Patent application title: Diagnostics and treatments of periodontal disease
Inventors:
Eric Charles Reynolds (North Balwyn, AU)
Peter Singh Bhogal (Point Lonsdale, AU)
Nada Slakeski (East Kew, AU)
Assignees:
THE UNIVERSITY OF MELBOURNE
IPC8 Class: AC07K1640FI
USPC Class:
53038826
Class name: Monoclonal binds microorganism or normal or mutant component or product thereof (e.g., animal cell, cell-surface antigen, secretory product, etc.) binds enzyme
Publication date: 2011-09-01
Patent application number: 20110213129
Abstract:
This invention relates to the PrtR-PrtK cell surface protein of
Porphyromonas gingivalis and in particular a multimeric cell association
protein complex comprising the PrtR and PrtK proteins. Accordingly the
invention provides a substantially purified antigenic complex for use in
raising an antibody response directed against Porphyromonas gingivalis.
The complex comprises at least one multimeric protein complex of
arginine-specific and lysine-specific thiol endopeptidases each
containing at least one adhesin domain, the complex having a molecular
weight of greater than about 200 kDa. The invention also relates to
pharmaceutical compositions and associated agents based on said complex
for the detection, prevention and treatment of Periodontal disease
associated with P. gingivalis.Claims:
1-20. (canceled)
21. An antibody preparation comprising antibodies specifically directed against a substantially purified antigenic complex from Porphyromonas gingivalis, the complex comprising at least one multimeric protein complex of arginine-specific and lysine-specific thiol endopeptidases each containing at least one adhesion domain, the complex having a molecular weight of about 294 to about 323 kDa wherein the multimeric protein complex comprises 9 proteins, the 9 proteins having the following N-terminal sequences: DVYTDHGDLYNTPVRML (SEQ ID NO:1), YTPVEEKQNGRMIVIVAKKYEGD (SEQ ID NO:2), SGQAEIVLEAHDVWNDGSGYQILLDADHDQYGQVIPSDTHFL (SEQ ID NO:3), PQSVWIERTVDLPAGTKYVAFR (SEQ ID NO:4), ANEAKVVLAADNVWGNTGYQFLLDA (SEQ ID NO:5), ANEAKVVLAADNVWGDNTGYQFLLDA SEQ ID NO:5), PQSVWIERTVDLPAGTKYVAFR (SEQ ID NO:4), ADFTETFESSTHGEAPAEWTTIDA (SEQ ID NO:6), and ADFTETFESSTHGEAPAEWTTIDA (SEQ ID NO:6).
22. An antibody preparation as claimed in claim 21 in which the antibodies are polyclonal antibodies.
23. An antibody preparation as claimed in claim 21 in which the antibodies are monoclonal antibodies.
24. An antibody preparation as claimed in claim 21 formulated for administration as a mouth wash or as a dentifrice.
25. An antibody preparation as claimed in claim 22 formulated for administration as a mouth wash or as a dentifrice.
26. An antibody preparation as claimed in claim 23 formulated for administration as a mouth wash or as a dentifrice.
Description:
CROSS REFERENCES TO RELATED APPLICATIONS
[0001] This application is a continuation of application Ser. No. 11/654,512, filed Jan. 18, 2007, which is a continuation of Ser. No. 10/229,066, filed Aug. 28, 2002, which is a continuation of application Ser. No. 09/066,330, filed Sep. 15, 1998, and claims priority to Australian Application No. PN 6275, filed Oct. 30, 1995, which is a 371 of PCT/AU96/00673, filed Oct. 30, 1996, the entire contents of each of which is hereby incorporated by reference in this application.
FIELD OF THE INVENTION
[0002] This invention relates to the PrtR-PrtK cell surface protein of Porphyromonas gingivalis and in particular a multimeric cell associated protein complex comprising the PrtR and PrtK proteins. The invention also relates to pharmaceutical compositions and associated agents based on said complex for the detection, prevention and treatment of Periodontal disease associated with P. gingivalis.
BACKGROUND OF THE INVENTION
[0003] Periodontal diseases are bacterial-associated inflammatory diseases of the supporting tissues of the teeth and range from the relatively mild form of gingivitis, the non-specific, reversible inflammation of gingival tissue to the more aggressive forms of periodontitis which are characterised by the destruction of the tooth's supporting structures. Periodontitis is associated with a subgingival infection of a consortium of specific Gram-negative bacteria that leads to the destruction of the periodontium and is a major public health problem. One bacterium that has attracted considerable interest is P. gingivalis as the recovery of this microorganism from adult periodontitis lesions can be up to 50% of the subgingival anaerobically cultivable flora, whereas P. gingivalis is rarely recovered, and then in low numbers, from healthy sites. A proportional increase in the level of P. gingivalis in subgingival plaque has been associated with an increased severity of periodontitis and eradication of the microorganism from the cultivable subgingival microbial population is accompanied by resolution of the disease. The progression of periodontitis lesions in non-human primates has been demonstrated with the subgingival implantation of P. gingivalis. These findings in both animals and humans suggest a major role for P. gingivalis in the development of adult periodontitis.
[0004] P. gingivalis is a black-pigmented, anaerobic, asaccharolytic, proteolytic Gram-negative rod that obtains energy from the metabolism of specific amino acids. The microorganism has an absolute growth requirement for iron, preferentially in the form of haeme or its Fe(III) oxidation product haemin and when grown under conditions of excess haemin is highly virulent in experimental animals. A number of virulence factors have been implicated in the pathogenicity of P. gingivalis including the capsule, adhesins, cytotoxins and extracellular hydrolytic enzymes. In particular, proteases have received a great deal of attention for their ability to degrade a broad range of host proteins including structural proteins and others involved in defence. The proteins that have been shown to be substrates for P. gingivalis proteolytic activity include collagen types 1 and IV, fibronectin, fibrinogen, laminin, complement and plasma clotting cascade proteins, α1-antitrypsin, α2macroglobulin, antichymotrypsin, antithrombin III, antiplasmin, cystatin C, IgG and IgA. The major proteolytic activities associated with this organism have been defined by substrate specificity and are "trypsin-like", that is cleavage on the carboxyl side of arginyl and lysyl residues and collagenolytic although other minor activities have been reported.
[0005] P. gingivalis trypsin-like proteolytic activity has been shown to degrade complement, generating biologically active C5a, impair the phagocytic and other functions of neutrophils by modifying surface receptors, and abrogate the clotting potential of fibrinogen prolonging plasma clotting time. The trypsin-like proteolytic activity of P. gingivalis also generates Fc fragments from human IgGI stimulating the release of pro-inflammatory cytokines from mononuclear cells and is associated with vascular disruption and enhanced vascular permeation through the activation of the kallikrein-kinin cascade. P. gingivalis spontaneous mutants with reduced trypsin-like activity as well as wild-type cells treated with the trypsin-like protease inhibitor N-p-tosyl-L-lysine chloromethyl ketone are avirulent in animal models. Further, it has been shown that P.gingivalis grown under controlled, haemin-excess conditions expressed more trypsin-like and less collagenolytic activity and were more virulent in mice relative to cells grown under haemin-limited but otherwise identical conditions. The increased expression of the trypsin-like activity by the more virulent P. gingivalis has led to the speculation that the trypsin-like proteolytic activity may be the major determinant for infection or disease. However, the cell-associated trypsin-like proteolytic activities of P. gingivalis have not been characterised to date.
[0006] There has been considerable endeavour to purify and characterise the trypsin-like proteases of P. gingivalis from cell-free culture fluids. Chen et al, (1992) [J Biol Chem 267:18896-18901] have purified and characterised a 50 kDa arginine-specific, thiol protease from the culture fluid of P. gingivalis H66 designated Arg-gingipain. A similar arginine-specific thiol protease has been disclosed in JP 07135973 and the amino acid sequence disclosed in WO 9507286 and in Kirszbaum et al, 1995 [Biochem Biophys Res Comm 207:424-431]. Pike et al (1994) [J Biol Chem 269:406-411] have characterised a 60 kDa lysine-specific cysteine proteinase from the culture fluid of P. gingivalis H66 designated Lys-gingipain and the partial gene sequence for this enzyme was disclosed in WO 9511298 and fully disclosed in WO 9617936. However, prior to the development of the present invention it was unknown that there existed on the cell surface of P. gingivalis a 300 kDa complex of arginine-specific and lysine-specific proteases both containing adhesin domains. The 300 kDa complex has been designated the PrtR-PrtK complex. The presence of the PrtR-PrtK cell surface complex exhibiting both arginine- and lysine-specific proteolytic activity together with adhesin activity was previously unknown. Furthermore, the new PrtR-PrtK complex of the present invention is expressed on the cell surface, is a major virulence-associated factor and contains unique epitopes not displayed on the individual domains. The previously disclosed arginine-specific and lysine-specific thiol proteases, as discussed, do not exhibit any of these features and have proven of limited application to date. However, the aforementioned features have rendered the PrtR-PrtK complex of the invention ideal for development of diagnostic and immunoprophylactic products. The PrtR-PrtK cell surface complex is accordingly of particular interest for diagnostics and neutralisation by passive immunity through oral compositions containing neutralising antibodies and by vaccine development. In particular for the development of an intra-oral recombinant bacterial vaccine, where the recombinant bacterium expressing an inactivated PrtR-PrtK is a genetically engineered commensal inhabitant of the oral cavity.
SUMMARY OF THE INVENTION
[0007] Accordingly in a first aspect the present invention consists in a substantially purified antigenic complex for use in raising an antibody response directed against Porphyromonas gingivalis, the complex comprising at least one multimeric protein complex of arginine-specific and lysine-specific thiol endopeptidases each containing at least one adhesin domain, the complex having a molecular weight of greater than about 200 kDa.
[0008] In the context of this disclosure, the terms "adhesin" and "hemagglutinin" may be considered to be synonymous.
[0009] In a preferred form of the present invention the multimeric protein complex is associated with virulent strains of Porphyromonas gingivalis, preferably has a molecular weight of about 294 to about 323 kDa and is preferably derived from P. gingivalis W50.
[0010] It is also preferred that the multimeric protein complex is composed of 9 proteins. These 9 proteins preferably have the following N-terminal sequences:
TABLE-US-00001 (SEQ ID NO: 1) DVYTDHGDLYNTPVRML (SEQ ID NO: 2) YTPVEEKQNGRMIVIVAKKYEGD (SEQ ID NO: 3) SGQAEIVLEAHDVWNDGSGYQILLDADHDQYGQVIPSDTHFL (SEQ ID NO: 4) PQSVWIERTVDLPAGTKYVAFR (SEQ ID NO: 5) ANEAKVVLAADNVWGDNTGYQFLLDA (SEQ ID NO: 6) ANEAKVVLAADNVWGDNTGYQFLLDA (SEQ ID NO; 7) PQSVWIERTVDLPAGTKYVAFR (SEQ ID NO: 8) ADFTETFESSTHGEAPAEWTTIDA (SEQ ID NO: 9) ADFTETFESSTHGEAPAEWTTIDA
[0011] It is presently preferred that the 9 proteins are PrtK48, PrtR45, PrtR44, PrtK39, PrtK44, PrtR27, PrtR17, PrtK15 and PrtR15 as described herein.
[0012] As the purified antigenic complex normally has enzymatic activity it is preferred in a number of uses the thiol endopeptidases are rendered inactive. This may be achieved in a number of ways, for example by oxidation or by mutation. It is presently preferred that the inactivation is by oxidation.
[0013] In yet another preferred embodiment of the present invention the multimeric protein complex is encoded by the DNA sequence shown in FIGS. 8B and 9B.
[0014] In a second aspect the present invention consists in a composition for use in eliciting an immune response directed against Porphyromonas gingivalis, the composition comprising an effective amount of the complex of the first aspect of the present invention and a suitable adjuvant and/or acceptable carrier.
[0015] In a third aspect the present invention consists in an antibody preparation comprising antibodies specifically directed against the complex of the first aspect of the present invention. The antibodies may be polyclonal antibodies or monoclonal antibodies.
[0016] In a fourth aspect the present invention consists in a method of treating a subject suffering from Porphyromonas gingivalis infection, the method comprising administering to the subject an amount of the antibody preparation of the third aspect of the present invention effective to at least partially neutralize the PrtR-PrtK complex of Porphyromonas gingivalis.
[0017] As will be recognised by those skilled in the art the antibody preparation may be administered by any of a number of well known routes, however, it is presently preferred that the preparation is administered orally.
[0018] In a fifth aspect the present invention consists in a method of reducing the prospect of P. gingivalis infection in an individual and/or severity of disease, the method comprising administering to the individual an amount of the composition of the second aspect of the present invention effective to induce an immune response in the individual directed against P. gingivalis.
[0019] In yet a further aspect the present invention consists in a recombinant host cell, the host cell being transformed with a DNA sequence(s) encoding PrtR-PrtK operatively linked to control sequences such that under appropriate conditions the host cell expresses PrtR-PrtK.
[0020] In another aspect, the present invention is directed to novel DNA sequences involving PrtR-PrtK constructs and vectors including plasmid DNA, and viral DNA such as human viruses, animal viruses, insect viruses, or bacteriophages which can be used to direct the expression of PrtR-PrtK protein in appropriate host cells from which the expressed protein may be purified. Another aspect of the present invention provides methods for molecular cloning of the genes encoding the PrtR-PrtK complex. The nucleic acid sequences of the present invention can be used in molecular diagnostic assays for P. gingivalis genetic material through nucleic acid hybridization, and including the synthesis of PrtR-PrtK sequence-specific oligonucleotides for use as primers and/or probes in amplifying, and detecting amplified, nucleic acids. Additionally, PrtR-PrtK complex can be used as an immunogen in prophylactic and/or therapeutic vaccine formulations against pathogenic strains of P. gingivalis, whether the immunogen is chemically synthesized, purified from P. gingivalis, or purified from a recombinant expression vector system. Alternatively, the genes encoding PrtR-PrtK may be incorporated into a bacterial or viral vaccine comprising recombinant bacteria or virus which is engineered to produce PrtR-PrtK by itself, or in combination with immunogenic epitopes of other pathogenic microorganisms. In addition, the genes encoding PrtR-PrtK operatively linked to one or more regulatory elements, can be introduced directly into humans to express the PrtR-PrtK to elicit a protective immune response. A vaccine can also be based upon a recombinant component of a mutated PrtR-PrtK incorporated into an appropriate vector and expressed in a suitable transformed host (eg. E. coli, Bacillus subtilis, Saccharomyces cerevisiae, COS cells, CHO cells and HeLa cells) containing the vector. The vaccine can be based on an intra-oral recombinant bacterial vaccine, where the recombinant bacterium expressing an inactivated PrtR-PrtK is a commensal inhabitant of the oral cavity. Unlike whole P. gingivalis cells or other previously prepared antigens based on fimbriae or the capsule the PrtR-PrtK complex of the invention or component parts thereof are safe and effective antigens for the preparation of a vaccine for the prevention of P. gingivalis-associated periodontal disease. The invention therefore provides a range of recombinant products based on the PrtR-PrtK complex.
[0021] The invention also provides antibodies raised against the said PrtR-PrtK complex, herein called anti-PrtR-PrtK antibodies. The antibodies may be blended into oral compositions such as toothpaste, mouthwash, toothpowders and liquid dentifrices, mouthwashes, troches, chewing gums, dental pastes, gingival massage creams, gargle tablets, dairy products and other foodstuffs.
[0022] In another aspect the invention provides a method of diagnosis for the presence of P. gingivalis characterised by the use of any one or a combination of an antibody, antigen or nucleic acid probe as hereinbefore defined comprising the application of known techniques including for example, enzyme linked immunosorbent assay.
[0023] The invention also provides diagnostic kits comprising antibodies, antigens and/or nucleic acid probes as hereinbefore defined.
BRIEF DESCRIPTION OF FIGURES
[0024] FIG. 1. Anion exchange FPLC of a P. gingivalis W50 sonicate. The sonicate in TC buffer containing 50 mM NaCl was applied to a Hiload XK 16/10 Q sepharose column and eluted using a linear gradient from 0-100% buffer B over 90 min at a flow rate of 2.0 ml min-1. Fractions (6 ml) were assayed for proteolytic and amidolytic activity using azocasein, Bz-L-Arg-pNA and Z-L-Lys-pNA. The amidolytic activity of each 6 ml fraction with Bz-L-Arg-pNA is shown by the histogram.
[0025] FIG. 2. Gel filtration FPLC of the pooled and concentrated fractions from Q sepharose anion exchange FPLC containing proteolytic/amidolytic activity. Anion exchange fractions containing the major peak of proteolytic/amidolytic activity were pooled, equilibrated in TC buffer containing 150 mM NaCl, concentrated and divided into four aliquots and each then independently applied to a gel filtration column (Superose 12 HR 10/30) and eluted using the same buffer at a flow rate of 0.3 ml min-1. Fractions (0.5 ml) were assayed for proteolytic and amidolytic activity. Bz-L-Arg-pNA amidolytic activity is shown by the histogram. Vo and Vt indicate the void and total volumes of the column respectively. The elution volumes of the standard proteins thyroglobulin 667 kDa, catalase 232 kDa and aldolase 158 kDa are marked.
[0026] FIG. 3. SDS-PAGE (boiled/reduced conditions) of the 300 kDa peak from gel filtration (Superose 12 HR 10/30) FPLC. Lane 1, Pharmacia molecular mass standards (Mr shown in kDa). Lane 2, 300 kDa peak from gel filtration FPLC. Coomassie blue stained gel.
[0027] FIG. 4. Specific cleavage sites (marked with arrows) of α.sub.s1-casein by the proteolytic/amidolytic peak from gel filtration FPLC corresponding to 300 kDa. The protein α.sub.s1-casein was cleaved on the carboxyl side of arginyl and lysyl residues only (SEQ ID NO:14).
[0028] FIG. 5. Arg-sepharose FPLC of the 300 kDa gel filtration peak exhibiting Arg- and Lys-specific proteolytic activity. Gel filtration fractions containing the major peak of proteolytic activity (300 kDa) were pooled and applied to an arginine-sepharose column (5 ml arginine-Sepharose 4B) and washed with TC buffer containing 50 mM NaCl at 0.1 ml min-1 until the baseline returned to zero. The column was then further washed with 500 mM NaCl and then re-equilibrated with TC buffer containing 50 mM NaCl. The column was first eluted with 200 mM lysine in TC buffer containing 50 mM NaCl, followed by 750 mM lysine in the same buffer. The column was then re-equilibrated and eluted with 200 M arginine in the same buffer at a flow rate of 0.1 ml min-1. Peaks were collected and assayed for amidolytic and proteolytic activity. Bz-L-Arg-pNA amidolytic activity is shown by the histogram and the arrows indicate the start of each step gradient.
[0029] FIG. 6. SDS-PAGE (boiled/reduced conditions) of 200 mM lysine eluant from the Arg-sepharose FPLC. Lane 1, Pharmacia molecular mass standards (Mr shown in kDa) Lane 2, 200 mM lysine eluant from Arg-sepharose FPLC. Silver stained gel.
