may be combined with any of the preceding embodiments, the host cell surface molecule may include a first agglutinin which may be Aga1p. In other embodiments which may be combined with any of the preceding embodiments, the host cell surface molecule may be attached to the cell membrane via at GPI anchor. In other embodiments which ma be combined with any of the preceding embodiments, wherein the first binding site comprises a second agglutinin which may be Aga2p. In other embodiments which may be combined with any of the preceding embodiments, the second binding site may be covalently linked to the display molecule. In other embodiments which may be combined with any of the preceding embodiments, the second binding site may be covalently linked to the display molecule through disulfide bonds. In other embodiments which may be combined with any of the preceding embodiments, the second binding site includes a PDZ domain which may be the PDZ domain of InaD which may have the amino acid sequence of SEQ ID NO: 8. In other embodiments which may be combined with any of the preceding embodiments, the display molecule includes a NorpA ligand which may be at the C-terminus which may have the amino acid sequence of SEQ ID NO: 9. In other embodiments which may be combined With any of the preceding embodiments except where the second binding site includes a PDZ domain or where the display molecule comprises a NorpA ligand, the display molecule includes a PDZ domain which may be the PDZ domain of InaD which may have the amino acid sequence of SEQ ID NO: 8. In other embodiments which may be combined with ally of the preceding embodiments except where the second binding site includes a PDZ domain or where the display molecule comprises a NorpA ligand, the second binding site includes a NorpA ligand which may be at the C-terminus which may have the amino acid sequence or SEQ ID NO: 9. In other embodiments which may be combined with any of the preceding embodiments, wherein the modified polypeptide may be a scaffold protein, a signal transduction protein, an antibody, an immunoglobulin, an immunoadhesin, a receptor, a ligand an oncoprotein, a transcription factor, or an enzyme. In other embodiments which may be combined with any of the preceding embodiments, display molecule may be a fibronectin polypeptide which may include an F10 polypeptide. In other embodiments which may be combined with any of the preceding embodiments, the display molecule includes a secretion signal peptide may be an MFalpha, secretion signal sequence, a glucoamylase, an Aga2 secretion signal sequence, an Flo1p secretion signal sequence, an invertase secretion signal sequence, or an acid phosphatase secretion signal sequence. In other embodiments which may be combined with any of the preceding embodiments, the secretion signal peptide may be an MFalpha/HSA hybrid leader peptide. In other embodiments which may be combined with any of the preceding embodiments, expression of the display molecule is under the control of a first inducible promoter which may be an AOX 1 promoter, a Cup 1 promoter, or a Gal promotor. In other embodiments which may be combined with any of the preceding embodiments, the expression of the adapter molecule is under the control of a second inducible promoter which may be an AOX 1 promoter, a Cup 1 promoter, or a Gal promotor, in other embodiments which may be combined with any of the preceding embodiments, the host cell may be a yeast cell which may Pichia pastoris or Saccharomyces cerevisiae.
[0009] Another aspect includes libraries of host cells which include least two host cells in accordance with the preceding aspect and any and all of its embodiments where each host cell includes a different modified polypeptide.
[0010] Yet another aspect includes methods for displaying a modified polypeptide which includes (a) providing a host cell comprising a cell surface molecule attached to the surface of the cell and a first nucleic acid encoding a display polypeptide comprising a modified polypeptide, (b) contacting the host cell with an adapter molecule comprising a first binding site and a second binding site under conditions wherein the first binding site binds to the cell surface molecule, and then (c) incubating, the host cell under conditions wherein the host cell exports the display polypeptide outside the host cell under conditions wherein the second binding site binds to the display polypeptide, where the first binding site binds specifically to the cell surface molecule and cannot bind to the display molecule, the second binding site binds specifically to the display polypeptide and cannot hind to the cell surface molecule, and the adapter molecule is not a component of the modified polypeptide. In other embodiments, the host cell may display at least 102, at least 103, at least 104, or at least 105 modified polypeptides. In other embodiments which may be combined with the preceding embodiments, the host cell surface molecule may be covalently linked to the first binding site. In other embodiments which may be combined with the preceding embodiments, the host cell surface molecule may be covalently linked to the first binding site through a disulfide bond. In other embodiments which may be combined with any of the preceding embodiments, the host cell surface molecule may include a first agglutinin which may be Aga1p. In other embodiments Which may be combined with any of the preceding embodiments, the host cell surface molecule may be attached to the cell membrane via a GPI anchor. In other embodiments which may be combined with any of the preceding embodiments, wherein the first binding site comprises a second agglutinin which may be Aga2p. In other embodiments which may be combined with any of the preceding embodiments, the second binding site may be covalently linked to the display molecule. In other embodiments which may be combined with any of the preceding embodiments, the second binding site may be covalently linked to the display molecule through disulfide bonds. In other embodiments which may be combined with any of the preceding embodiments, the second binding site includes a PDZ domain which may be the PDZ domain of InaD which may have the amino acid sequence of SEQ ID NO: 8. in other embodiments which may be combined with any of the preceding embodiments, the display molecule includes a NorpA ligand which may heat the C-terminus which may have the amino acid sequence of SEQ ID NO: 9. In other embodiments which may be combined with any of the preceding embodiments except where the second binding site includes a PDZ domain or where the display molecule comprises a NorpA ligand, the display molecule includes a PDL domain which may be the PDZ domain of InaD which may have the amino acid sequence of SEQ ID NO: 8. In other embodiments which may be combined with any of the preceding embodiments except where the second binding site includes a PDZ domain or where the display molecule comprises a NorpA ligand, the second binding site includes a NorpA ligand which may be at the C-terminus which may have the amino acid sequence of SEQ ID NO: 9. In other embodiments which may be combined with any of the preceding embodiments, wherein the modified polypeptide may be a scaffold protein, a signal transduction protein, an antibody, an immunoglobulin, an immunoadhesin, a receptor, a ligand, an oncoprotein, a transcription factor, or an enzyme. In other embodiments which may be combined with any of the preceding embodiments, display molecule may be a fibronectin polypeptide which may include an F10 polypeptide. In other embodiments which may be combined with any of the preceding embodiments, the display molecule includes a secretion signal peptide may be an MFalpha secretion signal sequence, a glucoamylase an Aga2 secretion signal sequence, an Flo1p secretion signal sequence, an invertase secretion signal sequence, or an acid phosphatase secretion signal sequence. In other embodiments which may be combined with any of the preceding embodiments, the secretion signal peptide may be an MFalpha/HSA hybrid leader peptide. In other embodiments which may be combined with any of the preceding embodiments, expression of the display molecule is under the control of a first inducible promoter which may be an AOX 1 promoter,a Cup 1 promoter, or a Gal promotor. In other embodiments which may be combined with any of the preceding embodiments, the expression of the adapter molecule is under the control of a second inducible promoter which may be an AOX 1 promoter, a Cup 1 promoter, or a Gal promotor. In other embodiments which may be combined with any of the preceding embodiments, the host cell may be a yeast cell winch may be Pichia pastoris or Saccharomyces cerevisiae.
[0011] Still another aspect includes methods for generating a host cell display library which includes introducing into a plurality of host cells a display library of first nucleic acids each encoding a display polypeptide comprising a modified polypeptide, wherein at least two of the introduced first nucleic acids encode different modified polypeptides, wherein each host cell comprises a second nucleic acid which encodes a cell surface polypeptide and a third nucleic acid which encodes an adapter molecule comprising a first binding site and a second binding site where the first binding site binds to the cell surface molecule but not the display polypeptide, the second binding site binds to the display polypeptide but not the cell surface molecule, and the adapter molecule is not as component of the modified polypeptide. This aspect may be combined with any of the embodiments of the preceding aspects.
[0012] The foregoing are non-limiting examples of the present invention. Additions aspects and embodiments may be found throughout the specification.
BRIEF DESCRIPTION OF THE DRAWINGS
[0013] FIG. 1 shows a schematic of the three component system including the cell surface molecule, the adapter molecule including the first and second binding sites and the display molecule with the binding partner for the second binding site (a binding polypeptide in this embodiment) and a modified polypeptide as the molecule being displayed. In this embodiment, the host cell is a yeast cell.
[0014] FIG. 2 shows the pPlC3.5 AGA1 vector for yeast expression of the Aga1p as the cell surface molecule.
[0015] FIG. 3 shows the pPlC6 A AGA2-InaD vector for yeast expression of the Aga2p-InaD fusion polypeptide as the adapter molecule.
[0016] FIG. 4 shows the pPlCHOLl-1 MFalpha1 Hsa-Fn10-NorpA vector for yeast expression of the MFalpha1Hsa-Fn10-NorpA fusion polypeptide as the display molecule where the NorpA is the binding partner of the second binding site of the adapter molecule (i.e., InaD) and the fibronectin F10 domain is modified polypeptide.
[0017] FIG. 5 shows the pPlCHOL1-C MFalpha1 Hsa-Fn10-NorpA vector for yeast expression of the MFalpha1Hsa-Fn10-NorpA fusion polypeptide as the display molecule where the NorpA is the binding partner of the second binding site of the adapter molecule (i.e., InaD) and the fibronectin HO domain is modified polypeptide.
[0018] FIG. 6 shows the pYD NBC1 Aga2-InaD vector for yeast expression of the Aga2p-InaD fusion polypeptide as the adapter molecule.
[0019] FIG. 7 shows the pYS HSA MFalpha1 Fn10 NorpA vector for yeast expression of the MFalpha1HSA-Fn10-NorpA fusion polypeptide a the display molecule where the NorpA is the binding partner of the second binding site of the adapter molecule (i.e., InaD) and the fibronectin F10 domain is modified polypeptide.
[0020] FIG. 8 shows the pYS MFalpha1 HSA NorpA vector for yeast expression of the MFalpha1-HSA-NorpA fusion polypeptide as the display molecule where the NorpA is the binding partner of the second binding site of the adapter molecule (i.e., InaD) and the HSA is the displayed polypeptide.
[0021] FIG. 9A-E are FACS analysis graphs showing protein surface expression of yeast cells expressing either fibronectin (pYS6/CT HSA MFalpha1 Fn10 NorpA) or HSA (pYS6/CT MFalpha1-HSA-NorpA) in which the yeast cells are stained with anti-myc antibody and APC labeled secondary anti-mouse antibody. FIG. 9A is the a control with unstained yeast cells: FIG. 9B are uninduced yeast cells expressing fibronectin; FIG. 9C are induced yeast cells expressing fibronectin showing a shift in the curve; FIG. 9D are uninduced yeast cells expressing HSA; and FIG. 9E are induced yeast cells expressing HSA showing a shift in the curve.
[0022] FIG. 10A-E are images of FMAT analysis of yeast cells expressing either fibronectin (pYS6/CT HSA MFalpha1 Fn 10 NorpA) or HSA (pYS6/CT HSA-NorpA) in which the yeast cells are stained with anti-myc mouse monoclonal antibody and APC labeled secondary anti-mouse antibody and subjected to FMAT confocal fluorescence. FIG. 10A is the a control with unstained yeast cells: FIG. 10B are uninduced yeast cells expressing fibronectin; FIG. 10C are induced yeast cells expressing fibronectin appearing as white spots; FIG. 101) are uninduced yeast cells expressing HSA; and FIG. 10E are induced yeast cells expressing HSA appearing, as white spots.
[0023] FIG. 11 shows the pYS MFalpha1 scFv lysozyme NorpA vector for yeast expression attic MFalpha1 scFv lysozyme NorpA fusion polypeptide as the display molecule where the NorpA is the binding partner of the second binding site of the adapter molecule (i.e., InaD) and the lysozyme is modified polypeptide.
[0024] FIG. 12 shows a reversed system in which the pYD NBC1 Aga2-NorpA vector is used for yeast expression of the NBC1 Aga2-NorpA,
[0025] FIG. 13 shows a reversed system in which the pYS6/CT*MFalpha1-InaD-Fn10 vector is used for yeast expression of the MFalpha1-InaD-Fn10.