[0030] FIG. 7. SDS-PAGE (boiled/reduced conditions) of the 750 mM lysine and 200 mM arginine eluants from the arginine-Sepharose FPLC and the purified 45 kDa Arg-specific endopeptidase. Lane 1, 750 mM lysine eluant. Lane 2, 200 mM arginine eluant. Lane 3, purified 45 kDa Arg-specific endopeptidase. Lane 4, Pharmacia molecular mass standards (Mr shown in kDa). Coomassie blue stained gel.
[0031] FIG. 8a. Schematic representation of the prtR gene. The PrtR nascent polyprotein is composed of a leader sequence, a prosequence followed by the Arg-specific cysteine proteinase PrtR45 (SEQ ID NO:15), and the adhesins PrtR44 (SEQ ID NO:16), PrtR15 (SEQ ID NO:17), PrtR17 (SEQ ID NO:18) and PrtR27 (SEQ ID NO: 19) all preceded by an arginyl or lysyl residue.
[0032] FIG. 8b. Nucleotide sequence of prtR (SEQ ID NO:20 and encoded protein, SEQ ID NO:21).
[0033] FIG. 9a. Schematic representation of the prtK gene. The PrtK nascent polyprotein is composed of a leader sequence, a prosequence followed by the Lys-specific cysteine proteinase PrtK48 (SEQ ID NO:22), and the adhesins PrtK39 (SEQ ID NO:19), PrtK 15 (SEQ ID NO:17) and PrtK44 (SEQ ID NO: 18) all preceded by an arginyl or lysyl residue.
[0034] FIG. 9b. Nucleotide sequence of prtK (SEQ ID NO:23 and encoded protein, SEQ ID NO:24).
[0035] FIG. 10. SDS-PAGE of the PrtR-PrtK complex purified by diafiltration. Lane 1 shows molecular mass markers. Lane 2 shows components of the PrtR-PrtK purified by diafiltration.
[0036] FIG. 11. ELISA titration of sera from 5 mice immunized twice with the PrtR-PrtK complex emulsified in Freund's Incomplete Adjuvant. Test sera (TS 32-36) and pre-immune sera (PIS 32-36) were screened using P. gingivalis W50 sonicate as the adsorbed antigen. Primary antibody dilutions of 1/100, 1/500, 1/2500 and 1/12500 were used. Bound antibody was determined using horseradish peroxidase-conjugated goat anti-mouse antibody and 3,3',5,5'tetramethylbenezidine. The reaction product was quantitated spectrophotometrically using a 450 nm interference filter in a plate reader and recorded as optical density (O.D.) readings.
DETAILED DESCRIPTION OF THE INVENTION
[0037] The invention will now be described in greater detail by reference to the methods used and applied in the development of the invention and by reference to particular examples which provide the best methods known of performing the invention.
[0038] The intra-oral bacterium Porphyromonas gingivalis possesses on its cell surface major trypsin-like proteinases as a 294-323 kDa heterodimeric protein complex of Arg-specific and Lys-specific thiol endopeptidases with hemagglutinins (adhesins) herein designated the PrtR-PrtK complex. The PrtR-PrtK complex can be purified from P. gingivalis cells by ultrasonication or chloroform extraction followed by diafiltration or anion exchange and Lys-sepharose or Arg-sepharose chromatography. The purified PrtR-PrtK complex is then used to generate antibodies using standard techniques. The animals used for antibody generation can be rabbits, goats, chickens, sheep, horses, cows etc. When a high antibody titre against the PrtR-PrtK complex is detected by immunoassay the animals are bled or eggs or milk are collected and the serum prepared and/or antibody purified using standard techniques or monoclonal antibodies produced by fusing spleen cells with myeloma cells using standard techniques. The antibody (immunoglobulin fraction) may be separated from the culture or ascites fluid, serum, milk or egg by salting out, gel filtration, ion exchange and/or affinity chromatography, and the like, with salting out being preferred. In the salting out method the antiserum or the milk is saturated with ammonium sulphate to produce a precipitate, followed by dialyzing the precipitate against physiological saline to obtain the purified immunoglobulin fraction with the specific anti-(PrtR-PrtK). The preferred antibody is obtained from the equine antiserum and the bovine antiserum and milk. In this invention the antibody contained in the antiserum and milk obtained by immunising the animal with the inactivated PrtR-PrtK may be blended into the oral composition. In this case the antiserum and milk as well as the antibody separated and purified from the antiserum and milk may be used. Each of these materials may be used alone or in combination of two or more. Antibodies against the PrtR-PrtK can be used in oral compositions such as toothpaste and mouthwash to neutralise the PrtR-PrtK and thus prevent disease. The anti-(PrtR-PrtK) antibodies can also be used for the early detection of P. gingivalis in subgingival plaque samples by a chairside Enzyme Linked Immunosorbent Assay (ELISA).
[0039] For oral compositions it is preferred that the amount of the above antibodies administered is 0.0001-50 g/kg/day and that the content of the above antibodies is 0.0002-10% by weight preferably 0.002-5% by weight of the composition. The oral composition of this invention which contains the above-mentioned serum or milk antibody may be prepared and used in various forms applicable to the mouth such as dentifrice including toothpastes, toothpowders and liquid dentifrices, mouthwashes, troches, periodontal pocket irrigating devices, chewing gums, dental pastes, gingival massage creams, gargle tablets, dairy products and other foodstuffs. The oral composition according to this invention may further include additional well known ingredients depending on the type and form of a particular oral composition.
[0040] In certain highly preferred forms of the invention the oral composition may be substantially liquid in character, such as a mouthwash or rinse. In such a preparation the vehicle is typically a water-alcohol mixture desirably including a humectant as described below. Generally, the weight ratio of water to alcohol is in the range of from about 1:1 to about 20:1. The total amount of water-alcohol mixture in this type of preparation is typically in the range of from about 70 to about 99.9% by weight of the preparation. The alcohol is typically ethanol or isopropanol. Ethanol is preferred.
[0041] The pH of such liquid and other preparations of the invention is generally in the range of from about 4.5 to about 9 and typically from about 5.5 to 8. The pH is preferably in the range of from about 6 to about 8.0, preferably 7.4. The pH can be controlled with acid (e g citric acid or benzoic acid) or base (e g sodium hydroxide) or buffered (as with sodium citrate, benzoate, carbonate, or bicarbonate, disodium hydrogen phosphate, sodium dihydrogen phosphate, etc).
[0042] Other desirable forms of this invention, the oral composition may be substantially solid or pasty in character, such as toothpowder, a dental tablet or a dentifrice, that is a toothpaste (dental cream) or gel dentifrice. The vehicle of such solid or pasty oral preparations generally contains dentally acceptable polishing material. Examples of polishing materials are water-insoluble sodium metaphosphate, potassium metaphosphate, tricalcium phosphate, dihydrated calcium phosphate, anhydrous dicalcium phosphate, calcium pyrophosphate, magnesium orthophosphate, trimagnesium phosphate, calcium carbonate, hydrated alumina, calcined alumina, aluminium silicate, zirconium silicate, silica, bentonite, and mixtures thereof. Other suitable polishing material include the particulate thermosetting resins such as melamine-, phenolic, and urea-formaldehydes, and cross-linked polyepoxides and polyesters. Preferred polishing materials include crystalline silica having particle sized of up to about 5 microns, a mean particle size of up to about 1.1 microns, and a surface area of up to about 50,000 cm2/gm, silica gel or colloidal silica, and complex amorphous alkali metal aluminosilicate.
[0043] When visually clear gels are employed, a polishing agent of colloidal silica, such as those sold under the trademark SYLOID as Syloid 72 and Syloid 74 or under the trademark SANTOCEL as Santocel 100, alkali metal alumino-silicate complexes are particularly useful since they have refractive indices close to the refractive indices of gelling agent-liquid (including water and/or humectant) systems commonly used in dentifrices.
[0044] Many of the so-called "water insoluble" polishing materials are anionic in character and also include small amounts of soluble material. Thus, insoluble sodium metaphosphate may be formed in any suitable manner as illustrated by Thorpe's Dictionary of Applied Chemistry, Volume 9, 4th Edition, pp. 510-511. The forms of insoluble sodium metaphosphate known as Madrell's salt and Kurrol's salt are further examples of suitable materials. These metaphosphate salts exhibit only a minute solubility in water, and therefore are commonly referred to as insoluble metaphosphates (IMP). There is present therein a minor amount of soluble phosphate material as impurities, usually a few percent such as up to 4% by weight. The amount of soluble phosphate material, which is believed to include a soluble sodium trimetaphosphate in the case of insoluble metaphosphate, may be reduced or eliminated by washing with water if desired. The insoluble alkali metal metaphosphate is typically employed in powder form of a particle size such that no more than 1% of the material is larger than 37 microns.
[0045] The polishing material is generally present in the solid or pasty compositions in weight concentrations of about 10% to about 99%. Preferably, it is present in amounts from about 10% to about 75% in toothpaste, and from about 70% to about 99% in toothpowder. In toothpastes, when the polishing material is silicious in nature, it is generally present in amount of about 10-30% by weight. Other polishing materials are typically present in amount of about 30-75% by weight.
[0046] In a toothpaste, the liquid vehicle may comprise water and humectant typically in an amount ranging from about 10% to about 80% by weight of the preparation. Glycerine, propylene glycol, sorbitol and polypropylene glycol exemplify suitable humectants/carriers. Also advantageous are liquid mixtures of water, glycerine and sorbitol. In clear gels where the refractive index is an important consideration, about 2.5-30% w/w of water, 0 to about 70% w/w of glycerine and about 20-80% w/w of sorbitol are preferably employed. Toothpaste, creams and gels typically contain a natural or synthetic thickener or gelling agent in proportions of about 0.1 to about 10, preferably about 0.5 to about 5% w/w. A suitable thickener is synthetic hectorite, a synthetic colloidal magnesium alkali metal silicate complex clay available for example as Laponite (e.g. CP, SP 2002, D) marketed by Laporte Industries Limited. Laponite D is, approximately by weight 58.00% SiO2, 25.40% MgO, 3.05% Na2O, 0.98% Li2O, and some water and trace metals. Its true specific gravity is 2.53 and it has an apparent bulk density of 1.0 g/ml at 8% moisture.
[0047] Other suitable thickeners include Irish moss, iota carrageenan, gum tragacanth, starch, polyvinylpyrrolidone, hydroxyethylpropylcellulose, hydroxybutyl methyl cellulose, hydroxypropyl methyl cellulose, hydroxyethyl cellulose (e.g. available as Natrosol), sodium carboxymethyl cellulose, and colloidal silica such as finely ground Syloid (e.g. 244). Solubilizing agents may also be included such as humectant polyols such propylene glycol, dipropylene glycol and hexylene glycol, cellosolves such as methyl cellosolve and ethyl cellosolve, vegetable oils and waxes containing at least about 12 carbons in a straight chain such as olive oil, castor oil and petrolatum and esters such as amyl acetate, ethyl acetate and benzyl benzoate.
[0048] It will be understood that, as is conventional, the oral preparations are to be sold or otherwise distributed in suitable labelled packages. Thus, a jar of mouthrinse will have a label describing it, in substance, as a mouthrinse or mouthwash and having directions for its use, and a toothpaste, cream or gel will usually be in a collapsible tube, typically aluminium, lined lead or plastic, or other squeeze, pump or pressurised dispenser for metering out the contents, having a label describing it, in substance, as a toothpaste, gel or dental cream.
[0049] Organic surface-active agents are used in the compositions of the present invention to achieve increased prophylactic action, assist in achieving thorough and complete dispersion of the active agent throughout the oral cavity, and render the instant compositions more cosmetically acceptable. The organic surface-active material is preferably anionic, nonionic or ampholytic in nature which does not denature the antibody of the invention, and it is preferred to employ as the surface-active agent a detersive material which imparts to the composition detersive and foaming properties while not denaturing the antibody. Suitable examples of anionic surfactants are water-soluble salts of higher fatty acid monoglyceride monosulfates, such as the sodium salt of the monosulfated monoglyceride of hydrogenated coconut oil fatty acids, higher alkyl sulfates such as sodium lauryl sulfate, alkyl aryl sulfonates such as sodium dodecyl benzene sulfonate, higher alkylsulfo-acetates, higher fatty acid esters of 1,2-dihydroxy propane sulfonate, and the substantially saturated higher aliphatic acyl amides of lower aliphatic amino carboxylic acid compounds, such as those having 12 to 16 carbons in the fatty acid, alkyl or acyl radicals, and the like. Examples of the last mentioned amides are N-lauroyl sarcosine, and the sodium, potassium, and ethanolamine salts of N-lauroyl, N-myristoyl, or N-palmitoyl sarcosine which should be substantially free from soap or similar higher fatty acid material. The use of these sarconite compounds in the oral compositions of the present invention is particularly advantageous since these materials exhibit a prolonged marked effect in the inhibition of acid formation in the oral cavity due to carbohydrates breakdown in addition to exerting some reduction in the solubility of tooth enamel in acid solutions. Examples of water-soluble nonionic surfactants suitable for use with antibodies are condensation products of ethylene oxide with various reactive hydrogen-containing compounds reactive therewith having long hydrophobic chains (e.g. aliphatic chains of about 12 to 20 carbon atoms), which condensation products ("ethoxamers") contain hydrophilic polyoxyethylene moieties, such as condensation products of poly (ethylene oxide) with fatty acids, fatty alcohols, fatty amides, polyhydric alcohols (e.g sorbitan monostearate) and polypropyleneoxide (e.g. Pluronic materials).
[0050] Surface active agent is typically present in amount of about 0.1-5% by weight. It is noteworthy, that the surface active agent may assist in the dissolving of the antibody of the invention and thereby diminish the amount of solubilizing humectant needed.
[0051] Various other materials may be incorporated in the oral preparations of this invention such as whitening agents, preservatives, silicones, chlorophyll compounds and/or ammoniated material such as urea, diammonium phosphate, and mixtures thereof. These adjuvants, where present, are incorporated in the preparations in amounts which do not substantially adversely affect the properties and characteristics desired.
[0052] Any suitable flavouring or sweetening material may also be employed. Examples of suitable flavouring constituents are flavouring oils, e.g. oil of spearmint, peppermint, wintergreen, sassafras, clove, sage, eucalyptus, marjoram, cinnamon, lemon, and orange, and methyl salicylate. Suitable sweetening agents include sucrose, lactose, maltose, sorbitol, xylitol, sodium cyclamate, perillartine, AMP (aspartyl phenyl alanine, methyl ester), saccharine, and the like. Suitably, flavour and sweetening agents may each or together comprise from about 0.1% to 5% more of the preparation.
[0053] In the preferred practice of this invention an oral composition according to this invention such as mouthwash or dentifrice containing the composition of the present invention is preferably applied regularly to the gums and teeth, such as every day or every second or third day or preferably from 1 to 3 times daily, at a pH of about 4.5 to about 9, generally about 5.5 to about 8, preferably about 6 to 8, for at least 2 weeks up to 8 weeks or more up to a lifetime.
[0054] The compositions of this invention can be incorporated in lozenges, or in chewing gum or other products, e.g. by stirring into a warm gum base or coating the outer surface of a gum base, illustrative of which may be mentioned jelutong, rubber latex, vinylite resins, etc, desirably with conventional plasticisers or softeners, sugar or other sweeteners or such as glucose, sorbitol and the like.
[0055] The composition of this invention also includes targeted delivery vehicles such as periodontal pocket irrigation devices, collagen, elastin, or synthetic sponges, membranes or fibres placed in the periodontal pocket or used as a barrier membrane or applied directly to the tooth root.
[0056] Another important form of the invention is a composition for use in eliciting an immune response directed against Pophyromonas gingivalis based on the PrtR-PrtK complex and suitable adjuvant delivered by nasal spray, orally or by injection to produce a specific immune response against the PrtR-PrtK complex thereby reducing colonisation of P. gingivalis and neutralising the PrtR-PrtK thereby preventing disease. Due to the potent enzymatic activity of the complex typically the complex will be inactivated. A vaccine can also be based upon a recombinant component of the PrtR-PrtK incorporated into an appropriate vector and expressed in a suitable transformed host (eg. E. coli, Bacillus subtilis, Saccharomyces cerevisiae, COS cells, CHO cells and HeLa cells) containing the vector. Unlike whole P. gingivalis cells or other previously prepared antigens based on fimbriae or the capsule the PrtR-PrtK complex is a safe and effective antigens for the preparation of a composition for use in the prevention of P.gingivalis-associated periodontal disease. The PrtR-PrtK complex can be produced using recombinant DNA methods as illustrated herein, or can be synthesized chemically from the amino acid sequence disclosed in the present invention. Additionally, according to the present invention, the PrtR- PrtK complex may be used to generate antisera useful for passive immunization against periodontal disease and infections caused by P. gingivalis.
[0057] Various adjuvants are used in conjunction with vaccine formulations. The adjuvants aid by modulating the immune response and in attaining a more durable and higher level of immunity using smaller amounts of vaccine antigen or fewer doses than if the vaccine antigen were administered alone. Examples of adjuvants include incomplete Freund's adjuvant (IFA), Adjuvant 65 (containing peanut oil, mannide monooleate and aluminium monostrearate), oil emulsions, Ribi adjuvant, the pluronic polyols, polyamines, Avridine, Quil A, saponin, MPL, QS-21, and mineral gels such as aluminium salts. Other examples include oil in water emulsions such as SAF-1, SAF-0, MF59, Seppic ISA720, and other particulate adjuvants such as ISCOMs and ISCOM matrix. An extensive but not exhaustive list of other examples of adjuvants are listed in Cox and Coulter 1992 [In : Wong WK (ed) Animals parasite control utilising technology. Bocca Raton, CRC press, 1992; 49-112]. In addition to the adjuvant the vaccine may include conventional pharmaceutically acceptable carriers, excipients, fillers, buffers or diluents as appropriate. One or more doses of the vaccine containing adjuvant may be administered prophylactically to prevent periodontitis or therapeutically to treat already present periodontitis.
[0058] In another preferred composition the preparation is combined with a mucosal adjuvant and administered via the oral route. Examples of mucosal adjuvants are cholera toxin and heat labile E. coli toxin, the non-toxic B subunits of these toxins, genetic mutants of these toxins which have a reduced toxicity. Other methods which may be utilised to deliver the PrtR-PrtK complex orally include incorporation of the protease into particles of biodegradable polymers (such as acrylates or polyesters) by microencapsulation to aid uptake of the microspheres from the gastrointestinal tract and to protect degradation of the proteins. Liposomes, ISCOMs, hydrogels are examples of other potential methods which may be further enhanced by the incorporation of targeting molecules such as LTB, CTB or lectins for delivery of the PrtR-PrtK complex to the mucosal immune system. In addition to the vaccine and the mucosal adjuvant or delivery system the vaccine may include conventional pharmaceutically acceptable carriers, excipients, fillers, coatings, dispersion media, antibacterial and antifungal agents, buffers or diluents as appropriate.
[0059] Another mode of this embodiment provides for either a live recombinant viral vaccine, recombinant bacterial vaccine, recombinant attenuated bacterial vaccine, or an inactivated recombinant viral vaccine which is used to protect against infections caused by P. gingivalis. Vaccinia virus is the best known example, in the art, of an infectious virus that is engineered to express vaccine antigens derived from other organisms. The recombinant live vaccinia virus, which is attenuated or otherwise treated so that it does not cause disease by itself, is used to immunize the host. Subsequent replication of the recombinant virus within the host provides a continual stimulation of the immune system with the vaccine antigens such as PrtR-PrtK complex, thereby providing long lasting immunity.
[0060] Other live vaccine vectors include: adenovirus, cytomegalovirus, and preferably the poxviruses such as vaccinia (Paoletti and Panicali, U.S. Pat. No. 4,603,112) and attenuated Salmonella strains (Stocker et al., U.S. Pat. Nos. 5,210,035, 4,837,151; and 4,735,801; and Curtiss et al., 1988, Vaccine 6:155-160). Live vaccines are particularly advantageous because they continually stimulate the immune system which can confer substantially long-lasting immunity. When the immune response is protective against subsequent P. gingivalis infection, the live vaccine itself may be used in a preventive vaccine against P. gingivalis. In particular, the live vaccine can be based on a bacterium that is a commensal inhabitant of the oral cavity. This bacterium can be transformed with a vector carrying a recombinant inactivated PrtR-PrtK and then used to colonise the oral cavity, in particular the oral mucosa. Once colonised the oral mucosa, the expression of the recombinant protein will stimulate the mucosal associated lymphoid tissue to produce neutralising antibodies. For example, using molecular biological techniques the genes encoding the PrtR-PrtK may be inserted into the vaccinia virus genomic DNA at a site which allows for expression of epitopes but does not negatively affect the growth or replication of the vaccinia virus vector. The resultant recombinant virus can be used as the immunogen in a vaccine formulation. The same methods can be used to construct an inactivated recombinant viral vaccine formulation except that the recombinant virus is inactivated, such as by chemical means known in the art, prior to use as an immunogen and without substantially affecting the immunogenicity of the expressed immunogen.
[0061] In another variation of this embodiment, genetic material is used directly as the vaccine formulation. Nucleic acid (DNA or RNA) containing sequences encoding the PrtR-PrtK protein complex operatively linked to one or more regulatory elements can be introduced directly to vaccinate the individual ("direct gene transfer") against pathogenic strains of P. gingivalis. Direct gene transfer into a vaccinated individual, resulting in expression of the genetic material by the vaccinated individual's cells such as vascular endothelial cells as well as the tissue of the major organs, has been demonstrated by techniques in the art such as by injecting intravenously an expression plasmid cationic liposome complex (Zhu et al., 1993, Science 261:209-211). Other effective methods for delivering vector DNA into a target cell are known in the art. In one example, purified recombinant plasmid DNA containing viral genes has been used to inoculate (whether parentally, mucosally, or via gene-gun immunization) vaccines to induce a protective immune response (Fynan et al. 1993, Proc. Natl. Acad. Sci. USA 90:11478-11482). In another example, cells removed from an individual can be transfected or electroporated by standard procedures known in the art, resulting in the introduction of the recombinant vector DNA into the target cell. Cells containing the recombinant vector DNA may then be selected for using methods known in the art such as via a selection marker expressed in the vector, and the selected cells may then be re-introduced into the individual to express the PrtR-PrtK complex.
[0062] As an alternative to active immunization, immunization may be passive, i.e. immunization comprising administration of purified immunoglobulin containing antibody against PrtR-PrtK.
[0063] The present invention further provides the nucleotide sequence of the genes encoding the PrtR-PrtK complex, as well as the amino acid sequence deduced from the isolated genes. According to one embodiment of the present invention, using recombinant DNA techniques the genes encoding the PrtR-PrtK complex are incorporated into an expression vector, and the recombinant vector is introduced into an appropriate host cell thereby directing the expression of these sequences in that particular host cell. The expression system, comprising the recombinant vector introduced into the host cell, can be used (a) to produce PrtR-PrtK complex which can be purified for use as an immunogen in vaccine formulations, (b) to produce PrtR-PrtK complex to be used as an antigen for diagnostic immunoassays or for generating P.gingivalis-specific antisera of therapeutic and/or diagnostic value, (c) or if the recombinant expression vector is a live virus such as vaccinia virus, the vector itself may be used as a live or inactivated vaccine preparation to be introduced into the host's cells for expression of PrtR-PrtK complex, (d) for introduction into live attenuated bacterial cells or genetically engineered commensal intra-oral bacteria which are used to express PrtR-PrtK complex to vaccinate individuals, (e) or for introduction directly into an individual to immunize against the encoded and expressed PrtR-PrtK complex In particular the recombinant bacterial vaccine can be based on a commensal inhabitant of the human oral cavity or animal if the vaccine is to prevent periodontal disease in animals. The recombinant bacterial vaccine expressing inactivated PrtR-PrtK can be used to colonise the oral cavity, supragingival or subgingival plaque. The intra-oral bacterium can be isolated from the patient with periodontitis and genetically engineered to express inactivated PrtR-PrtK complex. The production of the inactivated PrtR-PrtK within the oral cavity will not be toxic to the oral mucosal tissues. However, the inactivated PrtR-PrtK will stimulate the mucosal-associated lymphoid tissues (MALT) to produce specific antibody to neutralise the PrtR-PrtK of P. gingivalis.
[0064] Successful expression of a protein or peptide requires that either the insert comprising the gene or gene fragment, or the vector itself, contain the necessary elements for transcription and translation which is compatible with, and recognized by the particular host system used for expression. A variety of host systems may be utilized to express the PrtR-PrtK, which include, but are not limited to bacteria transformed with a bacteriophage vector, plasmid vector, or cosmid DNA; yeast containing yeast vectors; fungi containing fungal vectors, insect cell lines infected with virus (e.g. baculovirus); and mammalian cell lines transfected with plasmid or viral expression vectors, or infected with recombinant virus (e.g. vaccinia virus, adenovirus, adeno-associated virus, retrovirus, etc).
[0065] Using methods known in the art of molecular biology various promoters and enhancers can be incorporated into the vector or the DNA sequence encoding PrtR-PrtK to increase the expression of the PrtR-PrtK amino acid sequences, provided that the increased expression of the amino acid sequences is compatible with (for example, non-toxic to) the particular host cell system used. Further, the DNA can be fused to DNA encoding other antigens, such as other bacterial outer membrane proteins, or other bacterial, fungal, parasitic, or viral antigens to create a genetically fused (sharing a common peptide backbone) multivalent antigen for use as an improved vaccine composition.
[0066] The selection of the promoter will depend on the expression system used. Promoters vary in strength, i.e. ability to facilitate transcription. Generally, for the purpose of expressing a cloned gene, it is desirable to use a strong promoter in order to obtain a high level of transcription of the gene and expression into gene product. For example, bacterial, phage, or plasmid promoters known in the art from which a high level of transcription have been observed in a host cell system comprising E. coli include the lac promoter, trp promoter, recA promoter, ribosomal RNA promoter, the PR and PL promoters, lacUV5, ompF, bla, lpp, and the like, may be used to provide transcription of the inserted DNA sequence encoding PrtR-PrtK.
[0067] Additional, if PrtR-PrtK protein may be lethal or detrimental to the host cells, the host cell strain/line and expression vectors may be chosen such that the action of the promoter is inhibited until specifically induced. For example, in certain operons the addition of specific inducers is necessary for efficient transcription of the inserted DNA (e. g., the lac operon is induced by the addition of lactose or isopropylthio-beta-D-galactoside). A variety of operons such as the trp operon, are under different control mechanisms. The trp operon is induced when tryptophan is absent in the growth media. The PL promoter can be induced by an increase in temperature of host cells containing a temperature sensitive lambda repressor. In this way, greater than 95% of the promoter-directed transcription may be inhibited in uninduced cells. Thus, expression of recombinant PrtR-PrtK protein may be controlled by culturing transformed or transfected cells under conditions such that the promoter controlling the expression from the inserted DNA encoding PrtR-PrtK amino acid sequences is not induced, and when the cells reach a suitable density in the growth medium, the promoter can be induced for expression from the inserted DNA.
[0068] Other control elements for efficient gene transcription or message translation include enhancers, and regulatory signals. Enhancer sequences are DNA elements that appear to increase transcriptional efficiency in a manner relatively independent of their position and orientation with respect to a nearby gene. Thus, depending on the host cell expression vector system used, an enhancer may be placed either upstream or downstream from the inserted DNA sequences encoding PrtR-PrtK amino acid sequences to increase transcriptional efficiency. These or other regulatory sites, such as transcription or translation initiation signals, can be used to regulate the expression of the gene encoding PrtR-PrtK. Such regulatory elements may be inserted into DNA sequences encoding PrtR-PrtK amino acid sequences or nearby vector DNA sequences using recombinant DNA methods described herein for insertion of DNA sequences.
[0069] Accordingly, P. gingivalis nucleotide sequences containing regions encoding for PrtR-PrtK, can be ligated into an expression vector at a specific site in relation to the vector's promoter, control, and regulatory elements so that when the recombinant vector is introduced into the host cell the P. gingivalis-specific DNA sequences can be expressed in the host cell. For example, the PrtR-PrtK specific DNA sequences containing their own regulatory elements can be ligated into an expression vector in a relation or orientation to the vector promoter and control elements which will allow for co-expression of the PrtR and PrtK. The recombinant vector is then introduced into the appropriate host cells, and the host cells are selected, and screened for those cells containing the recombinant vector. Selection and screening may be accomplished by methods known in the art including detecting the expression of a marker gene (e.g , drug resistance marker) present in the plasmid, immunoscreening for production of PrtR-PrtK specific epitopes using antisera generated to PrtR-PrtK specific epitopes, and probing the DNA of the host's cells for PrtR-PrtK specific nucleotide sequence using one or more oligonucleotides and methods described herein.
[0070] Genetic engineering techniques may also be used to characterize, modify and/or adapt the encoded PrtR-PrtK protein. For example, site-directed mutagenesis to inactivate the protease domains of the PrtR-PrtK and to modify the protein in regions outside the protective domains, may be desirable to increase the safety and solubility.
[0071] In particular the host organism for the vector containing the PrtR-PrtK genes and constructs can be a commensal inhabitant of the oral cavity; for example an inhabitant of subgingival plaque, supragingival plaque or a bacterium associated with the oral mucosa. Examples of commensal intra-oral bacteria would be Streptococcus species and Actinomyces species, eg. Streptococcus salivarius, Streptococcus sanguis, Actinomyces naeslundii. These organisms can be isolated from the periodontitis patient and then genetically engineered to express the inactivated PrtR-PrtK. The DNA encoding the PrtR-PrtK could be linked with DNA encoding leader sequences of extracellular proteins of these commensal intra-oral bacteria. The DNA encoding the PrtR-PrtK could also be linked with, or inserted into, the DNA encoding extracellular proteins to produce secreted fusion proteins. Examples of extracellular proteins that could be used to produce fusion proteins with the inactivated PrtR-PrtK could be the glucosyltranferases (GTF) or fructosyltransferases (FTF). The recombinant organism would be then re-introduced into the patients oral cavity and once colonised the oral mucosa or teeth would express the inactivated PrtR-PrtK to stimulate the mucosal associated lymphoid tissue to produce neutralising antibodies.
[0072] Due to the conservation of the genes encoding PrtR-PrtK, the nucleic acid sequences of the present invention can be used in molecular diagnostic assays for detecting P. gingivalis genetic material. In particular, PrtR-PrtK sequence-specific oligonucleotides can be synthesized for use as primers and/or probes in amplifying, and detecting amplified, nucleic acids from P. gingivalis. Recent advances in molecular biology have provided several means for enzymatically amplifying nucleic acid sequences. Currently the most commonly used method, PCR® (polymerase chain reaction Cetus Corporation) involved the use of Taq Polymerase, known sequences as primers, and heating cycles which separate the replicating deoxyribonucleic acid (DNA) strands and exponentially amplify a gene of interest. Other amplification methods currently under development include LCR® (ligase chain reaction, BioTechnica International) which utilizes DNA ligase, and a probe consisting of two halves of a DNA segment that is complementary to the sequence of the DNA to be amplified, enzyme QB replicase (Gene-Trak Systems) and a ribonucleic acid (RNA) sequence template attached to a probe complementary to the DNA to be copied which is used to make a DNA template for exponential production of complementary RNA; and NASBA® (nucleic acid sequence-based amplification, Cangene Corporation) which can be performed on RNA or DNA as the nucleic acid sequence to be amplified.
[0073] Nucleic acid probes that are capable of hybridization with specific gene sequences have been used successfully to detect specific pathogens in biological specimens at levels of sensitivity approaching 103-104 organisms per specimen (1990, Gene Probes for Bacteria, eds Macario and deMacario, Academic Press). Coupled with a method that allows for amplification of specific target DNA sequences, species-specific nucleic acid probes can greatly increase the level of sensitivity in detecting organisms in a clinical specimen. Use of these probes may allow direct detection without relying on prior culture and/or conventional biochemical identification techniques. This embodiment of the present invention is directed to primers which amplify species-specific sequences of the genes encoding PrtR-PrtK of P. gingivalis, and to probes which specifically hybridize with these amplified DNA fragments. By using the nucleic acid sequences of the present invention and according to the methods of the present invention, as few as one P.gingivalis organism may be detected in the presence of 10 ug/ml extraneous DNA.
[0074] DNA may be extracted from clinical specimens which may contain P. gingivalis using methods known in the art. For example, cells contained in the specimen may be washed in TE buffer and pelleted by centrifugation. The cells then may be resuspended in 100 ul of amplification reaction buffer containing detergents and proteinase K. Using the polymerase chain reaction, the resultant sample may be composed of the cells in 10 mM Tris pH 8.3, 50 mM KCl, 1.5 mM MgCl2, 0.01% gelatin, 0.45% NP40®, 0.045% Tween 20®, and 60 ug/ml proteinase K. The sample is incubated in a 55° C. water bath for 1 hour. Following the incubation, the sample is incubated at 95° C. for 10 minutes to heat-inactivate the proteinase K. The sample may then be amplified in accordance with standard PCR protocols.
[0075] The following examples are further illustrative of the nature of the present invention, but it is understood that the invention is not limited thereto. All amounts and proportions referred to herein are by weight unless otherwise indicated.
Example 1
(1) Preparation of Antigen
A. Anion Exchange and Affinity Chromatography
[0076] P. gingivalis W50 was grown anaerobically at 37° C. on lysed horse blood agar and in modified BM media containing 1 μg/ml hemin. Bacteria were maintained on lysed horse blood plates by routine passage (<10 passages) and used to inoculate batch cultures. Batch culture growth in Brain Heart Infusion medium was monitored at 650 nm using a spectrophotometer (295E, Perkin-Elmer). Culture purity was checked routinely by Gram stain, microscopic examination and by using a variety of biochemical tests. Stocks were maintained as lyophilised cultures. A culture of P. gingivalis was grown to late logarithmic phase and the cells harvested by centrifugation (5,000×g, 20 min, 4° C.) and then resuspended in 160 ml TC buffer (20 mM Tris-HCl pH 7.4 and 5 mM CaCl2) containing 50 mM NaCl and subjected to mild sonication using a Branson Sonifier 250 with an output control of 3 and a 50% duty cycle for 15 min at 4° C. The sonicate was centrifuged (100,000×g, 30 min, 4° C.) and the supernatant filtered (0.22 μm) prior to anion-exchange FPLC. The sonicate was applied to an anion-exchange column (Hiload XK 16/10 Q Sepharose, Pharmacia-LKB) cooled to 4° C., in multiple injections using a 50 ml superloop (Pharmacia-LKB). The sample was eluted using a linear gradient from 0-100% buffer B over 90 min at a flow rate of 2.0 ml min-1. The eluant was monitored at 280 nm and collected in 6 ml fractions using a Frac 100 fraction collector (Pharmacia-LKB). Buffer A was TC buffer containing 50 mM NaCl and buffer B was TC buffer containing 500 mM NaCl. Fractions were analysed for proteolytic and amidolytic activity using azocasein (A-2765, Sigma Chemical Co. St Louis, Mo.), benzoyl-L-Arg-p-nitroanilide (Bz-L-Arg-pNa, Sigma) and benzyloxycarbonyl-L-Lys-p-nitroanilide (Z-L-Lys-/pNa, Calbiochem, Melbourne, Australia) vide infra. Anion-exchange fractions containing the majority of proteolytic/amidolytic activity were pooled, washed and then concentrated in TC buffer containing 150 mM NaCl using a centricon 10 micro-concentrator (Amicon). The sample was then divided into four aliquots and each was independently applied to a gel filtration column (Superose 12, HR 10/30, Pharmacia-LKB) using TC buffer containing 150 mM NaCl at a flow rate of 0.3 ml min-1. The eluant was monitored at 280 nm and peaks collected using a Frac 100 fraction collector. The M.sub.τ values of eluant peaks were determined using molecular mass gel filtration standards (Pharmacia-LKB) The peak containing the majority of the proteolytic/amidolytic activity was concentrated using a centricon 10 micro-concentrator and then applied at a flow rate of 0.1 ml min-1 to an Arg-sepharose column (5 ml arginine-Sepharose 4B beads, HR 5/5 column, Pharmacia-LKB) and the unbound material collected. The column was washed with 500 mM NaCl and re-equilibrated with TC buffer containing 50 mM NaCl. The column was first eluted with 200 mM lysine-HCl pH 7.4 in TC buffer containing 50 mM NaCl at a flow rate of 0.1 ml min-1. This was followed by 750 mM lysine-HCl pH 7.4 in the same buffer. The column was then re-equilibrated with TC buffer containing 50 mM NaCl and then eluted with 200 mM arginine-HCl pH 7.4 in TC buffer containing 50 mM NaCl at a flow rate of 0.1 ml min-1. The unbound material collected was then re-applied to the Arg-sepharose column and the elution steps repeated. This sequence was repeated until all proteolytic activity had bound to the column. The eluant was monitored at 280 nm and peaks collected using a Frac 100 fraction collector. The peaks eluted from the Arg-sepharose by 200 mM lysine and 200 mM arginine were equilibrated with TC buffer containing 50 mM NaCl and 1.0% octyl-β-D-glucopyranoside and then applied to a Mono Q (HR 5/5) anion-exchange column and eluted using a linear gradient of 0-100% buffer B at a flow rate of 1.0 ml min-1.
[0077] Buffer A was TC buffer containing 50 mM NaCl and 0.1% octyl-β-D-glucopyranoside and buffer B was TC buffer containing 500 mM NaCl and 0.1% octyl-β-D-glucopyranoside. The eluant was monitored at 280 nm and eluant peaks collected using a Frac 100 fraction collector.
[0078] Azocasein, and Bz-L-Arg-p-Na and z-L-lys-pNa were used to routinely assay FPLC fractions for proteolytic and amidolytic activity. A sample of each fraction (20-200:1) was incubated at 37° C. with azocasein (5 mg/ml final concentration) in TC buffer pH 8.0 containing 150 mM NaCl and 10 mM cysteine. For azocasein the reaction was stopped by the addition of 30% trichloroacetic acid at 4° C. Samples were centrifuged and the A440 of the supernatant measured using a spectrophotometer (Perkin Elmer, model 552).