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0026] As used herein the term "host cell" refers to a eukaryotic cell that has been modified to express a cell surface molecule, an adapter molecule, and a display molecule. Furthermore, it should be understood that the host cell secretes or excretes the display molecule prior to binding the display molecule to the adapter molecule on the surface of the host cell.
[0027] As used herein the term "cell surface molecule" refers to a peptide, polypeptide, binding domain, ligand, lipid, or carbohydrate that is directed to the extracellular surface of the host cell. The cell surface molecule may be anchored to the cell surface by covalent binding or non-covalent binding. The cell surface molecule may include a phospholipid, carbohydrate or protein through which it attaches to the surface of the host cell. The cell surface molecule may be a polypeptide that binds to, or is conjugated to a phospholipid, carbohydrate, or a polypeptide on the surface of the cell. For example, the polypeptide may use a phosphatidyl-inositol-glycan (GPI) anchor to attach to the surface of the host cell, such as α-agglutinins, α-agglutinins, and flocculins. The cell surface molecule may also be a transmembrane protein with a binding domain located on the surface of the host cell that can bind to the first binding site of the adapter molecule.
[0028] As used herein the term "adapter molecule" refers to a peptide, polypeptide, binding domain, ligand, lipid, or carbohydrate or combination of the foregoing that has two distinct binding sites. The adapter molecule has a binding site that specifically binds the cell surface molecule and a second distinct binding she that specifically binds the display molecule. Without limiting the invention, the two binding sites of the polypeptide ma bi polypeptide domains each with its on binding affinity to a different molecule that are fused together. For example, the polypeptide may be an a-agglutinin subunit, such as Aga2p, fused to a PDZ domain, or it may be a flocculin, such as Flo1, fused to a PDZ domain.
[0029] As used herein the term "first binding site" refers to a region of the adapter molecule that specifically recognizes and binds at least a portion of the cell surface molecule. For example, the first binding site may comprise a peptide, polypeptide, binding domain, ligand, lipid, or carbohydrate or combination thereof that specifically binds to a cell surface molecule which could include, without limitation, a peptide, binding domain, ligand, protein, lipoprotein, lipid, or carbohydrate. More specifically, but without limiting the invention, the first binding, site may refer to the Aga2p subunit of α-agglutinin that specifically binds to the Aga1p subunit of α-agglutinin through disulfide bonds. In general, any to molecular binding partners may be used for the first binding site and the corresponding portion of the cell surface molecule. Examples include Ni2+ ions and polyhistidine tags, sugar residues and Concanavalin A, p-aminophenyl-β-D-thiogalactoside and β-galactosidase (Germino et al., Proc. Natl. Acad. Sci. USA 80 6848 (1983), glutathione and glutathione-S-transferase (Smith, D. B. and Johnson, K. S. Gene 67:311 (1988)); staphylococcal protein A and IgG (Uhlen, M. et al. Gene 23:369 (1983)), calmodulin nickel binding proteins (CNBP) and calmodulin agarose Stofko-Hahn R. E. et al. FEBS Lett. 302(3):274-278); streptavidin or avidin and biotin (Takashige, S. and Dale, G. L., Proc. Natl. Acad. Sci. USA. 85:1647-1651 (1988)); amylase and maltose-binding protein domain from the malE gene of E. coli (Bach, H. et al, J. Mol. Biol. 312:79-93 (2001)), any epitope and its corresponding antibody (Sec, Kolodziej. P. A. and Young., R. A Methods Enzymol. 194:508-519 (1991), e.g., the FLAG® octapeptide or antidigoxygenin antibody and digoxygenin).
[0030] As used herein the term "second binding site" refers to a region of the adapter molecule that specifically recognizes and hinds the display molecule. For example, the second binding site may comprise a peptide, polypeptide, binding domain, ligand, lipid, or carbohydrate that specifically binds to a peptide, ligand, protein, lipoprotein, lipid, or carbohydrate comprising the display molecule. More specifically, but without limitations, the second binding site may refer to a PMZ domain that specifically binds to a NorpA ligand. Any of the binding pairs suitable for the first binding site may also be used for the second binding site so long as they do not recognize the same partners.
[0031] As used herein the term "display molecule" refers to a molecule that can be localized to the surface of the host cell via binding of the adapter molecule on the surface of the host cell. The display molecule will typically comprise the molecule (or library of molecules) to be displayed and a binding partner that is specifically bound by the second binding site of the adapter molecule. In certain instances the molecule to be displayed and the binding partner may be one in the same. By way of example, the display molecule may comprise a peptide, polypeptide, binding domain, ligand, lipid, or carbohydrate or combination thereof. It should be understood that the display molecule is expressed or otherwise generated within the host cell and is secreted or excreted out of the cell so as to be displayed on the surface of said cell. The display molecule may comprise a library of varied molecules that can be screened for binding to a target or for improved or altered activity. In certain embodiments, the library may comprise modified polypeptides. The display molecule may also comprise a tag or peptide that can be labeled so as to detect binding of the display molecule to the cell surface, or sort host cells displaying said molecule.
[0032] As used herein the term "modified polypeptide" refers to any polypeptide of interest that is fused to a peptide, polypeptide, binding domain, ligand, lipid, or carbohydrate that specifically binds to a peptide, ligand, protein, lipoprotein, lipid, or carbohydrate comprising the second binding site of the adapter molecule, and is displayed on the surface of the host cell (and is therefore a component of the display molecule). Non-limiting examples of the modified polypeptide are scaffold proteins, signal transduction proteins, antibodies, immunoglobulins, immunoadhesins, receptors, ligands, oncoproteins, transcription factors, and enzymes,
[0033] As used herein, the term "plurality of display molecules" refers to at least two copies of the display molecule displayed on the surface of host cells. In certain instances, each unique display molecule is displayed by a different host cell.
[0034] As used herein the term "component of the modified polypeptide" refers to any naturally occurring binding partners of any fragment of the modified peptide. Non-limiting examples include an immunoglobulin light chain binding to an immunoglobulin heavy, a biotin molecule binding avidin, two subunits of α-hemoglobin dimerizing, a myosin heavy chain binding to a myosin light chain, two monomers of glycophorin. A dimerizing, or two monomers of any naturally occurring dimer protein binding to one another.
[0035] As used herein the term "library of host cells" refers to a plurality of host cells, wherein each host cell comprises a non-identical modified polypeptide that is displayed on the surface of the cell.
[0036] As used herein the term "non-identical modified polypeptide" refers to the amino acid sequence of at least two modified polypeptides, wherein each amino acid sequence comprises amino acid substitutions, insertions, or deletions which differentiate one modified polypeptide displayed on the surface of a host cell from another modified polypeptide displayed on the surface of a second host cell.
[0037] As used herein the term "Fn10" refers to the tenth type III domain of human fibronectin.
[0038] Display Molecules
[0039] The display molecules may be used to display any molecule that may be expressed or otherwise generated in a host cell. Non limiting examples of such molecules follow.
[0040] Antibody Scaffold
[0041] The display molecules may be immunoglobulins. Methods of generating libraries of immunoglobulins were initially developed to display the immunoglobulins via phage, but additional methods of display have since been developed. All of the methods of generating libraries for these alternative methods of display may be adapted to allow display using the methods disclosed herein. Exemplary method of generating libraries of antibodies may be found in U.S. Pat. Nos. 5,223,409; 5,403,484; and 5,571,698 to Ladner et al.: U.S. Pat. No 5,427,908 and 5,580,717 to Dower et al.: U.S. Pat. Nos. 5,969,108 and 6,172,197 to McCafferty et al.; and U.S. Pat. Nos. 5,885,793; 6,521,404; 6,544,731; 6,555,313; 6,582,915 and 6,593,081 to Griffiths et al.
[0042] Non-antibody Scaffold
[0043] Known non-immunoglobulin frameworks or scaffolds which may be displayed using the methods disclosed herein include, but are not limited to, fibronectins (Compound Therapeutics, Inc., Waltham, Mass.), ankyrin (Molecular Partners AG, Zurich, Switzerland), domain antibodies (Domantis, Ltd (Cambridge, Mass.) and Ablynx nv (Zwijnaarde, Belgium)), lipocalin (Anticalin) (Pieris Proteolab AG, Freising, Germany), small modular immuno-pharmaceuticals (Trubion Pharmaceuticals Inc., Seattle, Wash.), maxybodies (Avidia, Inc. (Mountain View, Calif.)), Protein A (Affibody AG, Sweden) and affilin (gamma-crystallin or ubiquitin) (Scil Proteins GmbH, Halle, (Germany), protein epitope munches (Polyphor Ltd, Allschwil, Switzerland).
[0044] (i):Fibronetins
[0045] The adnectin scaffolds are based on fibronectin type III domain (e.g., the tenth module of the fibronectin type III (10 Fn3 domain). The fibronectin type III domain has 7 or 8 beta strands which are distributed between two beta sheets, which themselves pack against each other to form the core of the protein, and further containing loops (analogous to CDRs) which connect the beta strands to each other and are solvent exposed. There are at least three such loops at each edge of the beta sheet sandwich, where the edge is the boundary of the protein perpendicular to the direction of the beta strands. (U.S. Pat. No. 6,673,901).
[0046] These fibronectin-based scaffolds are not an immunoglobulin, although the overall fold is closely related to that of the smallest functional antibody fragment, the variable region of the heavy chain, which comprises the entire antigen recognition unit in camel and llama IgG. Because of this structure, the non-immunoglobulin fibronectin molecule mimics antigen binding properties that are similar in nature and affinity to those of antibodies. These scaffolds can be used in a loop randomization and shuffling strategy in vitro that is similar to the process of affinity maturation of antibodies in vivo. These fibronectin-based molecules can be used as scaffolds where the loop regions of the molecule can be replaced with CDRs of the disclosure using standard cloning techniques.
[0047] (ii) Ankyrin--Molecular Partners
[0048] The technology is based on using proteins with ankyrin derived repeat modules as scaffolds for bearing variable regions which can be used for binding to different targets. The ankyrin repeat module is a 33 amino acid polypeptide consisting of two anti-parallel α-helices and a β-turn. Binding of the variable regions is mostly optimized by using ribosome display.
[0049] (iii) Maxybodies/Avimers--Avidia
[0050] Avimers are derived from natural A-domain containing protein such as LRP-1. These domains are used by nature for protein-protein interactions and in human over 250 proteins art structurally based on A-domains. Avimers consist of a number of different "A-domain" monomers (2-10) linked via amino acid linkers. Avimers can be created that can bind to the target antigen using the methodology described in, for example, 20040175756; 20050053973; 20050048512; and 20060008844.
[0051] (vi) Protein A--Affibody
[0052] Affibody® affinity ligands are small, simple proteins composed of a three-helix bundle based on the scaffold of one of the IgG-binding domains of Protein A. Protein A is a surface protein from the bacterium Staphylococcus aureus. This scaffold domain consists of 58 amino acids, 13 of which are randomized to generate Affibody® libraries with a large number of ligand variants (See e.g., U.S. Pat. No. 5,831,012). Affibody® molecules mimic antibodies, they have a molecular weight of 6 kDa, compared to the molecular weight of antibodies, which is 150 kDa. In spite of its small size, the binding site of Affibody molecules is similar to that of an antibody.
[0053] (v) Anticalins--Pieris
[0054] Anticalins® are products developed by the company Pieris ProteoLab AG. They are derived from lipocalins, a widespread group of small and robust proteins that are usually involved in the physiological transport or storage of chemically sensitive or insoluble compounds. Several natural lipocalins occur in human tissues or body liquids.
[0055] The protein architecture is reminiscent of immunoglobulins, with hypervariable loops on top of a rigid framework. However, in contrast with antibodies or their recombinant fragments, lipocalins are composed of a single polypeptide chain with 160 to 180 amino acid residues, being just marginally bigger than a single immunoglobulin domain.