[0079] For the synthetic chromogenic substrates samples of each chromatographic fraction (5-50:1) were incubated at 37° C. with Bz-L-Arg-pNa or z-L-Lys-pNa (1.0 mM final concentration) in a total volume of 350:1 100 mM Tris-HCl pH 8.0 buffer containing 150 mM NaCl, 10 mM cysteine and 5 mM CaCl2. Inhibitors and activators were added to the purified enzymes in 100 mM Tris-HCl pH 8.0 buffer containing 150 mM NaCl. Absorbance was measured at 410 nm in a Hewlett Packard 8452A Diode Array spectrophometer and the amidolytic activity expressed in U, where U=μmol substrate converted min-1 at 37° C. Trypsin (E.C.3.4.21.4, T 8253 Sigma) was used as a standard. The protein concentration of FPLC fractions and purified samples was determined using the Bradford protein assay (Biorad) with BSA as a standard. A sample of the gel filtration chromatographic fraction (20 μl) exhibiting the major proteolytic and amidolytic activity was incubated for 4 h at 37° C. with 10 mg/ml of pure α.sub.s1-casein dissolved in TC buffer pH 8.0 containing 150 mM NaCl and 50 mM 2-mercaptoethanol. Following incubation the sample was equilibrated in 0.1% TFA (v/v) dissolved in Milli Q water (Buffer A). The sample was then applied to an HPLC reversed phase analytical column (C8, 7 μm, 4.6 mm×220 mm, Applied Biosystems Inc. Brownlee Aquapore RP 300) and peptides eluted using a linear gradient from 0-100% buffer B over 40 min at a flow rate of 1 ml min-1 (140A solvent delivery system). Buffer B was 80% acetonitrile (v/v) in 0.1% (v/v) TFA in Milli Q water. The eluant was monitored at 214 nm using a 1000S diode array detector (Applied Biosystems). Peaks were collected manually and peptides identified using a combination of amino acid composition and sequence analyses as described previously.
[0080] SDS-PAGE was performed using a Mini protean II electrophoresis system (Biorad) with 12% (w/v), 1 mm separating gels, overlaid with 5% stacking gels (Laemmli, 1970) [Nature 277:680-685]. Two volumes of each sample were mixed with one volume of buffer [0.5 M Tris-HCl, pH 6.8, 5% v/v 2-mercaptoethanol, 10.0% w/v SDS, 0.05% w/v bromophenol blue (75% v/v) and glycerol (25% v/v)] and heated to 100° C. for 4 min unless otherwise stated. SDS-PAGE was performed at room temperature using a current of 30-50 mA and a potential difference of ≦200 V. For silver staining, gels were fixed in methanol/water/acetic acid (45/45/10, v/v/v), washed in Milli Q water, reduced with 5 μg/ml dithiothreitol and then washed in Milli Q water, all for 30 min periods. Gels were then stained for 20 min with 0.1% w/v AgNO3 and developed with 3% w/v sodium carbonate containing 0.1% v/v formaldehyde and development stopped with glacial acetic acid. For Coomassie blue staining, gels were fixed in 12% TCA and stained overnight using 0.1% (w/v) purified Coomassie brilliant blue G 250 in 2% (w/v) phosphoric acid, 6% (w/v) ammonium sulphate. Gels were destained with methanol/water/acetic acid (50/40/10, v/v/v). Proteins were transferred onto a PVDF membrane (Problott, Applied Biosystems Inc. (ABI)) for sequence analysis using a transblot cell (Biorad). PVDF membrane was wetted in 100% methanol and soaked in transfer buffer (10 mM CAPS/10% methanol, pH 11.5). Transfer was performed using a potential difference of 60 V (300 mA) for 90 min. Membranes were briefly stained using 0.1% (w/v) Coomassie brilliant blue R 250 in methanol/water/acetic acid (5/5/1, v/v/v). Protein bands were excised, destained for 10-30 sec in 50% methanol and then the N-terminal sequence determined using a Hewlett Packard 10005A protein sequencer or a modified ABI 471-02A protein sequencer fitted with a blott cartridge.
[0081] The ultrasonication procedure was effective at releasing the cell-associated Arg- and Lys-specific proteolytic activity of P. gingivalis W50 and 15 min was required for maximal release of activity. The sonicate of P. gingivalis W50 cells contained 0.30 mg ml-1 protein and 2.6 and 2.3 μmol min-1 mg protein-1 activity with 1.0 mM Bz-L-Arg-pNA and z-L-Lys-pNA as substrate respectively at 37° C. The crude sonicate was subjected to Q-sepharose anion exchange FPLC and a representative chromatogram is presented in FIG. 1. Proteolytic/amidolytic activity eluted as one major peak between 246-320 mM NaCl (FIG. 1) which was collected, concentrated using a centricon-10 (Amicon) and then applied to the Superose 12 gel filtration column (FIG. 2). Molecular mass gel filtration standards were used to determine the Mr of the peaks obtained and the major peak, which also exhibited the major proteolytic/amidolytic activity, corresponded to 300 kDa (FIG. 2). Proteolytic/amidolytic activity was also associated with the high molecular mass material (0.6->2.0×106 Da) eluted from the gel filtration column. The 300 kDa gel filtration peak contained seven bands at 48, 45, 44, 39, 27, 17 and 15 kDa on SDS-PAGE analysis (FIG. 3). The seven bands were transblotted and subjected to N-terminal sequence analysis (Table 1). This analysis revealed that the 44 kDa band contained two proteins and the N-terminal sequences of these two 44 kDa proteins were assigned after further purification. The N-terminal sequence of one of the 44 kDa proteins was identical to that of the 17 kDa protein and the 39 kDa and 27 kDa proteins also had identical N-termini (Table 1).
TABLE-US-00002 TABLE 1 N-terminal sequences of proteins in the 300 kDa complex separated by SDS-PAGE Band N-terminal sequence (kDa) 48* DVYTDHGDLYNTPVRML (SEQ ID NO: 1) 45.sub.† YTPVEEKQNGRMIVIVAKKYEGD (SEQ ID NO: 2) 44.sub.† SGQAEIVLEAHDVWNDGSGYQILLDADHDQYGQVIPSDTHFL (SEQ ID NO: 3) 44* PQSVWIERTVDLPAGTKYVAFR (SEQ ID NO: 4) 39* ANEAKVVLAADNVWGDNTGYQFLLDA (SEQ ID NO: 5) 27.sub.† ANEAKVVLAADNVWGDNTGYQFLLDA (SEQ ID NO: 6) 17.sub.† PQSVWIERTVDLPAGTKYVAFR (SEQ ID NO: 7) 15*.sub.† ADFTETFESSTHGEAPAEWTTIDA (SEQ ID NO: 8) *Proteins eluted from Arg-sepharose by 200 mM lysine .sub.†Proteins eluted from Arg-sepharose by 200 mM arginine.
[0082] Repeated gel filtration analyses of the Q-sepharose purified material or crude sonicates indicated that the major proteolytic/amidolytic activity was associated with a peak corresponding to 300 kDa and higher molecular mass (0.6->2×106 Da) material that when boiled in SDS and subjected to SDS-PAGE analysis contained the same seven bands at 48, 45, 44, 39, 27, 17 and 15 kDa (FIG. 3).
[0083] The 300 kDa gel filtration protein complex was incubated with α.sub.s1-casein. The α.sub.s1-casein peptides released by the action of the proteolytic activity of the 300 kDa complex were purified by RP-HPLC and identified by amino acid composition and sequence analyses. The sites of α.sub.s1-casein cleavage by the material of the 300 kDa complex were the carboxyl side of arginyl and lysyl residues only (FIG. 4). All arginyl and lysyl residues of α.sub.s1-casein were cleaved except the N-terminal Arg and the Lys residues flanking the Ser(P) cluster sequence, presumably due to the high negative charge density (FIG. 4). The 300 kDa complex was then applied to an Arg-sepharose column and washed with TC buffer containing 500 mM NaCl (FIG. 5). The Arg-sepharose was eluted first with 200 mM lysine in TC buffer (FIG. 5) which eluted a small amount of the 48 kDa, 44 kDa, 39 kDa and 15 kDa proteins of the 300 kDa complex as shown by SDS-PAGE (FIG. 6 and Table 1). N-terminal sequence analysis of these transblotted proteins revealed that only one of the 44 kDa proteins of the 300 kDa complex was eluted with 200 mM lysine (Table 1). This fraction eluted from Arg-sepharose with 200 mM lysine contained only Lys-specific proteolytic/amidolytic activity. Next the Arg-sepharose column was eluted with 750 mM lysine (FIG. 5) which removed the majority of the protein bound as the undissociated 300 kDa complex containing all seven bands (eight proteins) as shown by SDS-PAGE analysis (FIG. 7). The 750 mM lysine eluant exhibited both Arg- and Lys-specific proteolytic/amidolytic activity characteristic of the 300 kDa complex. The Arg-sepharose column was then eluted with 200 mM arginine in TC buffer (FIG. 5). The 200 mM arginine eluant contained small amounts of the 45, 44, 27, 17 and 15 kDa proteins as shown by SDS-PAGE (FIG. 7). This fraction exhibited only Arg-specific proteolytic/amidolytic activity. N-terminal sequence analysis of these transblotted proteins eluted with 200 mM arginine revealed that only one of the 44 kDa proteins of the 300 kDa complex was eluted with 200 mM arginine and this 44 kDa protein was different to the 44 kDa protein eluted with 200 mM lysine (Table 1).
[0084] The proteins eluted from the Arg-sepharose column with 200 mM lysine and 200 mM arginine were washed, concentrated and equilibrated with TC buffer containing 50 mM NaCl and 1.0% octyl-β-D-glucopyranoside and applied independently to a Mono Q anion exchange column. Elution from the Mono Q column with a NaCl gradient associated the Arg-specific proteolytic activity with the 45 kDa protein with a 25 fold purification over the original crude sonicate (Table 2, FIG. 7). The specificity of the 45 kDa proteinase for arginyl residues was confirmed by the enzyme cleaving Bz-L-Arg-pNA but not z-L-Lys-pNA. The Arg-specific 45 kDa enzyme was activated by thiols (particularly cysteine), not inhibited by PMSF or AEBSF but inhibited by sulphydryl-directed reagents, leupeptin and EDTA (Table 3). The inhibition by EDTA could be reversed by the addition of Ca2- (Table 3). The pH optimum of the enzyme was 7.5-80 and activity dropped off dramatically as the pH was lowered below 7.0. These results indicate that the 45 kDa enzyme is a calcium-stabilized, Arg-specific cysteine endopeptidase. The Lys-specific activity was characterized using the substrate Z-L-Lys-pNA and was associated with the 48 kDa protein purified from the 200 mM lysine eluant by Mono Q FPLC. The Lys-specific enzyme was also activated by thiols and inhibited by sulphydryl-directed reagents but was not inhibited by leupeptin or EDTA Non-reducing SDS-PAGE without boiling of the 300 kDa complex produced bands corresponding to the relative molecular masses of approximately 300, 150, 104, 88, 76 and 66 kDa.
TABLE-US-00003 TABLE 2 Purification of the 45 kDa Arg-specific proteinase PrtR45 Proteolytic Specific Protein activity activity Purification Step (mg) (U*) U mg-1 fold Yield % Sonicate 48.0 124 2.6 1 100 Anion Exchange 8.2 64 7.8 3 52 FPLC (Q- sepharose) Gel filtration 3.9 46 11.8 5 37 FPLC (Superose 12) Affinity FPLC 0.7 17 24.3 9 14 (Arg-sepharose) Anion exchange 0.2 13 65.0 25 11 FPLC (mono Q) *Amidolytic activity using 1.0 mM Bz-L-Arg-pNA, 1 unit = μmol min-1 at 37° C.
TABLE-US-00004 TABLE 3 Effects of various activators/inhibitors on the activity of the 45 kDa Arg-specific proteinase Concentration Activity Compound (mM) (%) 2-mercaptoethanol 1.0 100 10.0 158 50.0 189 Dithiothreithol 1.0 109 10.0 174 L-cysteine 0.1 183 1.0 320 10.0 487 PMSF*.sup.† 1.0 100 10.0 90 AEBSF*.sup.† 1.0 93 10.0 80 Iodoacetic acid.sup.† 1.0 82 10.0 19 PCMB*.sup.† 1.0 100 10.0 14 Leupeptin.sup.† 0.1 0 EDTA.sup.† 1.0 100 10.0 4 50.0 0 +Ca2+ 50.0 97 o-phenanthroline.sup.† 10.0 100 *PCMB, p-chloromercuribenzoic acid; PMSF, phenylmethyl sulfonyl fluoride, AEBSF, [4-(2-aminoethyl)-benzenesulfonylfluoride] .sup.†These incubations also contained 1.0 mM 2-mercaptoethanol.
[0085] The 45, 27, 17, 15 kDa and one of the 44 kDa protein components of the 300 kDa complex are encoded by the gene the PrtR as presented schematically in FIG. 8a. The complete nucleotide sequence and deduced amino acid sequence of the PrtR is shown in FIG. 8b. Each PrtR component is preceded by an arginyl or lysyl residue (FIG. 8a, b) indicating that the polyprotein is processed by trypsin-like proteolytic specificity. We have designated these component parts of the 300 kDa complex, by their relative molecular masses as determined by SDS-PAGE, as the PrtR45, PrtR44, PrtR27, PrtR17 and PrtR15 which fit well with the predicted sizes from the deduced PrtR amino acid sequence (53.9, 44.8, 29.5, 17.5 and 14.3 kDa respectively). The 44 kDa protein, the PrtR44, has been disclosed by previous workers as a culture fluid hemagglutinin/adhesin (Pike et al., 1994) [J Biol Chem 269:406-411]. The PrtR44 has homology with the other non-proteinase components of the multiprotein complex suggesting a similar role for the PrtR27, PrtR17 and PrtR15 in interacting with the protease and/or in hemagglutination or adhesion. The PrtR45 Arg-specific endopeptidase component of the PrtR complex has the same characteristics and N-terminal sequence as the 50 kDa Arg-specific proteinase identified in the culture supernatant of P. gingivalis H66 by Chen et al. (1992) [J Biol Chem 267:18896-18901] designated Arg-gingipain.
[0086] The other proteins of the 300 kDa complex, the 48 kDa Lys-specific proteinase, the other 44 kDa protein and the 39 kDa and 15 Da proteins are encoded by a single gene the prtK presented schematically in FIG. 9a. The complete nucleotide sequence and deduced amino acid sequence of the PrtK is shown in FIG. 9b. The prtK is similar to the prtR in that it encodes a putative leader sequence, a prosequence followed by the proteinase domain which is then followed by sequence-related adhesins that have high homology with the C-terminal adhesins of the prtR. We have designated the 48 kDa Lys-specific proteinase the PrtK48 and its associated adhesins the PrtK39, PrtK15 and PrtK44 (FIG. 9a, b) based on the sizes measured by SDS-PAGE which fit reasonably well with the predicted sizes from the deduced PrtK amino acid sequence (55.9, 44.8, 14.3 and 47.9 kDa respectively). The PrtK48 has the same enzyme characteristics as the 48 kDa proteinase purified from the culture supernatant of P. gingivalis 33277 by Fujimura et al. (1993) [Infect Immun 55:716-720]. The PrtK48 also has the same N-terminal sequence and enzyme characteristics as the 60 kDa Lys-specific endopeptidase previously purified from the culture fluid of P. gingivalis H66 by Pike et al (1994) [J Biol Chem 269:406-411] and designated Lys-gingipain. The PrtK39, PrtK 15 and PrtK44 are all sequence-related and have high homology with the PrtR hemagglutinins/adhesins particularly the 15 kDa protein which is identical in both gene products suggesting that these proteins also are hemagglutinin/adhesins.
[0087] As the 300 kDa proteinase-adhesin complex and higher molecular mass forms are composed of proteins from the two genes, the prtR and prtK, we suggest that they be designated PrtR-PrtK complexes. The deduced molecular mass of the mature PrtR is 160 kDa (FIG. 9a, b) and mature PrtK is 163 kDa (FIG. 9b) such that the mass of the PrtR-PrtK heterodimer would be 323 kDa which is in good agreement with the Mr determined by gel filtration and non-boiling SDS-PAGE. SDS-PAGE of the sample after boiling produced the seven bands of 48, 45, 44, 39, 27, 17 and 15 kDa corresponding to the domains of the two gene products, the PrtR and PrtK. These domains were only seen when the sample was boiled, with or without reducing agent, suggesting that the domains remain tightly non-covalently associated after proteolytic processing. The cell sonicate and the chromatographic fractions had minimal or no proteolytic activity in the absence of reducing agents thus ensuring minimal enzymic activity during the chromatographic purifications. The characterization of the 300 kDa cell-associated complex as being composed of processed domains of the two genes the prtR and prtK suggests that the secreted, mature PrtR and PrtK proteins associate and then are processed, perhaps autolytically. The identification of several of the domains of the PrtR and PrtK in the culture supernatant by independent groups is consistent with the proteolytic (autolytic) processing of these polyproteins.
[0088] The relative molecular mass of the processed PrtR-PrtK complex is likely to be attributable to the composition of 1 PrtK48+1 PrtR45+1 PrtR44+1 PrtK39+1 PrtK44+1 PrtR27+1 PrtR17+1 PrtK15+1 PrtR15=294-323 kDa depending on C-terminal truncation, that is the 300 kDa complex would contain the five domains of the prtR and the four domains of the prtK gene products (FIGS. 8 and 9). As high Mr material (0.6->2×106 Da) on gel filtration (FIG. 2) was also composed of the seven PrtR-PrtK bands then this suggests that the 300 kDa PrtR-PrtK complexes may further associate to form larger cell-associated aggregates. The high amino acid sequence homology between the PrtR44, PrtK39, PrtK44, PrtR27, PrtR17 and the 15 kDa protein of both the PrtR and PrtK suggests that these adhesins are responsible for the non-covalent cohesive interactions between the components of the PrtR-PrtK complexes and between the complexes themselves in the larger aggregates. It is interesting to note that some dissociation of the 300 kDa PrtR-PrtK complex occurred during the affinity chromatography on Arg-sepharose, although the majority of the protein eluted as the undissociated complex with 750 mM lysine The partial dissociation of the complex on binding to substrate may be a mechanism by which the complex targets specific host macromolecules and cells releasing the proteinase/adhesin domains at the target site on binding.
[0089] This example describes the purification of a novel cell associated complex of Arg-specific and Lys-specific proteinases and sequence-related adhesins encoded by the two genes, the prtR and prtK.
B. Ultrafiltration and Diafiltration
[0090] P. gingivalis W50 was grown anaerobically at 37° C. on lysed horse blood agar and in modified BM media containing 1 μg/ml hemin. Bacteria were maintained on lysed horse blood plates by routine passage (<10 passages) and used to inoculate batch cultures. Batch culture growth in Brain Heart Infusion medium was monitored at 650 nm using a spectrophotometer (295E, Perkin-Elmer). Culture purity was checked routinely by Gram stain, microscopic examination and by using a variety of biochemical tests. Stocks were maintained as lyophilised cultures. A culture of P. gingivalis was grown to late logarithmic phase and the cells harvested by centrifugation (5,000×g, 20 min, 4° C.). Chloroform was added to the cell pellet and after gentle mixing the suspension was left for 15 min at room temperature. Following chloroform treatment, 20 mM Tris-HCl pH 8.0 buffer containing 50 mM NaCl was added and gently mixed. This mixture was then centrifuged (100,000×g, 30 min, 4° C.) and the supernatant diafiltered through a 100,000 M, cut-off membrane (Amicon) with five volumes of distilled water. This purifies and inactivates by oxidation the 294-323 kDa PrtR-PrtK which is freeze dried and used as an immunogen. The PrtR-PrtK purified by diafiltration was composed of 48, 45, 44, 39, 27, 17 and 15 kDa components as shown by SDS-PAGE (FIG. 10).