[0056] The set of four loops, which makes up the binding pocket, shows pronounced structural plasticity and tolerates a variety of side chains. The binding site can thus be reshaped in a proprietary process in order to recognize prescribed target molecules of different shape with high affinity and specificity.
[0057] One protein of lipocalin family, the bilin-binding protein (BBP) of Pieris Brassicae has been used to develop anticalins by mutagenizing the set of four loops. One example of a patent application describing "anticalins" is PCT WO199916873.
[0058] (vi) Affilin--Scil Proteins
[0059] Affilin® molecules are small non-immunoglobulin proteins which are designed for specific affinities towards proteins and small molecules. New Affilin® molecules can be very quickly selected from two libraries, each of which is based on a different human derived scaffold protein.
[0060] Affilin® molecules do not show any structural homology to immunoglobulin proteins. Scil Proteins employs two Affilin® scaffolds, one of which is gamma crystalline, a human structural eye lens protein and the other is "ubiquitin" superfamily proteins. Both human scaffolds are very small, show high temperature stability and are almost resistant to pH changes and denaturing agents. This high stability is mainly due to the expanded beta sheet structure of the proteins. Examples of gamma crystalline derived proteins are described in WO200104144 and examples of "ubiquitin-like" proteins are described in WO2004106368.
[0061] (vii) Protein Epitope Mimetics (PEM)
[0062] PEM are medium-sized, cyclic, peptide-like molecules (MW 1-2kDa) mimicking beta-hairpin secondary structures of proteins, the major secondary structure involved in protein-protein interactions.
[0063] Non-scaffold
[0064] In addition to scaffolds which are useful for de novo generation of molecule with specific affinity, the methods disclosed herein may be used to display any other biological molecule that can be expressed or otherwise generated in the host cell. Libraries of such biological molecules, particularly polypeptides which can be encoded by polynucleotides for easy expression by the host cell, may be screened for improved characteristics of interest such as improved binding between receptor and ligand where the receptor or the ligand are part of the display molecule or improved enzymatic activity where the enzyme is part of the display molecule.
[0065] Expression Systems
[0066] Expression vectors may be used to express one or more of the cell surface molecules, the adapter molecule and the display molecule, in the host cell. Expression vectors for eukaryotic host cells typically include (i) eukaryotic DNA elements that control initiation of transcription, such as a promoter, (ii) eukaryotic DNA elements that control the processing of transcripts, such as a transcription termination/polyadenylation signal sequence, and (iii)optionally eukaryotic DNA elements that control replication in the eukaryotic host cell if the vector is to be independently replicated (e.g., non-integrating vectors). To ease construction of such expression vectors, the vectors may optionally include (iv) prokaryotic DNA elements coding for a bacterial replication origin and an antibiotic resistance marker to provide for the growth and selection of the expression vector when manipulating the vector in the bacterial host cell. Appropriate eukaryotic expression vectors for use with fungal, yeast, and mammalian cellular hosts are known in the art, and are described in, for example, Powell et al. (Cloning Vectors: A Laboratory Manual, Elsevier, N.Y., 1985).
[0067] Yeast host cells are of particular interest and include Saccharomyces cerevisiae, Pichia pastoris, and Pichia methanolica. These vectors include YIp-based vectors, such as YIp5, YRp vectors, such as YRp17, YEp vectors such as YEp13 and YCp vectors, such as YCp19. A number of vectors exist for the expression of recombinant proteins in yeast, Other example of the YEp vectors include YEp24, YEp51, and YEp52,which are cloning and expression vehicles useful in the introduction of genetic constructs into S. cerevisiae (see, e.g., Broach et al. (1983) in Experimental Manipulation of Cleric Expression, ed. M. Inouye Academic Press, p 83), These vectors are also shuttle vectors in that they can replicate in E. coli due the presence of the pBR322 ori, and in S. cerevisiae due to the replication determinant of the yeast 2 micron plasmid.
[0068] Suitable promoters for function in yeast include the promoters for metallothionein, 3-phosphoglycerate kinase (Hitzeman et al., J. Biol. Chem. 255, 2073 (1980) or other glycolytic enzymes (Hess et al., J. Adv. Enzyme Req. 7, 149 (1968); and Holland et al, Biochemistry 17, 4900 (1978)), such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phospho-fructokinase, glucose-6-phosphate isomerase, 3-phosphoglycerate mutase, pyruvate kinase, triosephosphate isomerase, phospho-glucose isomerase, and glucokinase. Suitable vectors and promoters for use in yeast expression are further described in R. Hitzeman et al., EP073,657. Other suitable promoters for expression in yeast include the promoters from GAL1 (galactose), PGK (phosphoglycerate kinase), ADH (alcohol dehydrogenase), AOX1 (alcohol oxidase), HIS4 (histidinol dehydrogenase), and the like. Many yeast cloning vectors readily available and can be modified following the above discussion. Still other promoters, which have the additional advantage of transcription controlled by growth conditions, are the promoter regions for alcohol dehydrogenase 2, isocytochrome C, acid phosphatase, degradative enzymes associated with nitrogen metabolism, and the afore-mentioned metallothionein and glycetaldehyde-3-phosphate dehydrogenase, as well as enzymes responsible for maltose and galactose utilization. Finally, promoters that are active in only one of the two haploid mating types may be appropriate in certain circumstances. Among these haploid-specific promoters, the pheromone promoters MFa1 and MFα1 are of particular interest.
[0069] Secretion from yeast host cells of the components including the adapter molecule (if produced in the host cell) and the display molecule may be increased by use any available secretion signal sequences of yeast proteins, One example is the leader sequence of a precursor of yeast mating pheromone, α-factor, which has also been used to direct secretion of heterologous proteins in yeast (See. e.g., Valenzuela, P., eds pp. 269-280, Butterworths, London; Brake, A. J. (1990) Meth. Enzymol. 185, 408-441). The α-factor leader sequence, in addition to the N-terminal signal peptide of 17 residues, includes a hydrophilic pro-region which contains 72 residues and bears three sites of N-linked glycosylation. The pro-region is extensively glycosylated in the ER and Golgi and is cleaved by Kex2 endopeptidase in the late Golgi compartment. The presence of the pro-region at the N-terminus is believed to allow some heterologous proteins to pass the quality control in the ER and to reach the periplasm.
[0070] Another example is the leader sequence from yeast invertase (MLLQAFLFLLAGFAAKISADAHKS) (SEQ ID NO: 1). This leader sequence has been demonstrated to be cleaved from nascent heterologous peptide upon entrance into the endoplasmic reticulum. The enzyme responsible for cleavage of the pre sequence, Kex2, resides in the trans Golgi. A further example is the signal sequence of yeast acid phosphatase which may be used to direct the secretion of the components disclosed herein.
[0071] Methods for transforming S. cerevisiae cells with exogenous DNA and producing recombinant polypeptides therefrom are disclosed by, for example, Kawasaki, U.S. Pat. No. 4,599,311, Kawasaki et al., U.S. Pat. No. 4,931,373, Brake, U.S. Pat. No. 4,870,008, Welch et al, U.S. Pat. No. 5,037,743, and Murray et at U.S. Pat. No. 4,845,075. Transformed cells are selected by phenotype determined by the selectable, marker, commonly drug resistance or the ability to grow in the absence of a particular nutrient (e.g., leucine). A preferred vector system for use in Saccharomyces cerevisiae is the POT1 vector system disclosed by Kawasaki et al. (U.S. Pat. No. 4,931,373), which allows transformed cells to be selected by growth in glucose containing media.
[0072] Transformation systems for other yeasts, including Hansenula polymorpha, Schizosaccharomyces pombe, Kluyveromyces lactis, Kluyveromyces fragilis, Ustilago maydis, Pichia pastoris, Pichia methanolica, Pichia guillermondii and Candida maltosa are known in the art. See, for example, Gleeson et al,. J. Gen. Microbiol. 132:3459 (1986), and Cregg, U.S. Pat. No. 4,882,279. Aspergillus cells may be utilized according to the methods of McKnight et al., U.S. Pat. No. 4,935,349. Methods for transforming Acremonium chrysogenum are disclosed by Sumino et al., U.S. Pat. No. 5,162,228. Methods for transforming Neurospora are disclosed by Laambowitz, U.S. Pat. No. 4,486,533.
[0073] For example, the use of Pichia methanolica as host for the production of recombinant proteins is disclosed by Raymond, U.S. Pat. No. 5,716,808 Raymond, U.S. Pat. No. 5,736,383, Raymond et al., Yeast 14:11-23 (1998), and in international publication Nos. WO 97/17450, WO 97/17451, WO 98/02536, and WO 98/02565. DNA molecules for use in transforming P. methanolica will commonly be prepared as double-stranded, circular plasmids, which are preferably linearized prior to transformation. For polypeptide production in P. methanolica it is preferred that the promoter and terminator in the plasmid be that of a P. methanolica gene, such as a P. methanolica alcohol utilization gene (AUG1 or AUG2). Other useful promoters include those of the dihydroxyacetone synthase (DHAS), formate dehydrogenase (FMD), and catalase (CAT) genes. To facilitate integration of the DNA into the host chromosome, it is preferred to have the entire expression segment of the plasmid flanked at both ends by host DNA sequences. For large-scale, industrial processes where it is desirable to minimize the use of methanol, it is preferred to use host cells in which both methanol utilization genes (AUG1 and AUG2) are deleted, For production of secreted proteins host cells deficient in vacuolar protease genes (PEP4 and PRB1) are preferred. Electroporation is used to facilitate the introduction of a plasmid containing DNA encoding a polypeptide of interest into P. methanolica cells. P. methanolica cells can be transformed by electroporation using an exponentially decaying, pulsed electric field having a field strength of from 2.5 to 4.5 kV/cm, preferably about 3.75 kV/cm, and a time constant (t) of from 1 to 40 milliseconds, most preferably about 20 milliseconds.
[0074] For use of mammalian host cells, mammalian expression vectors are also well known in the art and may be used as well. Examples of suitable mammalian host cells include African green monkey kidney cells (Vero; ATCC CRL 1587), human embryonic kidney cells (293-HEK; ATCC CRL 1573), baby hamster kidney cells (BHK-21,BHK-570; ATCC CRL8544, ATCC CRL 10314), canine kidney cells (MDCK; ATCC CCL 34), Chinese hamster ovary cells (CHO-K1; ATCC (CCL61; CHO DG44 (Chasin et al., Som, Cell. Molec. Genet. 12:555, 1986)), rat pituitary cells (GH1; ATCC CCL82), HeLa S3 cells (ATCC, CCL2.2), rat hepatoma cells (H4-II-E, ATCC CRL 1548) SV40-transformed monkey kidney cells (COS-1 ATCC CRL 1650) and murine embryonic cells (NIH-3T3; ATCC CRL 1658).
EXAMPLES
[0075] The following provides non-limiting examples of the systems, compositions and methods disclosed herein. Proteins can be displayed on the surface of yeast cells by utilizing the PDZ domain of the yeast InaD protein and the C-terminal 5 amino acids of the yeast NorpA protein. This three component protein display system consists of a vector expressing the protein to be displayed with a secretion signal fused at its N-terminus, and the NorpA ligand fused at the C-terminus; a second vector expressing an adapter protein that can bind specifically to a yeast cell wall protein, and which is fused to the PDZ domain of InaD, which binds specifically to the NorpA ligand; and a third vector that express a yeast cell wall protein that binds specifically to the adapter protein. This system has been adapted for use in Sacchromyces cerrevisiae and Pichia pastoris.