(2) Preparation of Antibodies
[0091] Polyclonal antiserum to PrtR-PrtK was raised in a rabbit by immunizing with the O2-inactivated PrtR-PrtK subcutaneously. The rabbit was immunized at day 0 with 40 μg of protein in incomplete Freund's adjuvant, day 14 with 90 μg of protein in incomplete Freund's adjuvant, and day 28 with 60 μg of protein in incomplete Freund's adjuvant. Immunizations were carried out using standard procedures. Polyclonal antisera having a high titre against P. gingivalis was obtained. If desired the antibodies directed specifically against P. gingivalis can be obtained using standard procedures.
Example 2
[0092] Methods and compounds for vaccine formulations related to PrtR-PrtK.
[0093] This embodiment of the present invention is to provide PrtR-PrtK protein to be used in as an immunogen in a prophylactic and/or therapeutic vaccine for active immunization to protect against or treat infections caused by P. gingivalis. For vaccine purposes, an antigen of P. gingivalis comprising a bacterial protein should be immunogenic, and induce functional antibodies directed to one or more surface-exposed epitopes on intact bacteria, wherein the epitope(s) are conserved amongst strains of P. gingivalis.
[0094] In one illustration of the PrtR-PrtK protein having the properties desirable of a vaccine antigen, the protein was purified from P. gingivalis using the method described herein in Example 1. Mice were immunized with the purified inactivated PrtR-PrtK protein (25 μg) with adjuvant (20 ug of QS21) two times at four week intervals. The purified PrtR-PrtK was inactivated by air oxidation. Blood from the immunized mice was drawn 32 days after the last immunization and the immune sera was pooled. The pooled immune sera was assayed against whole bacteria (P. gingivalis strain W50) by an enzyme linked immunosorbent assay (ELISA). For the whole cell ELISA, overnight cultures of bacteria were harvested by a swab and suspended in PBS to an absorbance of 0.1 at 600 nm. Aliquots (100 μl) of the bacterial suspension were added to the wells of a 96 well microtiter plate and dried overnight at room temperature. The plates were blocked with 100 μI of 0.1% (w/v) gelatin in PBS. This, and all remaining incubations, were for one hour at room temperature unless otherwise specified. The blocking solution was removed and 100 μl of the immune sera, diluted in PBS with 0.1% (w/v) gelatin, was added to the wells and incubated. After washing three times with PBS, the bound antibodies were detected by incubating with 100 μl of alkaline phosphatase conjugated recombinant protein G (1:1500 in PBS with 0.1% (w/v) gelatin). The plates were washed and colour development was facilitated by the addition of 100 μl/well of p-nitrophenyl phosphate (2 mg/ml in diethanolamine). After 30 minutes, the reaction was stopped by adding 50 μl of 3M NaOH. The absorbance was read at 492 nm using an ELISA reader. Endpoint titers were determined as the reciprocal of the dilution at which the absorbance was greater than that of the blank wells. The results demonstrated that immunization with inactivated PrtR-PrtK elicit antibodies which can bind to one or more surface-exposed epitopes on intact P. gingivalis.
[0095] Additional evidence supporting the immunogenicity of the PrtR-PrtK protein comes from a study of the human immune response to the PrtR-PrtK of P. gingivalis in which 86% of 43 patients with adult periodontitis had specific IgG in their sera to the PrtR-PrtK.
[0096] Another illustration of a desirable vaccine antigen is the O2-inactivated PrtR-PrtK. It has been demonstrated that the cell surface PrtR-PrtK is the target of bactericidal antibody generated from immunization with the inactivated protein. Polyclonal antiserum to PrtR-PrtK was raised in a rabbit by immunizing with the inactivated PrtR-PrtK subcutaneously. A rabbit was immunized at day 0 with 40 μg of protein in incomplete Freund's adjuvant, day 14 with 90 μg of protein in incomplete Freund's adjuvant, and day 28 with 60 μg of protein in incomplete Freund's adjuvant. The resultant antiserum was tested for its bactericidal activity against strain W50 of P. gingivalis. The bacteria were grown to logarithmic phase in brain-heart infusion (BHI) broth. An aliquot of the bacterial culture was diluted to 5×104 colony forming units (CFU) per ml in 10% bovine serum albumin in a balanced salt solution. The bactericidal assay reaction contained bacteria, polyclonal antiserum to inactivated PrtR-PrtK protein, a complement source consisting of normal human serum which was absorbed with protein G to remove antibodies, and the balanced salt solution. All reagents were added to the reaction to yield a 250 μl volume. Aliquots of 25 μl of the reaction were removed and plated in triplicate on BHI agar at times 0 and 60 minutes. The plates were incubated and colonies were counted the next day. The percent killing was calculated using the average of the three triplicate values at the 2 times. A representative example of data generated by the bactericidal assays is shown in Table 4. The results indicate that the polyclonal antiserum raised to the inactivated PrtR-PrtK is bactericidal for P. gingivalis. As illustrated by Table 4, controls show that the antiserum does not kill bacteria in the absence of complement, and that the complement source does not kill the bacteria in the absence of the antiserum, indicating that the bactericidal activity is antibody directed and complement mediated.
TABLE-US-00005 TABLE 4 Bactericidal activity of anti-(PrtR-PrtK) antibody CFU at CFU at Percent Sample Antiserum Complement time 0 time 60 killing 1 10 μl 22 μl 225 0 100% 2 10 μl 0 227 390 0% 3 0 22 μl 254 286 0%
[0097] In further illustrating that the PrtR-PrtK protein possesses properties desirable of a vaccine antigen, pooled immune sera raised to strain W50 was shown to have cross-reactivity with heterologous strains. The pooled immune sera, prepared against PrtR-PrtK protein as described above, was examined for cross-reactivity with nine P. gingivalis strains from diverse clinical and geographical sources. Bacteria from each culture were harvested by swabs and suspended in PBS to an optical absorbance of 1.0 at 600 nm. A microliter of each suspension was applied to a nitrocellulose membrane and allowed to dry. The membrane was incubated one hour at room temperature in a solution of 5% non-fat dry milk in PBS to block the residual binding sites of the membrane. The membrane was washed twice with PBS, and then immersed in the blocking solution containing the immune sera diluted to 1:1000. The membrane was incubated with the antibody overnight at 46° C. with gentle shaking. The membrane was washed three times with PBS and then incubated for 2 hours at room temperature with alkaline phosphatase conjugated recombinant protein G (1:1500 in PBS with 5% non-fat dry milk). The membrane was washed three times with PBS and bound antibody was detected by the addition of substrate. The immune sera reacted with all strains as strongly, or to a greater extent than, strain W50. Thus, the antibodies elicited by immunization of the PrtR-PrtK protein isolated from strain W50 cross-reacted with all heterologous strains tested.
[0098] For vaccine development, PrtR-PrtK may be purified from a host containing a recombinant vector which expresses PrtR-PrtK Such hosts include, but are not limited to, bacterial transformants, yeast transformants, filamentous fungal transformants, and cultured cells that have been either infected or transfected with a vector which encodes PrtR-PrtK. Many methods are known for the introduction of a vaccine formulation into the human or animal to be vaccinated. These include, but are not limited to, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, ocular, intranasal, and oral administration. The vaccine may further comprise a physiological carrier such as a solution, a polymer or liposomes; and an adjuvant, or a combination thereof.
Example 3
[0099] Protective Efficacy of Immunisation with the PrtR-PrtK Complex in an Animal Model.
[0100] Various preparations of purified P. gingivalis proteins were tested in the mouse abscess model. This model is loosely based on the methods described by Kesavalu et al (1992) [Infect Immun 60:1455-1464]. A typical experiment is outlined below. Briefly BALB/c mice were obtained from ARC (Perth, Australia) and were immunised subcutaneously in the scruff of the neck with the preparations and doses according to Table 5 before challenge with live P. gingivalis strain W50, which was given at 10 weeks of age. Mice were given 2 doses of vaccine at 4 and 1 weeks before challenge. Formalin killed P. gingivalis W50 cells were prepared by incubating an aliquot of cells in 0.5% (vol/vol) of buffered formal saline overnight at 4° C. The chloroform extract of P. gingivalis was prepared as detailed in Example 2. Purification of PrtR-PrtK complex was performed as detailed in Example 1. The PrtR-PrtK domains were prepared by taking the PrtR-PrtK complex and incubating in the presence of 50 mM 2-mercaptoethanol for 8 h at 4° C. This resulted in the breakdown of the PrtR-PrtK complex to domains that were 15-115 kDa proteins as shown by gel filtration FPLC and SDS-PAGE as performed in Example 1.
[0101] All preparations were emulsified with an equal volume of Freund's Incomplete Adjuvant (FIA, Sigma) prior to injection.
[0102] Animals were bled before and 1 week after the immunisation schedule. Sera were screened by ELISA using a P. gingivalis sonicate (prepared as in Example 1) as the adsorbed antigen. The immunogenicity of the purified PrtR-PrtK complex is shown in FIG. 11.
TABLE-US-00006 TABLE 5 Immunization schedule No. of Group Doses Treatment n 1 2 1 × 10° Formalin killed P. gingivalis cells in 11 FIA1 2 2 Chloroform extracted P. gingivalis proteins in 10 FIA 3 2 Affinity purified P. gingivalis PrtR-PrtK complex 5 in FIA 4 2 PrtR-PrtK Domains in FIA 10 5 2 Tris-cysteine buffer in FIA 10 6 2 Tris-cysteine buffer 10 1FIA = Freunds incomplete adjuvant
[0103] For the preparation of the bacterial challenge P. gingivalis cells were grown at 37° C. on lysed horse blood agar (HBA) plates until day 3 or 4 in an anaerobic chamber (Mark 3 Anaerobic Workstation, Don Whitley Scientific Limited; with an air mixture of 8% H2, 12% CO2, 80% N2), then passaged into 20 ml of brain heart infusion broth (BHIB; Oxoid) supplemented with 0.5 g/L cysteine and 1 mg/L haemin for 24 hours in a standard incubator at 37° C. Finally, 3 ml of this culture was added to 400 ml of BHIB-cysteine media and incubated for approximately 15 hours in a standard incubator at 37° C., until the optical density at 650 nm reached 0.18. The cells were then pelleted by centrifugation at 10,000 g for 30 minutes using a JA10 rotor in a Beckman High Speed centrifuge and then resuspended to a final dilution of 3×1010 cells per ml in BHIB-cysteine media according to previously established growth curves for the W50 strain used in these experiments. Mice were marked for identification, their backs and chests shaved to make measurement of lesions possible, then weighed prior to inoculation with the challenge dose at a single site in the middle of the back. A 0.1 ml dose was given representing a predicted challenge dose of 3×109 bacteria per mouse. The inoculum dose was confirmed by culturing various dilutions of the challenge dose on lysed HBA plates and examining the number of colonies 7 days later.
[0104] Following challenge mice were examined daily for the number and size of lesions on their body and their size estimated by measuring the approximate surface area in mm2 involved. Previous experiments had shown that in unimmunized mice, lesions developed on the belly of the mice following inoculation of live bacteria into the back or side. Any distressed animals were culled. Observations were carried out over two weeks and a summary of one such experiment is summarised below in Table 6 In this experiment while a dose of 3×109 bacteria per mouse was the desired number of bacteria, after plating out of the inoculum it was calculated that each mouse actually received a challenge dose of 3.17×109 live P. gingivalis bacteria strain W50.
[0105] When mice were immunised with the various P. gingivalis fractions significant reductions (p<0.05) were seen in the size of the lesions with whole formalin killed P. gingivalis strain W50 cells (Group 1), the chloroform extracted proteins (Group 2) and the PrtR-PrtK complex (Group 3) when compared with the lesion size of the animals receiving FIA (Group 5) (Table 6). The PrtR-PrtK domains (Group 4) of the broken down PrtR-PrtK complex did not significantly reduce lesion size compared with the control (Group 5). These results clearly show that the complex works effectively as an immunogen whereas the PrtR-PrtK domains (15-115 kDa proteins) do not. The only group of animals that had a number of animals (40%) that exhibited no visible lesions at all was the PrtR-PrtK complex group (Group 3). All other groups, including formalin killed cells (Group 1), had all animals exhibiting visible lesions indicating that the PrtR-PrtK complex was a better immunogen than formalin killed cells.
TABLE-US-00007 TABLE 6 Immunisation with the PrtR-PrtK complex can protect mice from challenge with P. gingivalis. Lesion size Mean maximum Group lesion\size mm2 P* 1 30.2 ± 28.4 0.0008 2 39.0 ± 33.2 0.009 3 30.0 ± 36.0 0.0028 4 88.3 ± 32.2 NS 5 86.8 ± 41.1 -- 6 201.7 ± 125.8 0.012 *probability calculated by Mann Whitney rank sum test comparing Group 5 with other groups mean ± SD
Example 4
[0106] Cloning and Sequence Analysis of the prtR and prtK Genes
Bacterial Strains
[0107] P. gingivalis W50 was grown in modified BM medium supplemented with 1 μg/ml haemin in an atmosphere of 10% CO2, 10% H2 and 80% N2 at 37° C. Escherichia coli JM109 and Escherichia coli LE392 were grown in LB medium at 37° C. Escherichia coli strains harbouring pUC18 plasmids were grown in LB medium supplemented with 100 μg/ml ampicillin at 37° C.
Genomic Library Construction
[0108] Chromosomal DNA was isolated from P. gingivalis W50 as described by Smith et al, [Oral Microbiol. Immunol. 4:47-51 (1989)] except that cells were pelleted from a 500 ml late-exponential culture. The genomic library was constructed from BamHI partially-digested W50 DNA which was partially-filled with dGTP and dATP and ligated into LambdaGEM®-12 XhoI half-site arms (Promega) and packaged using Packagene® (Promega).
[0109] prtR gene characterisation: The genomic library was screened using degenerate synthetic oligonucleotides derived from the N-terminal sequence information of the purified PrtR45. The oligonucleotide probes were based on the amino acid sequence YEGDIKD (SEQ ID NO:10) (antisense) and KDFVDWKNQ (SEQ ID NO:11) (sense) and were 5' end-labelled using γ32PATP and T4 polynucleotide kinase. Approximately 1.5×104 phage were screened by lifting onto Nylon membrane filters and hybridised with radiolabeled oligonucleotides overnight in hybridisation buffer: 6×SSC (SSC is 15 mM sodium citrate, 150 mM NaCl pH 8.0), 0.25% SDS, 5×Denhardt's solution and 100 μg/ml salmon sperm DNA at 44° C. Filters were washed extensively in a solution of 5×SSC containing 0.01% SDS (w/v) at 44° C. Positively-hybridising plaques were purified. Standard protocols for end-labelling of oligonucleotides and screening procedures were essentially as described in Sambrook et al. (1989) [Molecular Cloning. A Laboratory Manual; 2nd ed., Cold Spring Harbour Laboratory Press]. Lambda clone four with an insert size of approximately 15 kb was selected and this fragment contained the entire prtR gene. The 15 kb fragment was cut with appropriate restriction enzymes and the fragments generated subcloned into pUC18 Escherichia coli JM109 was transformed with the recombinant plasmids using electroporation.
[0110] prtK gene characterisation: The 5' portion of the gene encoding PrtK was isolated from the same genomic library described above. The genomic library was screened using a degenerate synthetic oligonucleotide derived from the N-terminal sequence information of the purified PrtK48. The oligonucleotide probes were sense to the amino acid sequence DVYTDHGD (SEQ ID NO:12) and radiolabelled as described above. Hybridisation and washing conditions were as described above except that the temperature was 48° C. and the filters were washed extensively in a solution of 3×SSC containing 0.01% SDS (w/v) at 48° C. Lambda clone 12 with an insert size of approximately 15 kb was selected and digested with BamHI and a 3.3 kb fragment was ligated into plasmid BamHI-BAP pUC18 and Escherichia coli JM109 transformed with the recombinant plasmid as described previously. Due to an internal BamHI site within prtK, the 3.3 kb BamHI fragment contained the 5' portion of prtK which constituted the end of the lambda 12 clone. Sequence characterisation of the 3.3 kb BamHI fragment showed that the DNA sequence encoding PrtK48 contains an internal EcoRI site. Subsequently, a second oligonucleotide probe (lysur) specific to the sequence THIGAH (SEQ ID NO:13) which is found within the PrtK48 was generated to determine a suitable strategy for cloning the 3' end of prtK. Southern blot analysis of genomic DNA indicated that a 7.5 kb EcoRI fragment contained the entire 3' portion of prtK. In order to characterise the 3' end of the prtK gene a second genomic library was prepared. EcoRI digested DNA fragments of 6-8 kb were purified from an agarose gel and subsequently ligated to EcoRI digested Lambda Zap H-calf intestinal phosphatase-treated vector (Stratagene). The genomic library enriched for 6-8 kb P. gingivalis EcoRI fragments was packaged using GigapackIII Gold packaging extract (Stratagene) according to the manufacturer's instructions. The library was screened as described previously, using oligonucleotide lysur except that hybridisation temperatures were 42° C. and filters were washed to 3×SSC containing 0.01% SDS (w/v) at 42° C. In vivo excision of the Lambda Zap II positive genomic clone was performed (Stratagene instruction manual) to excise the pBluescript phagemid which was subsequently sequenced to generate the sequence information corresponding to the 3' end of the prtK gene.
[0111] DNA Sequencing. Double-stranded plasmid template DNA prepared following the procedure of Li and Schweizer [Focus 15:19-20 (1993)] was sequenced in both directions using DNA sequence-derived, synthetic oligonucleotides, following the di-deoxy termination method [Proc. Natl. Acad. Sci. U.S.A. 74:5463-5467 (1977)], using the Sequenase version 2 0 nucleotide sequencing kit purchased from United States Biochemicals. Nucleotide and protein sequence data were analysed using programme suites accessed by the Australian National Genomic Information Service (ANGIS).
Example 5
[0112] The following is an example of a proposed toothpaste formulation containing anti-(PrtR-PrtK) antibodies.
TABLE-US-00008 Ingredient % w/w Dicalcium phosphate dihydrate 50.0 Glycerol 20.0 Sodium carboxymethyl cellulose 1.0 Sodium lauryl sulphate 1.5 Sodium lauroyl sarconisate 0.5 Flavour 1.0 Sodium saccharin 0.1 Chlorhexidine gluconate 0.01 Dextranase 0.01 Goat serum containing anti-(PrtR-PrtK) 0.2 Water balance
Example 6
[0113] The following is an example of a proposed toothpaste formulation.
TABLE-US-00009 Ingredient % w/w Dicalcium phosphate dihydrate 50.0 Sorbitol 10.0 Glycerol 10.0 Sodium carboxymethyl cellulose 1.0 Sodium lauryl sulphate 1.5 Sodium lauroyl sarconisate 0.5 Flavour 1.0 Sodium saccharin 0.1 Sodium monofluorophosphate 0.3 Chlorhexidine gluconate 0.01 Dextranase 0.01 Bovine serum containing anti-(PrtR- 0.2 PrtK) Water balance
Example 7
[0114] The following is an example of a proposed toothpaste formulation.