Example 1
Yeast Display Using InaD/NorpA Interaction in Pichia pastoris
[0076] The protein display system for P. pastoris was developed to display a fibronectin type 111 domain (Fn10), by fusing a hybrid secretion sequence (MFalpha/HSA) or a yeast leader sequence (MFalpha1) at N-terminus of Fn10 and fusing the NorpA ligand to its C-terminus. Once expressed, the Fn10 was secreted from the cell and the NorpA ligand bound specifically to the PDZ domain of InaD through disulfide bonds. The InaD was fused to the C-terminus of the Agap2 protein. The Aga2p-InaD fusion protein served as the adapter protein, and the N-terminal Aga2p bound Aga1p, which was immobilized on the surface of the cell. Aga2p bound specifically to Aga1p through disulfide bonds.
[0077] The three component system consisting of the Fn10-NorpA fusion protein, the
[0078] Aga2p-InaD fusion protein, and the Aga1p cell surface protein were cloned into pPIC expression vectors, under the control of an inducible promoter. The inducible promoter used was the AOX1 promoter, which is induced by methanol. Thus when methanol was added to yeast cells transformed with the vectors, the three proteins were expressed. Aga1p as expressed on the surface of the cell, Aga2p-InaD was localized to the cell surface where the N-terminal region of Aga2p-InaD bound to Aga1p. Fn10-NorpA was localized to the secretory pathway, was secreted from the cell, and bound InaD via the C-terminal NorpA ligand (FIG. 1). The system can also be switched such that the InaD is fused to Aga1 and NorpA is fused to Aga2p (See FIGS. 12 and 13).
[0079] A c-myc epitope to was fused between the NorpA ligand and the C-terminus of Fn10. The c-myc epitope allowed for the detection of the displayed fibronectin by using a c-myc antibody. The fluorescently labeled c-myc antibody bound to the c-myc epitope on the surface of the cell was detected by fluorescence-activated cell sorting (FA(S).
[0080] Strains and Media
[0081] The Escherichia coli Top10 strain (Invitrogen Carlsbad, Calif.) was used as the host strain for recombinant DNA manipulation. The P. pastoris GS115 strain (Invitrogen Co., Carlsbad, Calif.) was used for the production of the fusion protein AGA2-InaD and HSA/MFalpha1-Fn10-NorpA. E. coli as cultivated in LB medium (1% tryptone, 0.5% yeast extract, and 0.5% sodium chloride) containing 100 ug/mL ampicillin. P. pastoris was cultivated in BMGY medium (1% yeast extract, 2% peptone, 100 mM potassium phosphate buffer (pH 6.0), 1.34% yeast nitrogen base, 4×10-5% biotin, and 1% glycerol), and BMMY medium (1% yeast extract, 2% peptone, 100 mM potassium phosphate buffer (pH 6.0), 1.34% yeast nitrogen base, 4×10-5% biotin, and 0.5-2.0% methanol).
[0082] Construction of Expression Plasmids
[0083] The gene corresponding to AGA1 as synthesized by Geneart and subcloned into pPlC3.5 (Invitrogen). The resulting vector was named pPlC3.5-AGA1 (FIG. 2). The AGA2-InaD anchor gene was synthesized by Geneart (Germany) and subcloned into expression vector pPIC6a (Invitrogen) using Bst1 and EcoR1 restriction sites. The resulting vector was named pPlC6-AGA2-InaD (FIG. 4). The fibronectin construct consists of the MFalpha1/HSA hybrid leader followed by the fibronectin fused at the C-terminus to the NorpA ligand sequence. The complete gene was synthesized by Geneart (Germany) and subcloned into pPlCHOLl-1 (Mobitec). The resulting vector was named pPlCHOLl-1 MFalpha1Hsa-Fn10-NorpA (FIG. 6).
[0084] Yeast Transformation.
[0085] Electro-competent P. pastoris GS115 (Invitrogen) strain was prepared according to the protocol specified by the supplier and co-transformed with SalI-digested pPlC3.5-AGA1, pPlC6-AGA2-InaD. and pPlCHOLl-1 MFalpha1Hsa-Fn10-NorpA.
[0086] Cultivation Conditions
[0087] The yeast transformants were precultivated in BMGY medium containing 100 ug/ml Zeocin and 200 ug/ml Blasticidin at 30° C. for 16 hr, and used to inoculate 200 ml of BMGY medium (containing 100 ug/ml Zeocin and 200 ug/ml Balsticidin) in a 1 l baffle flask to give an initial OD600 value of 0.1. After 24 hr. of cultivation, the culture was centrifuged at 1000 g for 10 min, and resuspended in BMMY medium (+100 ug/ml Zeocin and 200 ug/ml Blasticidin) containing 0.5%, 1.0%, or 2.0% methanol. To maintain the induction of the fusion proteins, 100% methanol was added every 24 hr. to the culture to the final concentrations mentioned above. Analysis of displayed fibronectins on the surface of yeast is performed using FACS and anti-myc antibody.
Example 2
Switch System to Secrete or Display Fibronectins on the Surface of Pichia pastoris
[0088] One variant of the above display system enables the choice between secretion and display of proteins from P. pastoris. To achieve this, the fibronectin construct consisting of the MFalpha1/HSA hybrid leader followed by fibronectin fused at the C-terminus to the NorpA ligand sequence is cloned into pPlCHOLl-C instead of pPlCHOLl-1. The resulting vector is named pPlCHOLl-C Mfalpha1Hsa-Fn10-NorpA (FIG. 8). The key difference between the two vectors is the promoter, which in pPlCHOLl-1 is the AOX1 promoter induced by methanol, and in the pPlCHOLl-C is the Cup1 promoter induced by copper. To display the fibronectin on the surface of P. pastoris, AGA1 and AGA2-InaD are induced with methanol, while pPlCHOL1-C is induced with copper. This allows for the capture of the secreted fibronectin on the surface of yeast mediated through the tight InaD/NorpA interaction. For secretion of the fibronectin without displaying the protein on the surface of yeast, induction with copper is sufficient. Without the induction of AGA1 and AGA2-InaD (driven by methanol) the binding partner for NorpA (AGA1/AGA2-InaD) is not present on the surface of yeast and therefore the fibronectin will be secreted.
Example 3
Yeast Display Using InaD/NorpA Interaction in Saccharomyces cerevisiae
[0089] This example describes using the InaD/NorpA system with other yeast strains such as Saccharomyces cerevisiae
[0090] Strains and Media
[0091] Escherichia coil Top10 (Invitrogen, Carlsbad, Calif.) was used as the host strain for recombinant DNA manipulation. The S. cerevisiae strain EBY100 (Invitrogen Co., Carlsbad, Calif.) was used for the production of the fusion proteins AGA2-InaD and MSalpha1/HSA-Fn10-NorpA or pYS6CT*MFalpha1-HSA-NorpA. E. coli was cultivated LB medium (1% tryptone, 0.5% yeast extract, and 0.5% sodium chloride) containing 100 u/g/mL ampicillin or 100 ug/ml Blasticidin. EBY 100 was cultivated in CM medium-URA.
[0092] Construction of Expression Plasmids
[0093] The InaD anchor gene was synthesized by Geneart (Germany) and subcloned in frame with the AGA2 anchor protein into the expression vector pYD NBC1 (derivative of pYD1Invitrogen) using HindIII and EcoRI restriction sites. The resulting vector was named pYD_NBC1 AGA2-InaD (FIG. 10). The fibronectin construct consists of the MFalpha1/HSA hybrid leader sequence followed by the fibronectin fused at its C-terminus to the NorpA ligand. The complete gene was synthesized by Geneart (Germany) and subcloned into pYS6CT (Invitrogen)), in which the origin of replication had been replaced by the CEN6/ARS4 region. The resulting vector was named pYS6CT_HSA_MFalpha.sub.1_Fn10_NorpA (FIG. 12).
[0094] Plasmids were isolated from E. coli and the sequence confirmed. The purified plasmids were then co-transformed into EBY 100 and plated out on selective media consisting of CM-TRP, +200 ug/ml Blasticidin. Transformed colonies appeared within 2 days and were tested for display of Fibronectin by FACS analysis using an anti-myc antibody (ccccc).
Example 4
Yeast Display Using Flo1-InaD/NorpA in Pichia pastoris
[0095] This example describes the use of an alternative expression system, Flo1, which is used with InaD/NorpA in Pichia pastoris.
[0096] Strains and Media
[0097] The Escherichia coil Top10 strain (Invitrogen Carlsbad, Calif.) is used as the host strain for recombinant DNA manipulation. The P. pastoris GS115 strain (Invitrogen Co., Carlsbad, Calif.) is used for the production of the fusion protein Flo1-InaD and HSA/MFalpha1-Fn10-NorpA. E. coli was cultivated in LB medium (1% tryptone, 0.5% yeast extract, and 0.5% sodium chloride) containing 100 ug/mL ampicillin. P. pastoris was cultivated in BMGY medium (1% yeast extract, 2% peptone, 100 mM potassium phosphate buffer (pH 6.0), 1.34% yeast nitrogen base, 4×10-5% biotin, and 1% glycerol), and BMMY medium (1% yeast extract, 2% peptone, 100 mM potassium phosphate buffer (pH 6.0), 1.34% yeast nitrogen base, 4×10-5% biotin, and 0.5-2.0% methanol).
[0098] Construction of Expression Plasmids
[0099] The gene for Flo1, fused at the C-terminus to the PDZ domain of InaD, is synthesized by Geneart (Germany) and cloned into pPlC3.5 (Invitrogen) using a 5' EcoR1 site and a 3'Notl site. The resulting plasmid is named pPlC3.5-Flo1-InaD. Expression of the fused protein is driven by the methanol inducible promoter AOX1. The fibronectin construct consists of the MFalpha1/HSA hybrid leader followed by the fibronectin fused at the C-terminus to the NorpA ligand sequence. The complete gene is synthesized by Geneart (German/) and subcloned into pPlCHOLl-1 (Mobitec). The resulting vector is named pP1CHOL1-1 MFalpha1Hsa-Fn10-NorpA. Expression of the fibronectin construct is driven by the methanol inducible promoter AOX1.
[0100] Yeast Transformation.
[0101] Electro-competent P. pastoris GS115 (Invitrogen) strain is prepared according to the protocol specified by the supplier and co-transformed with SalI-digested pPIC3.5-Flo1-InaD, and pPlCHOLl-1 MFalpha1 Hsa-Fn10-NorpA,
[0102] Cultivation Conditions
[0103] The yeast transformants are precultivated in BMGY medium containing 100 ug/ml Zeocin and 200 ug/ml Blasticidin at 30° C. for 16 hr. and used to inoculate 200 ml of BMGY medium (containing 100 ug/ml Zeocin and 200 ug/ml Balsticidin) in a 1 l baffle flask to give an initial OD600 value of 0.1. After 24 hr. of cultivation, the culture is centrifuged at 1000 g for 10 min. and resuspended in BMMY medium (+100 ug/ml Zeocin and 200 ug/ml Blasticidin) containing 0.5%, 1 or 2.0% methanol. To maintain the induction of the fusion proteins. 100% methanol is added every 24 hr. to the culture to the final concentrations mentioned above. Analysis of displayed fibronectins on the surface of yeast is performed using FACS and anti-myc antibody.
Example 5
Screening of a Fibronectin Library
[0104] Fibronectin Library Display
[0105] A fibronectin library is generated by methods well known in the art, including the method disclosed in U.S. Pat. No. 6,673,901. Other methods, such as use of error prone PCR, use of random priming techniques, or use of computational techniques are well known in the art and can also be used. The fibronectin library is designed with appropriate restriction enzyme cleavage sites in order to clone the library into yeast expression vectors.
[0106] The fibronectin library is displayed on a plurality of P. pastoris cells as described above in Example 1. The fibronectin library is modified to contain an MFalpha/HSA hybrid leader sequence fused to the N-terminus and a NorpA ligand sequence fused to the C-terminus. The modified fibronectin library is then cloned into the pPlCHOLl-1 vector. As in the examples above, the expression of the fibronectin library is under the control of the AOX1 promoter. P. pastoris cells are transformed with the pPlCHOLl-1 vectors expressing the fibronectin library and the vectors expressing Aga1p and Aga2p-InaD. Expression of the components is induced by the addition of methanol to the cells, and the fibronectin library is displayed on a plurality of P. pastoris cells.