TABLE-US-00010 Ingredient % w/w Dicalcium phosphate dihydrate 50.0 Sorbitol 10.0 Glycerol 10.0 Sodium carboxymethyl cellulose 1.0 Lauroyl diethanolamide 1.0 Sucrose monolaurate 2.0 Flavour 1.0 Sodium saccharin 0.1 Sodium monofluorophosphate 0.3 Chlorhexidine gluconate 0.01 Dextranase 0.01 Bovine milk 1 g containing anti-(PrtR-PrtK) 0.1 Water balance
Example 8
[0115] The following is an example of a proposed toothpaste formulation.
TABLE-US-00011 Ingredient % w/w Sorbitol 22.0 Irish moss 1.0 Sodium Hydroxide (50%) 1.0 Gantrez 19.0 Water (deionised) 2.69 Sodium Monofluorophosphate 0.76 Sodium saccharine 0.3 Pyrophosphate 2.0 Hydrated alumina 48.0 Flavour oil 0.95 anti-(PrtR-PrtK) mouse monoclonal 0.3 sodium lauryl sulphate 2.00
EXAMPLE 9
[0116] The following is an example of a proposed liquid toothpaste formulation.
TABLE-US-00012 Ingredient % w/w Sodium polyacrylate 50.0 Sorbitol 10.0 Glycerol 20.0 Flavour 1.0 Sodium saccharin 0.1 Sodium monofluorophosphate 0.3 Chlorhexidine gluconate 0.01 Ethanol 3.0 Equine 1 g containing anti-(PrtR-PrtK) 0.2 Linolic acid 0.05 Water balance
Example 10
[0117] The following is an example of a proposed mouthwash formulation.
TABLE-US-00013 Ingredient % w/w Ethanol 20.0 Flavour 1.0 Sodium saccharin 0.1 Sodium monofluorophosphate 0.3 Chlorhexidine gluconate 0.01 Lauroyl diethanolamide 0.3 Rabbit 1 g containing anti-(PrtR-PrtK) 0.2 Water balance
[0118] It will be appreciated by persons skilled in the art that numerous variations and/or modifications may be made to the invention as shown in the specific embodiments without departing from the spirit or scope of the invention as broadly described. The present embodiments are, therefore, to be considered in all respects as illustrative and not restrictive.
Sequence CWU
1
24117PRTPorphyromonas gingivalis 1Asp Val Tyr Thr Asp His Gly Asp Leu Tyr
Asn Thr Pro Val Arg Met1 5 10
15Leu223PRTPorphyromonas gingivalis 2Tyr Thr Pro Val Glu Glu Lys Gln
Asn Gly Arg Met Ile Val Ile Val1 5 10
15Ala Lys Lys Tyr Glu Gly Asp
20342PRTPorphyromonas gingivalis 3Ser Gly Gln Ala Glu Ile Val Leu Glu Ala
His Asp Val Trp Asn Asp1 5 10
15Gly Ser Gly Tyr Gln Ile Leu Leu Asp Ala Asp His Asp Gln Tyr Gly
20 25 30Gln Val Ile Pro Ser Asp
Thr His Phe Leu 35 40422PRTPorphyromonas
gingivalis 4Pro Gln Ser Val Trp Ile Glu Arg Thr Val Asp Leu Pro Ala Gly
Thr1 5 10 15Lys Tyr Val
Ala Phe Arg 20526PRTPorphyromonas gingivalis 5Ala Asn Glu Ala
Lys Val Val Leu Ala Ala Asp Asn Val Trp Gly Asp1 5
10 15Asn Thr Gly Tyr Gln Phe Leu Leu Asp Ala
20 25626PRTPorphyromonas gingivalis 6Ala Asn Glu
Ala Lys Val Val Leu Ala Ala Asp Asn Val Trp Gly Asp1 5
10 15Asn Thr Gly Tyr Gln Phe Leu Leu Asp
Ala 20 25722PRTPorphyromonas gingivalis 7Pro
Gln Ser Val Trp Ile Glu Arg Thr Val Asp Leu Pro Ala Gly Thr1
5 10 15Lys Tyr Val Ala Phe Arg
20824PRTPorphyromonas gingivalis 8Ala Asp Phe Thr Glu Thr Phe Glu Ser
Ser Thr His Gly Glu Ala Pro1 5 10
15Ala Glu Trp Thr Thr Ile Asp Ala
20924PRTPorphyromonas gingivalis 9Ala Asp Phe Thr Glu Thr Phe Glu Ser Ser
Thr His Gly Glu Ala Pro1 5 10
15Ala Glu Trp Thr Thr Ile Asp Ala 20107PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 10Tyr
Glu Gly Asp Ile Lys Asp1 5119PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 11Lys
Asp Phe Val Asp Trp Lys Asn Gln1 5128PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 12Asp
Val Tyr Thr Asp His Gly Asp1 5136PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 13Thr
His Ile Gly Ala His1 514199PRTBos taurus 14Arg Pro Lys His
Pro Ile Lys His Gln Gly Leu Pro Gln Glu Val Leu1 5
10 15Asn Glu Asn Leu Leu Arg Phe Phe Val Ala
Pro Phe Pro Gln Val Phe 20 25
30Gly Lys Glu Lys Val Asn Glu Leu Ser Lys Asp Ile Gly Ser Glu Ser
35 40 45Thr Glu Asp Gln Ala Met Glu Asp
Ile Lys Gln Met Glu Ala Glu Ser 50 55
60Ile Ser Ser Ser Glu Glu Ile Val Pro Asn Ser Val Glu Gln Lys His65
70 75 80Ile Gln Lys Glu Asp
Val Pro Ser Glu Arg Tyr Leu Gly Tyr Leu Glu 85
90 95Gln Leu Leu Arg Leu Lys Lys Tyr Lys Val Pro
Gln Leu Glu Ile Val 100 105
110Pro Asn Ser Ala Glu Glu Arg Leu His Ser Met Lys Glu Gly Ile His
115 120 125Ala Gln Gln Lys Glu Pro Met
Ile Gly Val Asn Gln Glu Leu Ala Tyr 130 135
140Phe Tyr Pro Glu Leu Phe Arg Gln Phe Tyr Gln Leu Asp Ala Tyr
Pro145 150 155 160Ser Gly
Ala Trp Tyr Tyr Val Pro Leu Gly Thr Gln Tyr Thr Asp Ala
165 170 175Pro Ser Phe Ser Asp Ile Pro
Asn Pro Ile Gly Ser Glu Asn Ser Glu 180 185
190Lys Thr Thr Met Pro Leu Trp
1951517PRTPorphyromonas gingivalis 15Arg Tyr Thr Pro Val Glu Glu Lys Gln
Asn Gly Arg Met Ile Val Ile1 5 10
15Val1617PRTPorphyromonas gingivalis 16Arg Ser Gly Gln Ala Glu
Ile Val Leu Glu Ala His Asp Val Trp Asn1 5
10 15Asp1717PRTPorphyromonas gingivalis 17Arg Ala Asp
Phe Thr Glu Thr Phe Glu Ser Ser Thr His Gly Glu Ala1 5
10 15Pro1817PRTPorphyromonas gingivalis
18Lys Pro Gln Ser Val Trp Ile Glu Arg Thr Val Asp Leu Pro Ala Gly1
5 10 15Thr1917PRTPorphyromonas
gingivalis 19Arg Ala Asn Glu Ala Lys Val Val Leu Ala Ala Asp Asn Val Trp
Gly1 5 10
15Asp205280DNAPorphyromonas gingivalisCDS(85)..(5202) 20gaattttgtc
tcccaagaag actttataat gcataaatac agaaggggta ctacacagta 60aaatcatatt
ctaatttcat caaa atg aaa aac ttg aac aag ttt gtt tcg 111
Met Lys Asn Leu Asn Lys Phe Val Ser
1 5att gct ctt tgc tct tcc tta tta gga gga atg gca ttt
gcg cag cag 159Ile Ala Leu Cys Ser Ser Leu Leu Gly Gly Met Ala Phe
Ala Gln Gln10 15 20
25aca gag ttg gga cgc aat ccg aat gtg aga ttg ctc gaa tcc act cag
207Thr Glu Leu Gly Arg Asn Pro Asn Val Arg Leu Leu Glu Ser Thr Gln
30 35 40caa tcg gtg aca aag gtt
cag ttc cgt atg gac aac ctc aag ttc acc 255Gln Ser Val Thr Lys Val
Gln Phe Arg Met Asp Asn Leu Lys Phe Thr 45 50
55gaa gtt caa acc cct aag gga atc gga caa gtg ccg acc
tat aca gaa 303Glu Val Gln Thr Pro Lys Gly Ile Gly Gln Val Pro Thr
Tyr Thr Glu 60 65 70ggg gtt aat
ctt tct gaa aaa ggg atg cct acg ctt ccc att cta tca 351Gly Val Asn
Leu Ser Glu Lys Gly Met Pro Thr Leu Pro Ile Leu Ser 75
80 85cgc tct ttg gcg gtt tca gac act cgt gag atg aag
gta gag gtt gtt 399Arg Ser Leu Ala Val Ser Asp Thr Arg Glu Met Lys
Val Glu Val Val90 95 100
105tcc tca aag ttc atc gaa aag aaa aat gtc ctg att gca ccc tcc aag
447Ser Ser Lys Phe Ile Glu Lys Lys Asn Val Leu Ile Ala Pro Ser Lys
110 115 120ggc atg att atg cgt
aac gaa gat ccg aaa aag atc cct tac gtt tat 495Gly Met Ile Met Arg
Asn Glu Asp Pro Lys Lys Ile Pro Tyr Val Tyr 125
130 135gga aag acg tac tcg caa aac aaa ttc ttc ccg gga
gag atc gcc acg 543Gly Lys Thr Tyr Ser Gln Asn Lys Phe Phe Pro Gly
Glu Ile Ala Thr 140 145 150ctt gat
gat cct ttt atc ctt cgt gat gtg cgt gga cag gtt gta aac 591Leu Asp
Asp Pro Phe Ile Leu Arg Asp Val Arg Gly Gln Val Val Asn 155
160 165ttt gcg cct ttg cag tat aac cct gtg aca aag
acg ttg cgc atc tat 639Phe Ala Pro Leu Gln Tyr Asn Pro Val Thr Lys
Thr Leu Arg Ile Tyr170 175 180
185acg gaa atc act gtg gca gtg agc gaa act tcg gaa caa ggc aaa aat
687Thr Glu Ile Thr Val Ala Val Ser Glu Thr Ser Glu Gln Gly Lys Asn
190 195 200att ctg aac aag aaa
ggt aca ttt gcc ggc ttt gaa gac aca tac aag 735Ile Leu Asn Lys Lys
Gly Thr Phe Ala Gly Phe Glu Asp Thr Tyr Lys 205
210 215cgc atg ttc atg aac tac gag cca ggg cgt tac aca
ccg gta gag gaa 783Arg Met Phe Met Asn Tyr Glu Pro Gly Arg Tyr Thr
Pro Val Glu Glu 220 225 230aaa caa
aat ggt cgt atg atc gtc atc gta gcc aaa aag tat gag gga 831Lys Gln
Asn Gly Arg Met Ile Val Ile Val Ala Lys Lys Tyr Glu Gly 235
240 245gat att aaa gat ttc gtt gat tgg aaa aac caa
cgc ggt ctc cgt acc 879Asp Ile Lys Asp Phe Val Asp Trp Lys Asn Gln
Arg Gly Leu Arg Thr250 255 260
265gag gtg aaa gtg gca gaa gat att gct tct ccc gtt aca gct aat gct
927Glu Val Lys Val Ala Glu Asp Ile Ala Ser Pro Val Thr Ala Asn Ala
270 275 280att cag caa ttc gtt
aag caa gaa tac gag aaa gaa ggt aat gat ttg 975Ile Gln Gln Phe Val
Lys Gln Glu Tyr Glu Lys Glu Gly Asn Asp Leu 285
290 295acc tat gtt ctt ttg att ggc gat cac aaa gat att
cct gcc aaa att 1023Thr Tyr Val Leu Leu Ile Gly Asp His Lys Asp Ile
Pro Ala Lys Ile 300 305 310act ccg
ggg atc aaa tcc gac cag gta tat gga caa ata gta ggt aat 1071Thr Pro
Gly Ile Lys Ser Asp Gln Val Tyr Gly Gln Ile Val Gly Asn 315
320 325gac cac tac aac gaa gtc ttc atc ggt cgt ttc
tca tgt gag agc aaa 1119Asp His Tyr Asn Glu Val Phe Ile Gly Arg Phe
Ser Cys Glu Ser Lys330 335 340
345gag gat ctg aag aca caa atc gat cgg act att cac tat gag cgc aat
1167Glu Asp Leu Lys Thr Gln Ile Asp Arg Thr Ile His Tyr Glu Arg Asn
350 355 360ata acc acg gaa gac
aaa tgg ctc ggt cag gct ctt tgt att gct tcg 1215Ile Thr Thr Glu Asp
Lys Trp Leu Gly Gln Ala Leu Cys Ile Ala Ser 365
370 375gct gaa gga ggc cca tcc gca gac aat ggt gaa agt
gat atc cag cat 1263Ala Glu Gly Gly Pro Ser Ala Asp Asn Gly Glu Ser
Asp Ile Gln His 380 385 390gag aat
gta atc gcc aat ctg ctt acc cag tat ggt tat acc aag att 1311Glu Asn
Val Ile Ala Asn Leu Leu Thr Gln Tyr Gly Tyr Thr Lys Ile 395
400 405atc aaa tgt tat gat ccg gga gta act cct aaa
aac att att gat gct 1359Ile Lys Cys Tyr Asp Pro Gly Val Thr Pro Lys
Asn Ile Ile Asp Ala410 415 420
425ttc aac gga gga atc tcg ttg gcc aac tat acg ggc cac ggt agc gaa
1407Phe Asn Gly Gly Ile Ser Leu Ala Asn Tyr Thr Gly His Gly Ser Glu
430 435 440aca gct tgg ggt acg
tct cac ttc ggc acc act cat gtg aag cag ctt 1455Thr Ala Trp Gly Thr
Ser His Phe Gly Thr Thr His Val Lys Gln Leu 445
450 455acc aac agc aac cag cta ccg ttt att ttc gac gta
gct tgt gtg aat 1503Thr Asn Ser Asn Gln Leu Pro Phe Ile Phe Asp Val
Ala Cys Val Asn 460 465 470ggc gat
ttc cta ttc agc atg cct tgt ttc gca gaa gca ttg atg cgt 1551Gly Asp
Phe Leu Phe Ser Met Pro Cys Phe Ala Glu Ala Leu Met Arg 475
480 485gca caa aaa gat ggt aag ccg aca ggt act gtt
gct atc ata gcg tct 1599Ala Gln Lys Asp Gly Lys Pro Thr Gly Thr Val
Ala Ile Ile Ala Ser490 495 500
505acg atc aac cag tct tgg gct tct cct atg cgc ggg cag gat gag atg
1647Thr Ile Asn Gln Ser Trp Ala Ser Pro Met Arg Gly Gln Asp Glu Met
510 515 520aac gaa att ctg tgc
gaa aaa cac ccg aac aac atc aag cgt act ttc 1695Asn Glu Ile Leu Cys
Glu Lys His Pro Asn Asn Ile Lys Arg Thr Phe 525
530 535ggt ggt gtc acc atg aac ggt atg ttt gct atg gtg
gaa aag tat aaa 1743Gly Gly Val Thr Met Asn Gly Met Phe Ala Met Val
Glu Lys Tyr Lys 540 545 550aag gat
ggt gag aag atg ctc gac aca tgg act gta ttc ggc gac ccc 1791Lys Asp
Gly Glu Lys Met Leu Asp Thr Trp Thr Val Phe Gly Asp Pro 555
560 565tcg ctg ctc gtt cgt aca ctt gtc ccg acc aaa
atg cag gtt acg gct 1839Ser Leu Leu Val Arg Thr Leu Val Pro Thr Lys
Met Gln Val Thr Ala570 575 580
585ccg gct cag att aat ttg acg gat gct tca gtc aac gta tct tgc gat
1887Pro Ala Gln Ile Asn Leu Thr Asp Ala Ser Val Asn Val Ser Cys Asp
590 595 600tat aat ggt gct att
gct acc att tca gcc aat gga aag atg ttc ggt 1935Tyr Asn Gly Ala Ile
Ala Thr Ile Ser Ala Asn Gly Lys Met Phe Gly 605
610 615tct gca gtt gtc gaa aat gga aca gct aca atc aat
ctg aca ggt ctg 1983Ser Ala Val Val Glu Asn Gly Thr Ala Thr Ile Asn
Leu Thr Gly Leu 620 625 630aca aat
gaa agc acg ctt acc ctt aca gta gtt ggt tac aac aaa gag 2031Thr Asn
Glu Ser Thr Leu Thr Leu Thr Val Val Gly Tyr Asn Lys Glu 635
640 645acg gtt att aag acc atc aac act aat ggt gag
cct aac ccc tac cag 2079Thr Val Ile Lys Thr Ile Asn Thr Asn Gly Glu
Pro Asn Pro Tyr Gln650 655 660
665cct gtt tcc aac ttg act gct aca acg cag ggt cag aaa gta acg ctc
2127Pro Val Ser Asn Leu Thr Ala Thr Thr Gln Gly Gln Lys Val Thr Leu
670 675 680aag tgg gat gca ccg
agc acg aaa acc aat gca acc act aat acc gct 2175Lys Trp Asp Ala Pro
Ser Thr Lys Thr Asn Ala Thr Thr Asn Thr Ala 685
690 695cgc agc gtg gat ggc ata cga gaa ctg gtt ctt ctg
tca gtc agc gat 2223Arg Ser Val Asp Gly Ile Arg Glu Leu Val Leu Leu
Ser Val Ser Asp 700 705 710gcc ccc
gaa ctt ctt cgc agc ggt cag gcc gag att gtt ctt gaa gct 2271Ala Pro
Glu Leu Leu Arg Ser Gly Gln Ala Glu Ile Val Leu Glu Ala 715
720 725cac gat gtt tgg aat gat gga tcc ggt tat cag
att ctt ttg gat gca 2319His Asp Val Trp Asn Asp Gly Ser Gly Tyr Gln
Ile Leu Leu Asp Ala730 735 740
745gac cat gat caa tat gga cag gtt ata ccc agt gat acc cat act ctt
2367Asp His Asp Gln Tyr Gly Gln Val Ile Pro Ser Asp Thr His Thr Leu
750 755 760tgg ccg aac tgt agt
gtc ccg gcc aat ctg ttc gct ccg ttc gaa tat 2415Trp Pro Asn Cys Ser
Val Pro Ala Asn Leu Phe Ala Pro Phe Glu Tyr 765
770 775act gtt ccg gaa aat gca gat cct tct tgt tcc cct
acc aat atg ata 2463Thr Val Pro Glu Asn Ala Asp Pro Ser Cys Ser Pro
Thr Asn Met Ile 780 785 790atg gat
ggt act gca tcc gtt aat ata ccg gcc gga act tat gac ttt 2511Met Asp
Gly Thr Ala Ser Val Asn Ile Pro Ala Gly Thr Tyr Asp Phe 795
800 805gca att gct gct cct caa gca aat gca aag att
tgg att gcc gga caa 2559Ala Ile Ala Ala Pro Gln Ala Asn Ala Lys Ile
Trp Ile Ala Gly Gln810 815 820
825gga ccg acg aaa gaa gat gat tat gta ttt gaa gcc ggt aaa aaa tac
2607Gly Pro Thr Lys Glu Asp Asp Tyr Val Phe Glu Ala Gly Lys Lys Tyr
830 835 840cat ttc ctt atg aag
aag atg ggt agc ggt gat gga act gaa ttg act 2655His Phe Leu Met Lys
Lys Met Gly Ser Gly Asp Gly Thr Glu Leu Thr 845
850 855ata agc gaa ggt ggt gga agc gat tac acc tat act
gtc tat cgt gac 2703Ile Ser Glu Gly Gly Gly Ser Asp Tyr Thr Tyr Thr
Val Tyr Arg Asp 860 865 870ggc acg
aag atc aag gaa ggt ctg acg gct acg aca ttc gaa gaa gac 2751Gly Thr
Lys Ile Lys Glu Gly Leu Thr Ala Thr Thr Phe Glu Glu Asp 875
880 885ggt gta gct acg ggc aat cat gag tat tgc gtg
gaa gtt aag tac aca 2799Gly Val Ala Thr Gly Asn His Glu Tyr Cys Val
Glu Val Lys Tyr Thr890 895 900
905gcc ggc gta tct ccg aag gta tgt aaa gac gtt acg gta gaa gga tcc
2847Ala Gly Val Ser Pro Lys Val Cys Lys Asp Val Thr Val Glu Gly Ser
910 915 920aat gaa ttt gct cct
gta cag aac ctg acc ggt agt gca gtc ggc cag 2895Asn Glu Phe Ala Pro
Val Gln Asn Leu Thr Gly Ser Ala Val Gly Gln 925
930 935aaa gta acg ctt aag tgg gat gca cct aat ggt acc
ccg aat cca aat 2943Lys Val Thr Leu Lys Trp Asp Ala Pro Asn Gly Thr
Pro Asn Pro Asn 940 945 950cca aat
ccg aat cca aat ccg aat ccc gga aca act aca ctt tcc gaa 2991Pro Asn
Pro Asn Pro Asn Pro Asn Pro Gly Thr Thr Thr Leu Ser Glu 955
960 965tca ttc gaa aat ggt att cct gcc tca tgg aag
acg atc gat gca gac 3039Ser Phe Glu Asn Gly Ile Pro Ala Ser Trp Lys
Thr Ile Asp Ala Asp970 975 980
985ggt gac ggg cat ggc tgg aag cct gga aat gct ccc gga atc gct ggc
3087Gly Asp Gly His Gly Trp Lys Pro Gly Asn Ala Pro Gly Ile Ala Gly
990 995 1000tac aat agc aat ggt
tgt gta tat tca gag tca ttc ggt ctt ggt ggt 3135Tyr Asn Ser Asn Gly
Cys Val Tyr Ser Glu Ser Phe Gly Leu Gly Gly 1005
1010 1015ata gga gtt ctt acc cct gac aac tat ctg ata aca
ccg gca ttg gat 3183Ile Gly Val Leu Thr Pro Asp Asn Tyr Leu Ile Thr
Pro Ala Leu Asp 1020 1025 1030ttg
cct aac gga ggt aag ttg act ttc tgg gta tgc gca cag gat gct 3231Leu
Pro Asn Gly Gly Lys Leu Thr Phe Trp Val Cys Ala Gln Asp Ala 1035
1040 1045aat tat gca tcc gag cac tat gcg gtg tat
gca tct tcg acc ggt aac 3279Asn Tyr Ala Ser Glu His Tyr Ala Val Tyr
Ala Ser Ser Thr Gly Asn1050 1055 1060
1065gat gca tcc aac ttc acg aat gct ttg ttg gaa gag acg att acg
gca 3327Asp Ala Ser Asn Phe Thr Asn Ala Leu Leu Glu Glu Thr Ile Thr
Ala 1070 1075 1080aaa ggt
gtt cgc tcg ccg gaa gct atg cgt ggt cgt ata cag ggt act 3375Lys Gly
Val Arg Ser Pro Glu Ala Met Arg Gly Arg Ile Gln Gly Thr 1085
1090 1095tgg cgc cag aag acg gta gac ctt ccc
gca ggt acg aaa tat gtt gct 3423Trp Arg Gln Lys Thr Val Asp Leu Pro
Ala Gly Thr Lys Tyr Val Ala 1100 1105
1110ttc cgt cac ttc caa agc acc gat atg ttc tac atc gac ctt gat gag
3471Phe Arg His Phe Gln Ser Thr Asp Met Phe Tyr Ile Asp Leu Asp Glu
1115 1120 1125gtt gag atc aag gcc aat ggc
aag cgc gca gac ttc acg gaa acg ttc 3519Val Glu Ile Lys Ala Asn Gly
Lys Arg Ala Asp Phe Thr Glu Thr Phe1130 1135
1140 1145gag tct tct act cat gga gag gca cca gcg gaa tgg
act act atc gat 3567Glu Ser Ser Thr His Gly Glu Ala Pro Ala Glu Trp
Thr Thr Ile Asp 1150 1155
1160gcc gat ggc gat ggt cag ggt tgg ctc tgt ctg tct tcc gga caa ttg
3615Ala Asp Gly Asp Gly Gln Gly Trp Leu Cys Leu Ser Ser Gly Gln Leu
1165 1170 1175gac tgg ctg aca gct cat
ggc ggc acc aac gta gta agc tct ttc tca 3663Asp Trp Leu Thr Ala His
Gly Gly Thr Asn Val Val Ser Ser Phe Ser 1180 1185
1190tgg aat gga atg gct ttg aat cct gat aac tat ctc atc tca
aag gat 3711Trp Asn Gly Met Ala Leu Asn Pro Asp Asn Tyr Leu Ile Ser
Lys Asp 1195 1200 1205gtt aca ggc gca
acg aag gta aag tac tac tat gca gtc aac gac ggt 3759Val Thr Gly Ala
Thr Lys Val Lys Tyr Tyr Tyr Ala Val Asn Asp Gly1210 1215
1220 1225ttt ccc ggg gat cac tat gcg gtg atg
atc tcc aag acg ggc acg aac 3807Phe Pro Gly Asp His Tyr Ala Val Met
Ile Ser Lys Thr Gly Thr Asn 1230 1235
1240gcc gga gac ttc acg gtt gtt ttc gaa gaa acg cct aac gga ata
aat 3855Ala Gly Asp Phe Thr Val Val Phe Glu Glu Thr Pro Asn Gly Ile
Asn 1245 1250 1255aag ggc gga
gca aga ttc ggt ctt tcc acg gaa gcc gat ggc gcc aaa 3903Lys Gly Gly
Ala Arg Phe Gly Leu Ser Thr Glu Ala Asp Gly Ala Lys 1260
1265 1270cct caa agt gta tgg atc gag cgt acg gta gat
ttg cct gcg ggc acg 3951Pro Gln Ser Val Trp Ile Glu Arg Thr Val Asp
Leu Pro Ala Gly Thr 1275 1280 1285aag
tat gtt gct ttc cgt cac tac aat tgc tcg gat ttg aac tac att 3999Lys
Tyr Val Ala Phe Arg His Tyr Asn Cys Ser Asp Leu Asn Tyr Ile1290
1295 1300 1305ctt ttg gat gat att cag
ttc acc atg ggt ggc agc ccc acc ccg acc 4047Leu Leu Asp Asp Ile Gln
Phe Thr Met Gly Gly Ser Pro Thr Pro Thr 1310
1315 1320gat tat acc tac acg gtg tat cgt gat ggt acg aag
atc aag gaa ggt 4095Asp Tyr Thr Tyr Thr Val Tyr Arg Asp Gly Thr Lys
Ile Lys Glu Gly 1325 1330
1335ttg acc gaa acg acc ttc gaa gaa gac ggc gta gct acg ggc aat cat
4143Leu Thr Glu Thr Thr Phe Glu Glu Asp Gly Val Ala Thr Gly Asn His
1340 1345 1350gag tat tgc gtg gaa gtg aag
tac aca gcc ggc gta tct ccg aag aaa 4191Glu Tyr Cys Val Glu Val Lys
Tyr Thr Ala Gly Val Ser Pro Lys Lys 1355 1360
1365tgt gta aac gta act gtt aat tcg aca cag ttc aat cct gta aag aac
4239Cys Val Asn Val Thr Val Asn Ser Thr Gln Phe Asn Pro Val Lys
Asn1370 1375 1380 1385ctg
aag gca caa ccg gat ggc ggc gac gtg gtt ctc aag tgg gaa gcc 4287Leu
Lys Ala Gln Pro Asp Gly Gly Asp Val Val Leu Lys Trp Glu Ala
1390 1395 1400ccg agc gca aag aag aca gaa
ggt tct cgt gaa gta aaa cgg atc gga 4335Pro Ser Ala Lys Lys Thr Glu
Gly Ser Arg Glu Val Lys Arg Ile Gly 1405 1410
1415gac ggt ctt ttc gtt acg atc gaa cct gca aac gat gta cgt
gcc aac 4383Asp Gly Leu Phe Val Thr Ile Glu Pro Ala Asn Asp Val Arg
Ala Asn 1420 1425 1430gaa gcc aag
gtt gtg ctc gca gca gac aac gta tgg gga gac aat acg 4431Glu Ala Lys
Val Val Leu Ala Ala Asp Asn Val Trp Gly Asp Asn Thr 1435
1440 1445ggt tac cag ttc ttg ttg gat gcc gat cac aat aca
ttc gga agt gtc 4479Gly Tyr Gln Phe Leu Leu Asp Ala Asp His Asn Thr
Phe Gly Ser Val1450 1455 1460
1465att ccg gca acc ggt cct ctc ttt acc gga aca gct tct tcc gat ctt
4527Ile Pro Ala Thr Gly Pro Leu Phe Thr Gly Thr Ala Ser Ser Asp Leu
1470 1475 1480tac agt gcg aac ttc
gag tct ttg atc ccg gcc aat gcc gat cct gtt 4575Tyr Ser Ala Asn Phe
Glu Ser Leu Ile Pro Ala Asn Ala Asp Pro Val 1485
1490 1495gtt act aca cag aat att atc gtt aca gga cag ggt
gaa gtt gta atc 4623Val Thr Thr Gln Asn Ile Ile Val Thr Gly Gln Gly
Glu Val Val Ile 1500 1505 1510ccc
ggt ggt gtt tac gac tat tgc att acg aac ccg gaa cct gca tcc 4671Pro
Gly Gly Val Tyr Asp Tyr Cys Ile Thr Asn Pro Glu Pro Ala Ser 1515
1520 1525gga aag atg tgg atc gca gga gat gga ggc
aac cag cct gca cgt tat 4719Gly Lys Met Trp Ile Ala Gly Asp Gly Gly
Asn Gln Pro Ala Arg Tyr1530 1535 1540
1545gac gat ttc aca ttc gaa gca ggc aag aag tac acc ttc acg atg
cgt 4767Asp Asp Phe Thr Phe Glu Ala Gly Lys Lys Tyr Thr Phe Thr Met
Arg 1550 1555 1560cgc gcc
gga atg gga gat gga act gat atg gaa gtc gaa gac gat tca 4815Arg Ala
Gly Met Gly Asp Gly Thr Asp Met Glu Val Glu Asp Asp Ser 1565
1570 1575cct gca agc tat acc tat aca gtc tat
cgt gac ggc acg aag atc aag 4863Pro Ala Ser Tyr Thr Tyr Thr Val Tyr
Arg Asp Gly Thr Lys Ile Lys 1580 1585
1590gaa ggt ctg acc gaa acg acc tac cgc gac gca gga atg agt gca caa
4911Glu Gly Leu Thr Glu Thr Thr Tyr Arg Asp Ala Gly Met Ser Ala Gln
1595 1600 1605tct cat gar tat tgc gtg gaa
gtt aag tac aca gcc ggt gtt tct ccg 4959Ser His Glu Tyr Cys Val Glu
Val Lys Tyr Thr Ala Gly Val Ser Pro1610 1615
1620 1625aag gtt tgt gtg gat tat att cct gac gga gtg gca
gac gta acg gct 5007Lys Val Cys Val Asp Tyr Ile Pro Asp Gly Val Ala
Asp Val Thr Ala 1630 1635
1640cag aag cct tac acg ctg aca gtt gta gga aag acg atc acg gta act
5055Gln Lys Pro Tyr Thr Leu Thr Val Val Gly Lys Thr Ile Thr Val Thr
1645 1650 1655tgc caa ggc gaa gct atg
atc tac gac atg aac ggt cgt cgt ctg gca 5103Cys Gln Gly Glu Ala Met
Ile Tyr Asp Met Asn Gly Arg Arg Leu Ala 1660 1665
1670gcc ggt cgc aac acg gtt gtt tac acg gct cag ggc ggc tac
tat gca 5151Ala Gly Arg Asn Thr Val Val Tyr Thr Ala Gln Gly Gly Tyr
Tyr Ala 1675 1680 1685gtt atg gtt gtc
gtt gac ggc aag tct tac gta gag aaa ctc gct atc 5199Val Met Val Val
Val Asp Gly Lys Ser Tyr Val Glu Lys Leu Ala Ile1690 1695
1700 1705aag taaatctgtc ttggactcgg agactttgtg
cagacacttt taagataggt 5252Lysctgtaattgt ctcagagtat gaatcggt
5280211706PRTPorphyromonas gingivalis
21Met Lys Asn Leu Asn Lys Phe Val Ser Ile Ala Leu Cys Ser Ser Leu1
5 10 15Leu Gly Gly Met Ala Phe
Ala Gln Gln Thr Glu Leu Gly Arg Asn Pro 20 25
30Asn Val Arg Leu Leu Glu Ser Thr Gln Gln Ser Val Thr
Lys Val Gln 35 40 45Phe Arg Met
Asp Asn Leu Lys Phe Thr Glu Val Gln Thr Pro Lys Gly 50
55 60Ile Gly Gln Val Pro Thr Tyr Thr Glu Gly Val Asn
Leu Ser Glu Lys65 70 75
80Gly Met Pro Thr Leu Pro Ile Leu Ser Arg Ser Leu Ala Val Ser Asp
85 90 95Thr Arg Glu Met Lys Val
Glu Val Val Ser Ser Lys Phe Ile Glu Lys 100
105 110Lys Asn Val Leu Ile Ala Pro Ser Lys Gly Met Ile
Met Arg Asn Glu 115 120 125Asp Pro
Lys Lys Ile Pro Tyr Val Tyr Gly Lys Thr Tyr Ser Gln Asn 130
135 140Lys Phe Phe Pro Gly Glu Ile Ala Thr Leu Asp
Asp Pro Phe Ile Leu145 150 155
160Arg Asp Val Arg Gly Gln Val Val Asn Phe Ala Pro Leu Gln Tyr Asn
165 170 175Pro Val Thr Lys
Thr Leu Arg Ile Tyr Thr Glu Ile Thr Val Ala Val 180
185 190Ser Glu Thr Ser Glu Gln Gly Lys Asn Ile Leu
Asn Lys Lys Gly Thr 195 200 205Phe
Ala Gly Phe Glu Asp Thr Tyr Lys Arg Met Phe Met Asn Tyr Glu 210
215 220Pro Gly Arg Tyr Thr Pro Val Glu Glu Lys
Gln Asn Gly Arg Met Ile225 230 235
240Val Ile Val Ala Lys Lys Tyr Glu Gly Asp Ile Lys Asp Phe Val
Asp 245 250 255Trp Lys Asn
Gln Arg Gly Leu Arg Thr Glu Val Lys Val Ala Glu Asp 260
265 270Ile Ala Ser Pro Val Thr Ala Asn Ala Ile
Gln Gln Phe Val Lys Gln 275 280
285Glu Tyr Glu Lys Glu Gly Asn Asp Leu Thr Tyr Val Leu Leu Ile Gly 290
295 300Asp His Lys Asp Ile Pro Ala Lys
Ile Thr Pro Gly Ile Lys Ser Asp305 310
315 320Gln Val Tyr Gly Gln Ile Val Gly Asn Asp His Tyr
Asn Glu Val Phe 325 330
335Ile Gly Arg Phe Ser Cys Glu Ser Lys Glu Asp Leu Lys Thr Gln Ile
340 345 350Asp Arg Thr Ile His Tyr
Glu Arg Asn Ile Thr Thr Glu Asp Lys Trp 355 360
365Leu Gly Gln Ala Leu Cys Ile Ala Ser Ala Glu Gly Gly Pro
Ser Ala 370 375 380Asp Asn Gly Glu Ser
Asp Ile Gln His Glu Asn Val Ile Ala Asn Leu385 390
395 400Leu Thr Gln Tyr Gly Tyr Thr Lys Ile Ile
Lys Cys Tyr Asp Pro Gly 405 410
415Val Thr Pro Lys Asn Ile Ile Asp Ala Phe Asn Gly Gly Ile Ser Leu
420 425 430Ala Asn Tyr Thr Gly
His Gly Ser Glu Thr Ala Trp Gly Thr Ser His 435
440 445Phe Gly Thr Thr His Val Lys Gln Leu Thr Asn Ser
Asn Gln Leu Pro 450 455 460Phe Ile Phe
Asp Val Ala Cys Val Asn Gly Asp Phe Leu Phe Ser Met465
470 475 480Pro Cys Phe Ala Glu Ala Leu
Met Arg Ala Gln Lys Asp Gly Lys Pro 485
490 495Thr Gly Thr Val Ala Ile Ile Ala Ser Thr Ile Asn
Gln Ser Trp Ala 500 505 510Ser
Pro Met Arg Gly Gln Asp Glu Met Asn Glu Ile Leu Cys Glu Lys 515
520 525His Pro Asn Asn Ile Lys Arg Thr Phe
Gly Gly Val Thr Met Asn Gly 530 535
540Met Phe Ala Met Val Glu Lys Tyr Lys Lys Asp Gly Glu Lys Met Leu545
550 555 560Asp Thr Trp Thr
Val Phe Gly Asp Pro Ser Leu Leu Val Arg Thr Leu 565
570 575Val Pro Thr Lys Met Gln Val Thr Ala Pro
Ala Gln Ile Asn Leu Thr 580 585
590Asp Ala Ser Val Asn Val Ser Cys Asp Tyr Asn Gly Ala Ile Ala Thr
595 600 605Ile Ser Ala Asn Gly Lys Met