[0107] Screening of Display Library
[0108] The yeast display fibronectin library is screened for binding to a target protein of interest using one of marry methods known in the an For example, the target protein is contacted with the yeast display fibronectin library under conditions that allow for the specific binding of the target protein to any members of the library. All bound target protein is no immobilized on the surface of a yeast cell. All unbound target protein is washed off. The bound target protein is fluorescently labeled by methods well known in the art, such as fluorescently labeled antibodies specific for the target protein. The labeled target protein, now immobilized on the surface of a yeast cell, is then detected using flow cytometry, i.e. FACS. Yeast cells tint bind the labeled target protein will fluoresce and are sorted from those yeast cells that do not bind the target protein. The sorted yeast cells that have bound the target protein are clonally expanded , and the clone line or line containing members of the fibronectin library that bind the target protein are determined.
[0109] Example 6
Screening of a Protein Library
[0110] Protein Library Display
[0111] A protein library is generated by methods well known in the art, such as use of error prone PCR, use of random priming techniques, or use of computational techniques. The protein library is designed with appropriate restriction enzyme cleavage sites in order to clone the library into yeast expression vectors.
[0112] The cloned protein library is displayed on a plurality of P. pastoris cells as described above in Example 1. The protein library is modified to contain an MFalpha/HSA hybrid leader sequence fused to the N-terminus and a NorpA ligand sequence fused to the C-terminus. The modified protein library is then cloned into the pPlCHOLl-1 vector. As in the examples above, the expression of the protein library is tinder the control of the AOX1 promoter. P. pastoris cells are transformed with the pPlCHOLl-1 vectors expressing the protein library and the vectors expressing Aga1p and Aga2p-InaD. Expression of the components is induced by the addition of methanol to the cells, and the protein library is displayed On a plurality of P. pastoris cells.
[0113] Screening of Display Library
[0114] The yeast display protein library is screened for binding, to a target protein of interest using one of many methods known in the art. For example, the target protein is contacted with the yeast display protein library under conditions that allow for the specific binding of the target protein to any members of the library. All bound target protein is now immobilized on the surface of a yeast cell. All unbound target protein is washed off. The bound target protein is fluorescently labeled by methods well known in the art, such as fluorescently labeled antibodies specific for the target protein. The labeled target protein, now immobilized on the surface of a yeast cell, is then detected using flow cytometry, i.e. FACS. Yeast cells that bind the labeled target protein will fluoresce and are sorted from those yeast cells that do not hind the target protein. The sorted yeast cells that have bound the target protein are clonally expanded, and the clone line or line containing members of the protein library that bind the target protein are determined.
Example 7
Screening of a Fibronectin or HSA Libraries
Fibronectin or HSA Library Display
[0115] A fibronectin or HSA library is generated by methods well known in the art, such as use of error prone PCR, use of random priming techniques, or use of computational techniques. The libraries are designed With appropriate restriction enzyme cleavage sites in order to clone the libraries into yeast expression vectors (See FIG. 8 and SEQ ID NO: 10).
[0116] The cloned fibronectin library or HSA library is displayed on a plurality of P. pastoris cells as described above in Example 1. The fibronectin library is modified to contain an MFalpha/HSA hybrid leader sequence used to the N-terminus and a NorpA ligand sequence fused to the C-terminus (pYS HSA_MFalpha1 Fn10 NorpA). The HSA library is modified to contain a MFalpha CT (C-Terminal) It is a left-over of the original Invitrogen vector used for the constructions. If you look at the vector map (e.g. FIG. 13) you can see a c-terminal v5 and 6xhis sequence of the c-terminus of the insert. I've placed a stop in front of it and it is not translated in the final displayed protein leader sequence (pYS6/CT HSA-NorpA). The modified fibronectin or HSA library is then cloned into the pYS vector. The expression of the fibronectin or HSA library is under the control of the T7 promoter. P. pastoris cells are transformed with the pYS vectors expressing the fibronectin or HSA library and the vectors expressing Aga1p and Aga2p-InaD, Expression of the components is induced by the addition of methanol to the cells., and, the fibronectin or HSA library is displayed on a plurality of P. pastoris cells.
[0117] (a) FACS Analysis of Protein Surface Expression,
[0118] Yeast cells expressing either fibronectin (pYS HSA_MFalpha1 Fn10 NorpA) or HSA (pYS6/CT HSA-NorpA) sere stained with anti-myc antibody, followed by APC labeled secondary anti-mouse antibody and then subjected to FACS analysis. The results of the analysis are shown in FIGS. 9A-E. Specifically, FIG. 9A is the control sample showing unstained yeast cells; FIG. 9B is a sample of uninduced yeast cells expressing fibronectin; FIG. 9C is a sample of induced yeast cells expressing fibronectin, showing a shift of cells compared with the uninduced cells; FIG. 9D is a sample of uninduced yeast cells expressing HSA: and FIG. 9E is a sample of induced yeast cells expressing HSA, again showing a shill of cells compared with the uninduced cells. These results clearly demonstrate that the yeast display system is able to express fibronectin molecules, and proteins, such as HSA.
[0119] b) Fluorometric Mircovolume Assay Technology (FMAT, Perkin Elmer)Analysis of Yeast Expressing Fibronectin or HSA
[0120] Yeast cells expressing either fibronectin (plasmid) or HSA (plasmid) were also analyzed by FMAT by staining with anti-myc antibody and APC labeled secondary anti-mouse antibody. The samples were then subjected to FMAT confocal fluorescence microscopy and shown in FIGS. 10A-E. Those colonies that express fibronectin or HSA appear as white dots against a black background. Specifically, FIG. 10A is the control sample showing unstained yeast cells and appears entirely black; FIG. 10B is a sample of uninduced yeast cells expressing fibronectin. The uninduced yeast cells do not produce fibronectin and are not detected (image appears black): FIG. 10C is a sample of induced yeast cells expressing fibronectin. In this instance, induction leads to the fibronectin with a myc tag being expressed and detected using the anti-myc antibody. Subsequent detection with the APC secondary anti-mouse antibody and FMAT confocal fluorescence microscopy results in visible white colonies being detected. FIG. 10D is a sample of uninduced yeast cells expressing HSA, as before the uninduced yeast cells do not produce fibronectin and the image appears black; and FIG. 10E is a sample of induced yeast cells expressing HSA, again showing small white colonies compared with the uninduced cells. These results further confirm that the yeast display system is able to express fibronectin molecule and proteins, such as HSA.
Example 8
Screening of Single Chain Fv Libraries
Single Chain Fv Library Display
[0121] A single chain scFv library is generated by methods well known in the art, such as use of error prone PCR, use of random priming techniques, or use of computational techniques. The libraries are designed with appropriate restriction enzyme cleavage sites in order to clone the libraries into yeast expression vectors (See FIG. II and SEQ ID NO 11).
[0122] The cloned scFv lysozyme library is displayed on a plurality of P. pastoris cells as described above in Example 1. The scFv library is modified to contain an MFalpha leader sequence fused to the N-terminus and a NorpA ligand sequence fused to the C-terminus (pYS6/C.T* MFalpha1-scFv lysozyme-NorpA). The modified scFv lysozyme library is then cloned into the pYS vector. The expression of the scFv lysozyme is under the control of the 17 promoter. P. pastoris cells are transformed with the pYS vectors expressing the scFv lysozyme library and the vectors expressing Aga1p and Aga2p-InaD. Expression of the components is induced by the addition of methanol to the cells, and the fibronectin or HSA library is displayed on a plurality of P. pastoris cells.
[0123] (a) FACS Analysis of Protein Surface Expression.
[0124] Yeast cells expressing the scFv lysozyme were stained with anti-myc antibody, followed by APC labeled secondary anti-mouse antibody and then subjected to FACS analysis.
[0125] (b) FMAT Analysis of Yeast Expressing Fibronectin or HSA
[0126] Yeast cells expressing the scFv lysozyme were also analyzed by FMAT by staining with anti-myc antibody and APC labeled secondary anti-mouse antibody. The samples were then subjected to FMAT confocal fluorescence microscopy.
Example 9
Screening of Protein Libraries with a Reverse System
Protein Library Display
[0127] In the Example, the yeast display system described herein is reversed such that NorpA is fused to Aga2 and the InaD is fused to Aga1. A protein library is generated by methods well known in the art, such as use of error prone PCR, use of random priming techniques, or use of computational techniques. The libraries are designed with appropriate restriction enzyme cleavage sites in order to clone the libraries into yeast expression vectors (See FIGS. 12 and 13 and SEQ ID NOs: 12 and 13).
[0128] The protein display system for P. pastoris was developed to display a fibronectin type III domain (Fn10), by fusing a leader sequence (MFalpha1)at N-terminus of InaD and fusing the Fn10 to its C-terminus. One expressed, the Fn10 was secreted from the cell and the PDZ domain of InaD bound to the NorpA ligand through disulfide bonds. The NorpA as fused to the C-terminus of the Agap2 protein. The Aga2p-NorpA fusion protein served as the adapter protein, and the N--terminal Aga2p bound Aga1p, which was immobilized on the surface of the cell. Aga2p bound specifically to Aga1p through disulfide bonds.
[0129] The three component system consisting of the Aga2p-NorpA fusion protein, the Aga1-InaD fusion protein, and the Aga1p cell surface protein were cloned into pPD and pYS expression vectors respectively, under the control of a Gal inducible promoter.
[0130] The inducible promoter used was the Gal1 promoter, which is induced by galactose. Thus when galactose was added to yeast cells transformed with the vectors, the three proteins were expressed. Aga1p as expressed on the surface of the cell. Aga2p-NorpA as localized to the cell surface where the N-terminal region of Aga2p-NorpA bound to Aga1p. Fn10-InaD was localized to the secretory pathway, Was secreted front the cell, and bound NorpA via the C-terminal InaD ligand.
TABLE-US-00001 pPIC3.5 AGA1 (956 bp-31336 bp, direct) 242aa (SEQ ID NO 2) MTLSFAHFTY LFTILLGLTN IALASDPETI LVTITKTNDA NGVVTTTVSP ALVSTSTIVQ AGTTTLYTTW CPLTVSTSSA AEISPSISYA TTLSRFSTLT LSTEVCSHEA CPSSSTLPTT TLSVTSKFTS YICPTCHTTA ISSLSEVGTT TVVSSSAIEP SSASIISPVT STLSSTTSSN PTTTSLSSTS TSPSSTSTSP SSTSTSSSST STSSSSTSTS SSSTSTSPSS TSTSSSLTST SSSSTSTSQS STSTSSSSTS TSPSSTSTSS SSTSTSPSSK STSASSTSTS SYSTSTSPSL TSSSPTLAST SPSSTSISST FTDSTSSLGS SIASSSTSVS LYSPSTPVYS VPSTSSNVAT PSMTSSTVET TVSSQSSSEY ITKSSISTTI PSFSMSTYFT TVSGVTTMYT TWCPYSSESE TSTLTSMHET VTTDATVCTH ESCMPSQTTS LITSSIKMST KNVATSVSTS TVESSYACST CAETSHSYSS VQTASSSSVT QQTTSTKSWV SSMTTSDEDF NKHATGKYHV TSSGTSTIST SVSEATSTSS IDSESQEQSS HLLSTSVLSS SSLSATLSSD STILLFSSVS SLSVEQSPVT TLQISSTSEI LQPTSSTAIA TISASTSSLS ATSISTPSTS VESTIESSSL TPTVSSIFLS SSSAPSSLQT SVTTTEVSTT SISIQYQTSS MVTISQYMGS GSQTRLPLGK LVFAIMAVAC NVIFS pPIC6 A AGA2-InaD (941 bp-1648 bp, direct) 78aa (SEQ ID NO: 3) MQLLRCFSIF SVIASVLAQE LTTICEQIPS PTLESTPYSL STTTILANGK AMQGVFEYYK SVTFVSNCGS HPSTTSKGSP INTQYVFKLL QASGGGGSGG GGSGGGGSAS MTGGQQMGRE NLYFQGVPGS SVVSRAGELI HMVTLDKTGK KSFGICIVRG EVKDSPNTKT TGIFIKGIVP DSPAHLCGRL KVGDRILSLN GKDVRNSTEQ AVIDLIKEAD FKIELEIQTF DK pPICHOLI-1_MFalpha1Hsa-Fn10-NorpA (884 bp-1441 bp, direct) 62aa (SEQ ID NO 4) MKWVSFISLL FLFSSAYSRS LDKRENLYFQ GGSVSDVPRD LEVVAATPTS LLISWDAPAV TVRYYRITYG ETGGNSPVQE FTVPGSKSTA TISGLKPGVD YTITVYAVTG RGDSPASSKP ISINYRTEFE NLYFQGSGGG GEQKLISEED LHHHHHHPST PPTPSPSTPP TPSPSYKTQG KTEFCA pPICHOL1-C Mfalpha1Hsa-Fn10-NorpA (691 bp-1248 bp, direct) 62aa (SEQ ID NO: 5) MXWVSFISLL FLFSSAYSRS LDKRENLYFQ GGSVSDVPRD LEVVAATPTS LLISWDAPAV TVRYYRITYG ETGGNSPVQE FTVPGSKSTA TISGLKPGVD YTITVYAVTG RGDSPASSKP ISINYRTEFE NLYFQGSGGG GEQKLISEED LHHHHHHPST PPTPSPSTPP TPSPSYKTQG KTEFCA pYD_NBC1_Aga2-InaD (534 bp-1235 bp, direct) 78aa (SEQ. ID NO: 6) MQLLRCFSIF SVIASVLAQE LTTICEQIPS PTLESTPYSL STTTILANGK AMQGVFEYYK SVTFVSNCGS HPSTTSKGSP INTQYVFKLL QASGGGGSGG GGSGGGGSAS MTGGQQMGRE NLYFQGVPGS SVVSRAGELI HMVTLDKTGK KSFGICIVRG EVKDSPNTKT TGIFIKGIVP DSPAHLCGRL KVGDRILSLN GKDVRNSTEQ AVIDLIKEAD FKIELEIQTF DK pYS6/CT_HSA _MFalpha1_Fn10_NorpA (513 bp-1080 bp, direct) 63aa (SEQ ID NO: 7) MKWVSFISLL FLFSSAYSRS LDKRENLYFQ GGSVSDVPRD LEVVAATPTS LLISWDAPAV TVRYYRITYG ETGGNSPVQE FTVPGSKSTA TISGLKPGVD YTITVYAVTG RGDSPASSKP ISINYRTEFE NLYFQGSGGG GEQKLISEED LHHHHHHPST PPTPSPSTPP TPSPSYNTQG KTEFCA InaD PDZ domain amino acid sequence (InaD as 11-107) (SEQ ID NO 8) AGELIHMVTL DKTGKKSFGI CIVRGEVKDS PNTKTTGIFI KGIVPDSPAH LCGRLKVGDR ILSLNGKDVR NSTEQAVIDL IKEADFKIEL EIQTFDK NorpA C-terminal 11 amino acids including EFCA motif (SEQ ID NO: 9) YKTQGKTEFC A pYS6/CT* MFalpha HSA-NorpA (SEQ ID NO: 10) MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFDVAVLPFSNST NNGLLFINTTIASIAAKEEGVSLEKREAEAASDAHKSEVAERFKDLGEENFKALVLIAF AQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGE MADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARR HPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQ KFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKY ICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEA KDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLV EEPQNLIKQNCELFEQLGEYKPQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKH PEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVP KEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKC CKADDKETCFAEEGKKLVAASQAALGLGSENLYFQGSGGGGEQKLISEEDLHHHHHHHH PSTPPTPSPSTPPTPSPSYKTQGKTEFCA. pYS6/CT* MFalpha1-scFv lysozyme-NorpA (SEQ ID NO 11) MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFDVAVLPFSNS TNNGLLFINTTIASIAAKEEGVSLEKREAEAASQVKLQQSGAELVKPGASVKLSCTASG FNIKDTYMHWVKQRPEQGLEWIGRIDPANGNTKYDPKFQGKATITADTSSNTAYLQLSS LTSEDTAVYYCARWDWYFDVWGQGTTVTVSSGGGGSGGGGSGGGGSDIELTQSPSSMYT SLGERVTITCKASQDINSYLRWFQQKPGKSPKTLIYYATSLADGVPSRFSGSGSGQDYS LTISSLESDDTTTYYCLQHGESPYTEGGGTKLEIKRAAAEQKLISEEDLNGSENLYFQG SGGGGEQKLISEEDLHHHHHHHHPSTPPTPSPSTPPTPSPSYKTQGKTEFCA pYD_NBC1_Aga2-NorpA (SEQ ID NO: 12) MQLLRCFSIFSVIASVLAQELTTICEQIPSPTLESTPYSLSTTTILANGKAMQGVFEYY KSVTFVSNCGSHPSTTSKGSPINTQYVFKLLQASGGGGSGGGGSYKTQGKTEFCA pYS6/Cf* MFalpha1-InaD-Fn10 (507 bp-1487 bp, direct) 109aa (SEQ ID NO: 13) MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFDVAVLPFSNST NNGLLFINTTIASIAAKEEGVSLEKREAEAASAGELIHMVTLDKTGKKSFGICIVRGEV KDSPNTKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADF KIELEIQTFDKSGGGGEQKLISEEDLHHHHHHPSTPPTPSPSTPPTPSPENLYFQGVSD VPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGL KPGVDYTITVYAVTGRGDSPASSKPISINYRT
Sequence CWU
1
13124PRTArtificial SequenceSaccharomyces cerevisiae 1Met Leu Leu Gln Ala
Phe Leu Phe Leu Leu Ala Gly Phe Ala Ala Lys1 5
10 15Ile Ser Ala Asp Ala His Lys Ser
202725PRTArtificial SequencepPIC3.5 AGA1 2Met Thr Leu Ser Phe Ala His Phe
Thr Tyr Leu Phe Thr Ile Leu Leu1 5 10
15Gly Leu Thr Asn Ile Ala Leu Ala Ser Asp Pro Glu Thr Ile
Leu Val 20 25 30Thr Ile Thr
Lys Thr Asn Asp Ala Asn Gly Val Val Thr Thr Thr Val 35
40 45Ser Pro Ala Leu Val Ser Thr Ser Thr Ile Val
Gln Ala Gly Thr Thr 50 55 60Thr Leu
Tyr Thr Thr Trp Cys Pro Leu Thr Val Ser Thr Ser Ser Ala65
70 75 80Ala Glu Ile Ser Pro Ser Ile
Ser Tyr Ala Thr Thr Leu Ser Arg Phe 85 90
95Ser Thr Leu Thr Leu Ser Thr Glu Val Cys Ser His Glu
Ala Cys Pro 100 105 110Ser Ser
Ser Thr Leu Pro Thr Thr Thr Leu Ser Val Thr Ser Lys Phe 115
120 125Thr Ser Tyr Ile Cys Pro Thr Cys His Thr
Thr Ala Ile Ser Ser Leu 130 135 140Ser
Glu Val Gly Thr Thr Thr Val Val Ser Ser Ser Ala Ile Glu Pro145
150 155 160Ser Ser Ala Ser Ile Ile
Ser Pro Val Thr Ser Thr Leu Ser Ser Thr 165
170 175Thr Ser Ser Asn Pro Thr Thr Thr Ser Leu Ser Ser
Thr Ser Thr Ser 180 185 190Pro
Ser Ser Thr Ser Thr Ser Pro Ser Ser Thr Ser Thr Ser Ser Ser 195
200 205Ser Thr Ser Thr Ser Ser Ser Ser Thr
Ser Thr Ser Ser Ser Ser Thr 210 215
220Ser Thr Ser Pro Ser Ser Thr Ser Thr Ser Ser Ser Leu Thr Ser Thr225
230 235 240Ser Ser Ser Ser
Thr Ser Thr Ser Gln Ser Ser Thr Ser Thr Ser Ser 245
250 255Ser Ser Thr Ser Thr Ser Pro Ser Ser Thr
Ser Thr Ser Ser Ser Ser 260 265
270Thr Ser Thr Ser Pro Ser Ser Lys Ser Thr Ser Ala Ser Ser Thr Ser
275 280 285Thr Ser Ser Tyr Ser Thr Ser
Thr Ser Pro Ser Leu Thr Ser Ser Ser 290 295
300Pro Thr Leu Ala Ser Thr Ser Pro Ser Ser Thr Ser Ile Ser Ser
Thr305 310 315 320Phe Thr
Asp Ser Thr Ser Ser Leu Gly Ser Ser Ile Ala Ser Ser Ser
325 330 335Thr Ser Val Ser Leu Tyr Ser
Pro Ser Thr Pro Val Tyr Ser Val Pro 340 345
350Ser Thr Ser Ser Asn Val Ala Thr Pro Ser Met Thr Ser Ser
Thr Val 355 360 365Glu Thr Thr Val
Ser Ser Gln Ser Ser Ser Glu Tyr Ile Thr Lys Ser 370
375 380Ser Ile Ser Thr Thr Ile Pro Ser Phe Ser Met Ser
Thr Tyr Phe Thr385 390 395
400Thr Val Ser Gly Val Thr Thr Met Tyr Thr Thr Trp Cys Pro Tyr Ser
405 410 415Ser Glu Ser Glu Thr
Ser Thr Leu Thr Ser Met His Glu Thr Val Thr 420
425 430Thr Asp Ala Thr Val Cys Thr His Glu Ser Cys Met
Pro Ser Gln Thr 435 440 445Thr Ser
Leu Ile Thr Ser Ser Ile Lys Met Ser Thr Lys Asn Val Ala 450
455 460Thr Ser Val Ser Thr Ser Thr Val Glu Ser Ser
Tyr Ala Cys Ser Thr465 470 475
480Cys Ala Glu Thr Ser His Ser Tyr Ser Ser Val Gln Thr Ala Ser Ser
485 490 495Ser Ser Val Thr
Gln Gln Thr Thr Ser Thr Lys Ser Trp Val Ser Ser 500
505 510Met Thr Thr Ser Asp Glu Asp Phe Asn Lys His
Ala Thr Gly Lys Tyr 515 520 525His
Val Thr Ser Ser Gly Thr Ser Thr Ile Ser Thr Ser Val Ser Glu 530
535 540Ala Thr Ser Thr Ser Ser Ile Asp Ser Glu
Ser Gln Glu Gln Ser Ser545 550 555
560His Leu Leu Ser Thr Ser Val Leu Ser Ser Ser Ser Leu Ser Ala
Thr 565 570 575Leu Ser Ser
Asp Ser Thr Ile Leu Leu Phe Ser Ser Val Ser Ser Leu 580
585 590Ser Val Glu Gln Ser Pro Val Thr Thr Leu
Gln Ile Ser Ser Thr Ser 595 600
605Glu Ile Leu Gln Pro Thr Ser Ser Thr Ala Ile Ala Thr Ile Ser Ala 610
615 620Ser Thr Ser Ser Leu Ser Ala Thr
Ser Ile Ser Thr Pro Ser Thr Ser625 630
635 640Val Glu Ser Thr Ile Glu Ser Ser Ser Leu Thr Pro
Thr Val Ser Ser 645 650
655Ile Phe Leu Ser Ser Ser Ser Ala Pro Ser Ser Leu Gln Thr Ser Val
660 665 670Thr Thr Thr Glu Val Ser
Thr Thr Ser Ile Ser Ile Gln Tyr Gln Thr 675 680
685Ser Ser Met Val Thr Ile Ser Gln Tyr Met Gly Ser Gly Ser
Gln Thr 690 695 700Arg Leu Pro Leu Gly
Lys Leu Val Phe Ala Ile Met Ala Val Ala Cys705 710
715 720Asn Val Ile Phe Ser
7253232PRTArtificial SequencepPIC6 A AGA2-InaD 3Met Gln Leu Leu Arg Cys
Phe Ser Ile Phe Ser Val Ile Ala Ser Val1 5
10 15Leu Ala Gln Glu Leu Thr Thr Ile Cys Glu Gln Ile
Pro Ser Pro Thr 20 25 30Leu
Glu Ser Thr Pro Tyr Ser Leu Ser Thr Thr Thr Ile Leu Ala Asn 35
40 45Gly Lys Ala Met Gln Gly Val Phe Glu
Tyr Tyr Lys Ser Val Thr Phe 50 55
60Val Ser Asn Cys Gly Ser His Pro Ser Thr Thr Ser Lys Gly Ser Pro65
70 75 80Ile Asn Thr Gln Tyr
Val Phe Lys Leu Leu Gln Ala Ser Gly Gly Gly 85
90 95Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
Ser Ala Ser Met Thr 100 105
110Gly Gly Gln Gln Met Gly Arg Glu Asn Leu Tyr Phe Gln Gly Val Pro
115 120 125Gly Ser Ser Val Val Ser Arg
Ala Gly Glu Leu Ile His Met Val Thr 130 135
140Leu Asp Lys Thr Gly Lys Lys Ser Phe Gly Ile Cys Ile Val Arg
Gly145 150 155 160Glu Val
Lys Asp Ser Pro Asn Thr Lys Thr Thr Gly Ile Phe Ile Lys
165 170 175Gly Ile Val Pro Asp Ser Pro
Ala His Leu Cys Gly Arg Leu Lys Val 180 185
190Gly Asp Arg Ile Leu Ser Leu Asn Gly Lys Asp Val Arg Asn
Ser Thr 195 200 205Glu Gln Ala Val
Ile Asp Leu Ile Lys Glu Ala Asp Phe Lys Ile Glu 210
215 220Leu Glu Ile Gln Thr Phe Asp Lys225
2304186PRTArtificial SequencepPICHOLI-1_MFalpha1Hsa-Fn10-NorpA 4Met Lys
Trp Val Ser Phe Ile Ser Leu Leu Phe Leu Phe Ser Ser Ala1 5
10 15Tyr Ser Arg Ser Leu Asp Lys Arg
Glu Asn Leu Tyr Phe Gln Gly Gly 20 25
30Ser Val Ser Asp Val Pro Arg Asp Leu Glu Val Val Ala Ala Thr
Pro 35 40 45Thr Ser Leu Leu Ile
Ser Trp Asp Ala Pro Ala Val Thr Val Arg Tyr 50 55
60Tyr Arg Ile Thr Tyr Gly Glu Thr Gly Gly Asn Ser Pro Val
Gln Glu65 70 75 80Phe
Thr Val Pro Gly Ser Lys Ser Thr Ala Thr Ile Ser Gly Leu Lys
85 90 95Pro Gly Val Asp Tyr Thr Ile
Thr Val Tyr Ala Val Thr Gly Arg Gly 100 105
110Asp Ser Pro Ala Ser Ser Lys Pro Ile Ser Ile Asn Tyr Arg
Thr Glu 115 120 125Phe Glu Asn Leu
Tyr Phe Gln Gly Ser Gly Gly Gly Gly Glu Gln Lys 130
135 140Leu Ile Ser Glu Glu Asp Leu His His His His His
His Pro Ser Thr145 150 155
160Pro Pro Thr Pro Ser Pro Ser Thr Pro Pro Thr Pro Ser Pro Ser Tyr
165 170 175Lys Thr Gln Gly Lys
Thr Glu Phe Cys Ala 180 1855186PRTArtificial
SequencepPICHOLI-C Mfalpha1Hsa-Fn10-NorpA 5Met Lys Trp Val Ser Phe Ile
Ser Leu Leu Phe Leu Phe Ser Ser Ala1 5 10
15Tyr Ser Arg Ser Leu Asp Lys Arg Glu Asn Leu Tyr Phe
Gln Gly Gly 20 25 30Ser Val
Ser Asp Val Pro Arg Asp Leu Glu Val Val Ala Ala Thr Pro 35
40 45Thr Ser Leu Leu Ile Ser Trp Asp Ala Pro
Ala Val Thr Val Arg Tyr 50 55 60Tyr
Arg Ile Thr Tyr Gly Glu Thr Gly Gly Asn Ser Pro Val Gln Glu65
70 75 80Phe Thr Val Pro Gly Ser
Lys Ser Thr Ala Thr Ile Ser Gly Leu Lys 85
90 95Pro Gly Val Asp Tyr Thr Ile Thr Val Tyr Ala Val
Thr Gly Arg Gly 100 105 110Asp
Ser Pro Ala Ser Ser Lys Pro Ile Ser Ile Asn Tyr Arg Thr Glu 115
120 125Phe Glu Asn Leu Tyr Phe Gln Gly Ser
Gly Gly Gly Gly Glu Gln Lys 130 135
140Leu Ile Ser Glu Glu Asp Leu His His His His His His Pro Ser Thr145
150 155 160Pro Pro Thr Pro
Ser Pro Ser Thr Pro Pro Thr Pro Ser Pro Ser Tyr 165
170 175Lys Thr Gln Gly Lys Thr Glu Phe Cys Ala
180 1856232PRTArtificial
SequencepYD_NBC1_Aga2-InaD 6Met Gln Leu Leu Arg Cys Phe Ser Ile Phe Ser
Val Ile Ala Ser Val1 5 10
15Leu Ala Gln Glu Leu Thr Thr Ile Cys Glu Gln Ile Pro Ser Pro Thr
20 25 30Leu Glu Ser Thr Pro Tyr Ser
Leu Ser Thr Thr Thr Ile Leu Ala Asn 35 40
45Gly Lys Ala Met Gln Gly Val Phe Glu Tyr Tyr Lys Ser Val Thr
Phe 50 55 60Val Ser Asn Cys Gly Ser
His Pro Ser Thr Thr Ser Lys Gly Ser Pro65 70
75 80Ile Asn Thr Gln Tyr Val Phe Lys Leu Leu Gln
Ala Ser Gly Gly Gly 85 90
95Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Ala Ser Met Thr
100 105 110Gly Gly Gln Gln Met Gly
Arg Glu Asn Leu Tyr Phe Gln Gly Val Pro 115 120
125Gly Ser Ser Val Val Ser Arg Ala Gly Glu Leu Ile His Met
Val Thr 130 135 140Leu Asp Lys Thr Gly
Lys Lys Ser Phe Gly Ile Cys Ile Val Arg Gly145 150
155 160Glu Val Lys Asp Ser Pro Asn Thr Lys Thr
Thr Gly Ile Phe Ile Lys 165 170
175Gly Ile Val Pro Asp Ser Pro Ala His Leu Cys Gly Arg Leu Lys Val
180 185 190Gly Asp Arg Ile Leu
Ser Leu Asn Gly Lys Asp Val Arg Asn Ser Thr 195
200 205Glu Gln Ala Val Ile Asp Leu Ile Lys Glu Ala Asp
Phe Lys Ile Glu 210 215 220Leu Glu Ile
Gln Thr Phe Asp Lys225 2307186PRTArtificial
SequencepYS6/CT_HSA_MFalpha1_Fn10_NorpA 7Met Lys Trp Val Ser Phe Ile Ser
Leu Leu Phe Leu Phe Ser Ser Ala1 5 10
15Tyr Ser Arg Ser Leu Asp Lys Arg Glu Asn Leu Tyr Phe Gln
Gly Gly 20 25 30Ser Val Ser
Asp Val Pro Arg Asp Leu Glu Val Val Ala Ala Thr Pro 35
40 45Thr Ser Leu Leu Ile Ser Trp Asp Ala Pro Ala
Val Thr Val Arg Tyr 50 55 60Tyr Arg
Ile Thr Tyr Gly Glu Thr Gly Gly Asn Ser Pro Val Gln Glu65
70 75 80Phe Thr Val Pro Gly Ser Lys
Ser Thr Ala Thr Ile Ser Gly Leu Lys 85 90
95Pro Gly Val Asp Tyr Thr Ile Thr Val Tyr Ala Val Thr
Gly Arg Gly 100 105 110Asp Ser
Pro Ala Ser Ser Lys Pro Ile Ser Ile Asn Tyr Arg Thr Glu 115
120 125Phe Glu Asn Leu Tyr Phe Gln Gly Ser Gly
Gly Gly Gly Glu Gln Lys 130 135 140Leu
Ile Ser Glu Glu Asp Leu His His His His His His Pro Ser Thr145
150 155 160Pro Pro Thr Pro Ser Pro
Ser Thr Pro Pro Thr Pro Ser Pro Ser Tyr 165
170 175Lys Thr Gln Gly Lys Thr Glu Phe Cys Ala
180 185897PRTUnknownInaD PDZ domain amino acid sequence
8Ala Gly Glu Leu Ile His Met Val Thr Leu Asp Lys Thr Gly Lys Lys1
5 10 15Ser Phe Gly Ile Cys Ile
Val Arg Gly Glu Val Lys Asp Ser Pro Asn 20 25
30Thr Lys Thr Thr Gly Ile Phe Ile Lys Gly Ile Val Pro
Asp Ser Pro 35 40 45Ala His Leu
Cys Gly Arg Leu Lys Val Gly Asp Arg Ile Leu Ser Leu 50
55 60Asn Gly Lys Asp Val Arg Asn Ser Thr Glu Gln Ala
Val Ile Asp Leu65 70 75
80Ile Lys Glu Ala Asp Phe Lys Ile Glu Leu Glu Ile Gln Thr Phe Asp
85 90 95Lys911PRTUnknownNorpA
C-terminal 9Tyr Lys Thr Gln Gly Lys Thr Glu Phe Cys Ala1 5
1010737PRTArtificial SequencepYS6/CT* MFalpha HSA-NorpA
10Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1
5 10 15Ala Leu Ala Ala Pro Val
Asn Thr Thr Thr Glu Asp Glu Thr Ala Gln 20 25
30Ile Pro Ala Glu Ala Val Ile Gly Tyr Ser Asp Leu Glu
Gly Asp Phe 35 40 45Asp Val Ala
Val Leu Pro Phe Ser Asn Ser Thr Asn Asn Gly Leu Leu 50
55 60Phe Ile Asn Thr Thr Ile Ala Ser Ile Ala Ala Lys
Glu Glu Gly Val65 70 75
80Ser Leu Glu Lys Arg Glu Ala Glu Ala Ala Ser Asp Ala His Lys Ser
85 90 95Glu Val Ala His Arg Phe
Lys Asp Leu Gly Glu Glu Asn Phe Lys Ala 100
105 110Leu Val Leu Ile Ala Phe Ala Gln Tyr Leu Gln Gln
Cys Pro Phe Glu 115 120 125Asp His
Val Lys Leu Val Asn Glu Val Thr Glu Phe Ala Lys Thr Cys 130
135 140Val Ala Asp Glu Ser Ala Glu Asn Cys Asp Lys
Ser Leu His Thr Leu145 150 155
160Phe Gly Asp Lys Leu Cys Thr Val Ala Thr Leu Arg Glu Thr Tyr Gly
165 170 175Glu Met Ala Asp
Cys Cys Ala Lys Gln Glu Pro Glu Arg Asn Glu Cys 180
185 190Phe Leu Gln His Lys Asp Asp Asn Pro Asn Leu
Pro Arg Leu Val Arg 195 200 205Pro
Glu Val Asp Val Met Cys Thr Ala Phe His Asp Asn Glu Glu Thr 210
215 220Phe Leu Lys Lys Tyr Leu Tyr Glu Ile Ala
Arg Arg His Pro Tyr Phe225 230 235
240Tyr Ala Pro Glu Leu Leu Phe Phe Ala Lys Arg Tyr Lys Ala Ala
Phe 245 250 255Thr Glu Cys
Cys Gln Ala Ala Asp Lys Ala Ala Cys Leu Leu Pro Lys 260
265 270Leu Asp Glu Leu Arg Asp Glu Gly Lys Ala
Ser Ser Ala Lys Gln Arg 275 280
285Leu Lys Cys Ala Ser Leu Gln Lys Phe Gly Glu Arg Ala Phe Lys Ala 290
295 300Trp Ala Val Ala Arg Leu Ser Gln
Arg Phe Pro Lys Ala Glu Phe Ala305 310
315 320Glu Val Ser Lys Leu Val Thr Asp Leu Thr Lys Val
His Thr Glu Cys 325 330
335Cys His Gly Asp Leu Leu Glu Cys Ala Asp Asp Arg Ala Asp Leu Ala
340 345 350Lys Tyr Ile Cys Glu Asn
Gln Asp Ser Ile Ser Ser Lys Leu Lys Glu 355 360
365Cys Cys Glu Lys Pro Leu Leu Glu Lys Ser His Cys Ile Ala
Glu Val 370 375 380Glu Asn Asp Glu Met
Pro Ala Asp Leu Pro Ser Leu Ala Ala Asp Phe385 390
395 400Val Glu Ser Lys Asp Val Cys Lys Asn Tyr
Ala Glu Ala Lys Asp Val 405 410
415Phe Leu Gly Met Phe Leu Tyr Glu Tyr Ala Arg Arg His Pro Asp Tyr
420 425 430Ser Val Val Leu Leu
Leu Arg Leu Ala Lys Thr Tyr Glu Thr Thr Leu 435
440 445Glu Lys Cys Cys Ala Ala Ala Asp Pro His Glu Cys
Tyr Ala Lys Val 450 455 460Phe Asp Glu
Phe Lys Pro Leu Val Glu Glu Pro Gln Asn Leu Ile Lys465
470 475 480Gln Asn Cys Glu Leu Phe Glu
Gln Leu Gly Glu Tyr Lys Phe Gln Asn 485
490 495Ala Leu Leu Val Arg Tyr Thr Lys Lys Val Pro Gln
Val Ser Thr Pro 500 505 510Thr
Leu Val Glu Val Ser Arg Asn Leu Gly Lys Val Gly Ser Lys Cys 515
520 525Cys Lys His Pro Glu Ala Lys Arg Met
Pro Cys Ala Glu Asp Tyr Leu 530 535
540Ser Val Val Leu Asn Gln Leu Cys Val Leu His Glu Lys Thr Pro Val545
550 555 560Ser Asp Arg Val
Thr Lys Cys Cys Thr Glu Ser Leu Val Asn Arg Arg 565
570 575Pro Cys Phe Ser Ala Leu Glu Val Asp Glu
Thr Tyr Val Pro Lys Glu 580 585
590Phe Asn Ala Glu Thr Phe Thr Phe His Ala Asp Ile Cys Thr Leu Ser
595 600 605Glu Lys Glu Arg Gln Ile Lys
Lys Gln Thr Ala Leu Val Glu Leu Val 610 615
620Lys His Lys Pro Lys Ala Thr Lys Glu Gln Leu Lys Ala Val Met
Asp625 630 635 640Asp Phe
Ala Ala Phe Val Glu Lys Cys Cys Lys Ala Asp Asp Lys Glu
645 650 655Thr Cys Phe Ala Glu Glu Gly
Lys Lys Leu Val Ala Ala Ser Gln Ala 660 665
670Ala Leu Gly Leu Gly Ser Glu Asn Leu Tyr Phe Gln Gly Ser
Gly Gly 675 680 685Gly Gly Glu Gln
Lys Leu Ile Ser Glu Glu Asp Leu His His His His 690
695 700His His His His Pro Ser Thr Pro Pro Thr Pro Ser
Pro Ser Thr Pro705 710 715
720Pro Thr Pro Ser Pro Ser Tyr Lys Thr Gln Gly Lys Thr Glu Phe Cys
725 730 735Ala11405PRTArtificial
SequencepYS6/CT* MFalpha1-scFv lysozyme-NorpA 11Met Arg Phe Pro Ser Ile
Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5
10 15Ala Leu Ala Ala Pro Val Asn Thr Thr Thr Glu Asp
Glu Thr Ala Gln 20 25 30Ile
Pro Ala Glu Ala Val Ile Gly Tyr Ser Asp Leu Glu Gly Asp Phe 35
40 45Asp Val Ala Val Leu Pro Phe Ser Asn
Ser Thr Asn Asn Gly Leu Leu 50 55
60Phe Ile Asn Thr Thr Ile Ala Ser Ile Ala Ala Lys Glu Glu Gly Val65
70 75 80Ser Leu Glu Lys Arg
Glu Ala Glu Ala Ala Ser Gln Val Lys Leu Gln 85
90 95Gln Ser Gly Ala Glu Leu Val Lys Pro Gly Ala
Ser Val Lys Leu Ser 100 105
110Cys Thr Ala Ser Gly Phe Asn Ile Lys Asp Thr Tyr Met His Trp Val
115 120 125Lys Gln Arg Pro Glu Gln Gly
Leu Glu Trp Ile Gly Arg Ile Asp Pro 130 135
140Ala Asn Gly Asn Thr Lys Tyr Asp Pro Lys Phe Gln Gly Lys Ala
Thr145 150 155 160Ile Thr
Ala Asp Thr Ser Ser Asn Thr Ala Tyr Leu Gln Leu Ser Ser
165 170 175Leu Thr Ser Glu Asp Thr Ala
Val Tyr Tyr Cys Ala Arg Trp Asp Trp 180 185
190Tyr Phe Asp Val Trp Gly Gln Gly Thr Thr Val Thr Val Ser
Ser Gly 195 200 205Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Ile 210
215 220Glu Leu Thr Gln Ser Pro Ser Ser Met Tyr Thr Ser
Leu Gly Glu Arg225 230 235
240Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asn Ser Tyr Leu Arg
245 250 255Trp Phe Gln Gln Lys
Pro Gly Lys Ser Pro Lys Thr Leu Ile Tyr Tyr 260
265 270Ala Thr Ser Leu Ala Asp Gly Val Pro Ser Arg Phe
Ser Gly Ser Gly 275 280 285Ser Gly
Gln Asp Tyr Ser Leu Thr Ile Ser Ser Leu Glu Ser Asp Asp 290
295 300Thr Thr Thr Tyr Tyr Cys Leu Gln His Gly Glu
Ser Pro Tyr Thr Phe305 310 315
320Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Ala Ala Glu Gln Lys
325 330 335Leu Ile Ser Glu
Glu Asp Leu Asn Gly Ser Glu Asn Leu Tyr Phe Gln 340
345 350Gly Ser Gly Gly Gly Gly Glu Gln Lys Leu Ile
Ser Glu Glu Asp Leu 355 360 365His
His His His His His His His Pro Ser Thr Pro Pro Thr Pro Ser 370
375 380Pro Ser Thr Pro Pro Thr Pro Ser Pro Ser
Tyr Lys Thr Gln Gly Lys385 390 395
400Thr Glu Phe Cys Ala 40512114PRTArtificial
SequencepYD_NBC1_Aga2-NorpA 12Met Gln Leu Leu Arg Cys Phe Ser Ile Phe Ser
Val Ile Ala Ser Val1 5 10
15Leu Ala Gln Glu Leu Thr Thr Ile Cys Glu Gln Ile Pro Ser Pro Thr
20 25 30Leu Glu Ser Thr Pro Tyr Ser
Leu Ser Thr Thr Thr Ile Leu Ala Asn 35 40
45Gly Lys Ala Met Gln Gly Val Phe Glu Tyr Tyr Lys Ser Val Thr
Phe 50 55 60Val Ser Asn Cys Gly Ser
His Pro Ser Thr Thr Ser Lys Gly Ser Pro65 70
75 80Ile Asn Thr Gln Tyr Val Phe Lys Leu Leu Gln
Ala Ser Gly Gly Gly 85 90
95Gly Ser Gly Gly Gly Gly Ser Tyr Lys Thr Gln Gly Lys Thr Glu Phe
100 105 110Cys Ala13327PRTArtificial
SequencepYS6/CT* MFalpha1-InaD-Fn10 13Met Arg Phe Pro Ser Ile Phe Thr Ala
Val Leu Phe Ala Ala Ser Ser1 5 10
15Ala Leu Ala Ala Pro Val Asn Thr Thr Thr Glu Asp Glu Thr Ala
Gln 20 25 30Ile Pro Ala Glu
Ala Val Ile Gly Tyr Ser Asp Leu Glu Gly Asp Phe 35
40 45Asp Val Ala Val Leu Pro Phe Ser Asn Ser Thr Asn
Asn Gly Leu Leu 50 55 60Phe Ile Asn
Thr Thr Ile Ala Ser Ile Ala Ala Lys Glu Glu Gly Val65 70
75 80Ser Leu Glu Lys Arg Glu Ala Glu
Ala Ala Ser Ala Gly Glu Leu Ile 85 90
95His Met Val Thr Leu Asp Lys Thr Gly Lys Lys Ser Phe Gly
Ile Cys 100 105 110Ile Val Arg
Gly Glu Val Lys Asp Ser Pro Asn Thr Lys Thr Thr Gly 115
120 125Ile Phe Ile Lys Gly Ile Val Pro Asp Ser Pro
Ala His Leu Cys Gly 130 135 140Arg Leu
Lys Val Gly Asp Arg Ile Leu Ser Leu Asn Gly Lys Asp Val145
150 155 160Arg Asn Ser Thr Glu Gln Ala
Val Ile Asp Leu Ile Lys Glu Ala Asp 165
170 175Phe Lys Ile Glu Leu Glu Ile Gln Thr Phe Asp Lys
Ser Gly Gly Gly 180 185 190Gly
Glu Gln Lys Leu Ile Ser Glu Glu Asp Leu His His His His His 195
200 205His Pro Ser Thr Pro Pro Thr Pro Ser
Pro Ser Thr Pro Pro Thr Pro 210 215
220Ser Pro Glu Asn Leu Tyr Phe Gln Gly Val Ser Asp Val Pro Arg Asp225
230 235 240Leu Glu Val Val
Ala Ala Thr Pro Thr Ser Leu Leu Ile Ser Trp Asp 245
250 255Ala Pro Ala Val Thr Val Arg Tyr Tyr Arg
Ile Thr Tyr Gly Glu Thr 260 265
270Gly Gly Asn Ser Pro Val Gln Glu Phe Thr Val Pro Gly Ser Lys Ser
275 280 285Thr Ala Thr Ile Ser Gly Leu
Lys Pro Gly Val Asp Tyr Thr Ile Thr 290 295
300Val Tyr Ala Val Thr Gly Arg Gly Asp Ser Pro Ala Ser Ser Lys
Pro305 310 315 320Ile Ser
Ile Asn Tyr Arg Thr 325
User Contributions:
Comment about this patent or add new information about this topic:
People who visited this patent also read: | |
Patent application number | Title |
---|---|
20110274595 | Rack Apparatus for a Sample Distribution System |
20110274594 | AB-REMOVER, AB-REMOVING APPARATUS, AND AB REMOVAL METHOD |
20110274593 | PROCESSES FOR PREPARING A POLYMERIC INDICATOR FILM |
20110274592 | METHOD OF COOLING A STERILIZER |
20110274591 | PLANT FOR THE CRYSTALLIZATION OF ADIPIC ACID |