Phe Gly Ser Ala Val Val Glu Asn Gly 610 615
620Thr Ala Thr Ile Asn Leu Thr Gly Leu Thr Asn Glu Ser Thr Leu
Thr625 630 635 640Leu Thr
Val Val Gly Tyr Asn Lys Glu Thr Val Ile Lys Thr Ile Asn
645 650 655Thr Asn Gly Glu Pro Asn Pro
Tyr Gln Pro Val Ser Asn Leu Thr Ala 660 665
670Thr Thr Gln Gly Gln Lys Val Thr Leu Lys Trp Asp Ala Pro
Ser Thr 675 680 685Lys Thr Asn Ala
Thr Thr Asn Thr Ala Arg Ser Val Asp Gly Ile Arg 690
695 700Glu Leu Val Leu Leu Ser Val Ser Asp Ala Pro Glu
Leu Leu Arg Ser705 710 715
720Gly Gln Ala Glu Ile Val Leu Glu Ala His Asp Val Trp Asn Asp Gly
725 730 735Ser Gly Tyr Gln Ile
Leu Leu Asp Ala Asp His Asp Gln Tyr Gly Gln 740
745 750Val Ile Pro Ser Asp Thr His Thr Leu Trp Pro Asn
Cys Ser Val Pro 755 760 765Ala Asn
Leu Phe Ala Pro Phe Glu Tyr Thr Val Pro Glu Asn Ala Asp 770
775 780Pro Ser Cys Ser Pro Thr Asn Met Ile Met Asp
Gly Thr Ala Ser Val785 790 795
800Asn Ile Pro Ala Gly Thr Tyr Asp Phe Ala Ile Ala Ala Pro Gln Ala
805 810 815Asn Ala Lys Ile
Trp Ile Ala Gly Gln Gly Pro Thr Lys Glu Asp Asp 820
825 830Tyr Val Phe Glu Ala Gly Lys Lys Tyr His Phe
Leu Met Lys Lys Met 835 840 845Gly
Ser Gly Asp Gly Thr Glu Leu Thr Ile Ser Glu Gly Gly Gly Ser 850
855 860Asp Tyr Thr Tyr Thr Val Tyr Arg Asp Gly
Thr Lys Ile Lys Glu Gly865 870 875
880Leu Thr Ala Thr Thr Phe Glu Glu Asp Gly Val Ala Thr Gly Asn
His 885 890 895Glu Tyr Cys
Val Glu Val Lys Tyr Thr Ala Gly Val Ser Pro Lys Val 900
905 910Cys Lys Asp Val Thr Val Glu Gly Ser Asn
Glu Phe Ala Pro Val Gln 915 920
925Asn Leu Thr Gly Ser Ala Val Gly Gln Lys Val Thr Leu Lys Trp Asp 930
935 940Ala Pro Asn Gly Thr Pro Asn Pro
Asn Pro Asn Pro Asn Pro Asn Pro945 950
955 960Asn Pro Gly Thr Thr Thr Leu Ser Glu Ser Phe Glu
Asn Gly Ile Pro 965 970
975Ala Ser Trp Lys Thr Ile Asp Ala Asp Gly Asp Gly His Gly Trp Lys
980 985 990Pro Gly Asn Ala Pro Gly
Ile Ala Gly Tyr Asn Ser Asn Gly Cys Val 995 1000
1005Tyr Ser Glu Ser Phe Gly Leu Gly Gly Ile Gly Val Leu Thr
Pro Asp 1010 1015 1020Asn Tyr Leu Ile
Thr Pro Ala Leu Asp Leu Pro Asn Gly Gly Lys Leu1025 1030
1035 1040Thr Phe Trp Val Cys Ala Gln Asp Ala
Asn Tyr Ala Ser Glu His Tyr 1045 1050
1055Ala Val Tyr Ala Ser Ser Thr Gly Asn Asp Ala Ser Asn Phe Thr
Asn 1060 1065 1070Ala Leu Leu
Glu Glu Thr Ile Thr Ala Lys Gly Val Arg Ser Pro Glu 1075
1080 1085Ala Met Arg Gly Arg Ile Gln Gly Thr Trp Arg
Gln Lys Thr Val Asp 1090 1095 1100Leu
Pro Ala Gly Thr Lys Tyr Val Ala Phe Arg His Phe Gln Ser Thr1105
1110 1115 1120Asp Met Phe Tyr Ile Asp
Leu Asp Glu Val Glu Ile Lys Ala Asn Gly 1125
1130 1135Lys Arg Ala Asp Phe Thr Glu Thr Phe Glu Ser Ser
Thr His Gly Glu 1140 1145
1150Ala Pro Ala Glu Trp Thr Thr Ile Asp Ala Asp Gly Asp Gly Gln Gly
1155 1160 1165Trp Leu Cys Leu Ser Ser Gly
Gln Leu Asp Trp Leu Thr Ala His Gly 1170 1175
1180Gly Thr Asn Val Val Ser Ser Phe Ser Trp Asn Gly Met Ala Leu
Asn1185 1190 1195 1200Pro
Asp Asn Tyr Leu Ile Ser Lys Asp Val Thr Gly Ala Thr Lys Val
1205 1210 1215Lys Tyr Tyr Tyr Ala Val Asn
Asp Gly Phe Pro Gly Asp His Tyr Ala 1220 1225
1230Val Met Ile Ser Lys Thr Gly Thr Asn Ala Gly Asp Phe Thr
Val Val 1235 1240 1245Phe Glu Glu
Thr Pro Asn Gly Ile Asn Lys Gly Gly Ala Arg Phe Gly 1250
1255 1260Leu Ser Thr Glu Ala Asp Gly Ala Lys Pro Gln Ser
Val Trp Ile Glu1265 1270 1275
1280Arg Thr Val Asp Leu Pro Ala Gly Thr Lys Tyr Val Ala Phe Arg His
1285 1290 1295Tyr Asn Cys Ser Asp
Leu Asn Tyr Ile Leu Leu Asp Asp Ile Gln Phe 1300
1305 1310Thr Met Gly Gly Ser Pro Thr Pro Thr Asp Tyr Thr
Tyr Thr Val Tyr 1315 1320 1325Arg
Asp Gly Thr Lys Ile Lys Glu Gly Leu Thr Glu Thr Thr Phe Glu 1330
1335 1340Glu Asp Gly Val Ala Thr Gly Asn His Glu
Tyr Cys Val Glu Val Lys1345 1350 1355
1360Tyr Thr Ala Gly Val Ser Pro Lys Lys Cys Val Asn Val Thr Val
Asn 1365 1370 1375Ser Thr
Gln Phe Asn Pro Val Lys Asn Leu Lys Ala Gln Pro Asp Gly 1380
1385 1390Gly Asp Val Val Leu Lys Trp Glu Ala
Pro Ser Ala Lys Lys Thr Glu 1395 1400
1405Gly Ser Arg Glu Val Lys Arg Ile Gly Asp Gly Leu Phe Val Thr Ile
1410 1415 1420Glu Pro Ala Asn Asp Val Arg
Ala Asn Glu Ala Lys Val Val Leu Ala1425 1430
1435 1440Ala Asp Asn Val Trp Gly Asp Asn Thr Gly Tyr Gln
Phe Leu Leu Asp 1445 1450
1455Ala Asp His Asn Thr Phe Gly Ser Val Ile Pro Ala Thr Gly Pro Leu
1460 1465 1470Phe Thr Gly Thr Ala Ser
Ser Asp Leu Tyr Ser Ala Asn Phe Glu Ser 1475 1480
1485Leu Ile Pro Ala Asn Ala Asp Pro Val Val Thr Thr Gln Asn
Ile Ile 1490 1495 1500Val Thr Gly Gln
Gly Glu Val Val Ile Pro Gly Gly Val Tyr Asp Tyr1505 1510
1515 1520Cys Ile Thr Asn Pro Glu Pro Ala Ser
Gly Lys Met Trp Ile Ala Gly 1525 1530
1535Asp Gly Gly Asn Gln Pro Ala Arg Tyr Asp Asp Phe Thr Phe Glu
Ala 1540 1545 1550Gly Lys Lys
Tyr Thr Phe Thr Met Arg Arg Ala Gly Met Gly Asp Gly 1555
1560 1565Thr Asp Met Glu Val Glu Asp Asp Ser Pro Ala
Ser Tyr Thr Tyr Thr 1570 1575 1580Val
Tyr Arg Asp Gly Thr Lys Ile Lys Glu Gly Leu Thr Glu Thr Thr1585
1590 1595 1600Tyr Arg Asp Ala Gly Met
Ser Ala Gln Ser His Glu Tyr Cys Val Glu 1605
1610 1615Val Lys Tyr Thr Ala Gly Val Ser Pro Lys Val Cys
Val Asp Tyr Ile 1620 1625
1630Pro Asp Gly Val Ala Asp Val Thr Ala Gln Lys Pro Tyr Thr Leu Thr
1635 1640 1645Val Val Gly Lys Thr Ile Thr
Val Thr Cys Gln Gly Glu Ala Met Ile 1650 1655
1660Tyr Asp Met Asn Gly Arg Arg Leu Ala Ala Gly Arg Asn Thr Val
Val1665 1670 1675 1680Tyr
Thr Ala Gln Gly Gly Tyr Tyr Ala Val Met Val Val Val Asp Gly
1685 1690 1695Lys Ser Tyr Val Glu Lys Leu
Ala Ile Lys 1700 17052218PRTPorphyromonas
gingivalis 22Arg Asp Val Tyr Thr Asp His Gly Asp Leu Tyr Asn Thr Pro Val
Arg1 5 10 15Met
Leu236000DNAPorphyromonas gingivalisCDS(696)..(5891) 23ggatcctacg
cccgataccc atactcgaag cctttgctca gtaccatcct gcagaaggtt 60actctttcgc
atatagtgac cctcttttct ctcagcataa tggtacctat catatcagta 120aggggcgtat
tgtcttttcg aacaatgtac agcccgagaa ctctttactt ccacatcaca 180cccccgactc
cttagtcaag gatctttttt cccctttccc ctccgctctc ttcctcatgc 240tggactgact
taaccttggt ctgctctact tttcggttgt aaatacatgc aacacaataa 300ctttaagtgt
tgttagacaa cacttttaca agactctgac ttttaatgag gtggagcatg 360aaccttttcc
tctttcatct tctccttcag attacagtca atattttggc aaaaggctaa 420ttgacagcct
tttataaggg ttaatccctt gtggcttata ttgaaaacat gttctttata 480atccgatact
cttcttaaat cgaatttttt ctctaaattg cgccgcaaca aaactccttg 540agaaaagtac
caatagaaat agaaggtagc attttgcctt taaattcctt ttcttttctt 600ggattgttct
tgaaatgaat cttatttgtg gatttttttt gtttttttaa cccggccgtg 660gttctctgaa
tcacgaccat aaattgtttt aaagt atg agg aaa tta tta ttg 713
Met Arg Lys Leu Leu Leu
1 5ctg atc gcg gcg tcc ctt ttg gga gtt ggt
ctt tac gcc caa agc gcc 761Leu Ile Ala Ala Ser Leu Leu Gly Val Gly
Leu Tyr Ala Gln Ser Ala 10 15
20aag att aag ctt gat gct ccg act act cga acg aca tgt acg aac aat
809Lys Ile Lys Leu Asp Ala Pro Thr Thr Arg Thr Thr Cys Thr Asn Asn
25 30 35agc ttc aag cag ttc gat gca agc
ttt tcg ttc aat gaa gtc gag ctg 857Ser Phe Lys Gln Phe Asp Ala Ser
Phe Ser Phe Asn Glu Val Glu Leu 40 45
50aca aag gtg gag acc aaa ggt ggt act ttc gcc tca gtg tca att ccg
905Thr Lys Val Glu Thr Lys Gly Gly Thr Phe Ala Ser Val Ser Ile Pro55
60 65 70ggt gca ttc ccg acc
ggt gag gtt ggt tct ccc gaa gtg cca gca gtt 953Gly Ala Phe Pro Thr
Gly Glu Val Gly Ser Pro Glu Val Pro Ala Val 75
80 85agg aag ttg att gct gtg cct gtc gga gcc aca
cct gtt gtt cgc gtg 1001Arg Lys Leu Ile Ala Val Pro Val Gly Ala Thr
Pro Val Val Arg Val 90 95
100aaa agt ttt acc gag caa gtt tac tct ctg aac caa tac ggt tcc gaa
1049Lys Ser Phe Thr Glu Gln Val Tyr Ser Leu Asn Gln Tyr Gly Ser Glu
105 110 115aaa ctc atg cca cat caa ccc
tct atg agc aag agt gat gat ccc gaa 1097Lys Leu Met Pro His Gln Pro
Ser Met Ser Lys Ser Asp Asp Pro Glu 120 125
130aag gtt ccc ttc gtt tac aat gct gct gct tat gca cgc aaa ggt ttt
1145Lys Val Pro Phe Val Tyr Asn Ala Ala Ala Tyr Ala Arg Lys Gly Phe135
140 145 150gtc gga caa gaa
ctg acc caa gta gaa atg ttg ggg aca atg cgt ggt 1193Val Gly Gln Glu
Leu Thr Gln Val Glu Met Leu Gly Thr Met Arg Gly 155
160 165gtt cgc att gca gct ctt acc att aat cct
gtt cag tat gat gtg gtt 1241Val Arg Ile Ala Ala Leu Thr Ile Asn Pro
Val Gln Tyr Asp Val Val 170 175
180gca aac caa ttg aag gtt aga aac aac atc gaa att gaa gta agc ttt
1289Ala Asn Gln Leu Lys Val Arg Asn Asn Ile Glu Ile Glu Val Ser Phe
185 190 195caa gga gct gat gaa gta gct
aca caa cgt ttg tat gat gct tct ttt 1337Gln Gly Ala Asp Glu Val Ala
Thr Gln Arg Leu Tyr Asp Ala Ser Phe 200 205
210agc cct tat ttc gaa aca gct tat aaa cag ctc ttc aat aga gat gtt
1385Ser Pro Tyr Phe Glu Thr Ala Tyr Lys Gln Leu Phe Asn Arg Asp Val215
220 225 230tat aca gat cat
ggc gac ttg tat aat acg ccg gtt cgt atg ctt gtt 1433Tyr Thr Asp His
Gly Asp Leu Tyr Asn Thr Pro Val Arg Met Leu Val 235
240 245gtt gca ggt gca aaa ttc aaa gaa gct ctc
aag cct tgg ctc act tgg 1481Val Ala Gly Ala Lys Phe Lys Glu Ala Leu
Lys Pro Trp Leu Thr Trp 250 255
260aag gct caa aag ggc ttc tat ctg gat gtg cat tac aca gac gaa gct
1529Lys Ala Gln Lys Gly Phe Tyr Leu Asp Val His Tyr Thr Asp Glu Ala
265 270 275gaa gta gga acg aca aac gcc
tct atc aag gca ttt att cac aag aaa 1577Glu Val Gly Thr Thr Asn Ala
Ser Ile Lys Ala Phe Ile His Lys Lys 280 285
290tac aat gat gga ttg gca gct agt gct gct ccg gtc ttc ttg gct ttg
1625Tyr Asn Asp Gly Leu Ala Ala Ser Ala Ala Pro Val Phe Leu Ala Leu295
300 305 310gtt ggt gac act
gac gtt att agc gga gaa aaa gga aag aaa aca aaa 1673Val Gly Asp Thr
Asp Val Ile Ser Gly Glu Lys Gly Lys Lys Thr Lys 315
320 325aaa gtt acc gac ttg tat tac agt gca gtc
gat ggc gac tat ttc cct 1721Lys Val Thr Asp Leu Tyr Tyr Ser Ala Val
Asp Gly Asp Tyr Phe Pro 330 335
340gaa atg tat act ttc cgt atg tct gct tct tcc cca gaa gaa ctg acg
1769Glu Met Tyr Thr Phe Arg Met Ser Ala Ser Ser Pro Glu Glu Leu Thr
345 350 355aac atc att gat aag gta ttg
atg tat gaa aag gct act atg cca gat 1817Asn Ile Ile Asp Lys Val Leu
Met Tyr Glu Lys Ala Thr Met Pro Asp 360 365
370aag agt tat ttg gag aaa gtt ctc ttg att gca ggt gca gat tat agc
1865Lys Ser Tyr Leu Glu Lys Val Leu Leu Ile Ala Gly Ala Asp Tyr Ser375
380 385 390tgg aat tcc cag
gta ggt cag cca acc att aaa tac ggt atg cag tac 1913Trp Asn Ser Gln
Val Gly Gln Pro Thr Ile Lys Tyr Gly Met Gln Tyr 395
400 405tac tac aac caa gag cat ggt tat acc gac
gtg tac aac tat ctc aaa 1961Tyr Tyr Asn Gln Glu His Gly Tyr Thr Asp
Val Tyr Asn Tyr Leu Lys 410 415
420gcc cct tat aca ggt tgc tac agt cat ttg aat acc gga gtc agc ttt
2009Ala Pro Tyr Thr Gly Cys Tyr Ser His Leu Asn Thr Gly Val Ser Phe
425 430 435gca aac tat aca gcg cat gga
tct gag acc gca tgg gct gat cca ctt 2057Ala Asn Tyr Thr Ala His Gly
Ser Glu Thr Ala Trp Ala Asp Pro Leu 440 445
450ctg act act tct caa ctg aaa gca ctc act aat aag gac aaa tac ttc
2105Leu Thr Thr Ser Gln Leu Lys Ala Leu Thr Asn Lys Asp Lys Tyr Phe455
460 465 470tta gct att ggc
aac tgc tgt att aca gct caa ttc gat tat gta cag 2153Leu Ala Ile Gly
Asn Cys Cys Ile Thr Ala Gln Phe Asp Tyr Val Gln 475
480 485cct tgc ttc gga gag gta ata act cgc gtt
aag gag aaa ggg gct tat 2201Pro Cys Phe Gly Glu Val Ile Thr Arg Val
Lys Glu Lys Gly Ala Tyr 490 495
500gcc tat atc ggt tca tct cca aat tct tat tgg ggc gag gac tac tat
2249Ala Tyr Ile Gly Ser Ser Pro Asn Ser Tyr Trp Gly Glu Asp Tyr Tyr
505 510 515tgg agt gtg ggt gct aat gcc
gta ttt ggt gtt cag cct act ttt gaa 2297Trp Ser Val Gly Ala Asn Ala
Val Phe Gly Val Gln Pro Thr Phe Glu 520 525
530ggt acg tct atg ggt tct tat gat gct aca ttc ttg gag gat tcg tac
2345Gly Thr Ser Met Gly Ser Tyr Asp Ala Thr Phe Leu Glu Asp Ser Tyr535
540 545 550aac aca gtg aat
tct att atg tgg gca ggt aat ctt gcc gct act cat 2393Asn Thr Val Asn
Ser Ile Met Trp Ala Gly Asn Leu Ala Ala Thr His 555
560 565gct gga aat atc ggc aat att acc cat att
ggt gct cat tac tat tgg 2441Ala Gly Asn Ile Gly Asn Ile Thr His Ile
Gly Ala His Tyr Tyr Trp 570 575
580gaa gct tat cat gtc ctt ggc gat ggt tcg gtt atg cct tat cgt gca
2489Glu Ala Tyr His Val Leu Gly Asp Gly Ser Val Met Pro Tyr Arg Ala
585 590 595atg cct aag acc aat act tat
acg ctt cct gcc tct ttg cct cag aat 2537Met Pro Lys Thr Asn Thr Tyr
Thr Leu Pro Ala Ser Leu Pro Gln Asn 600 605
610cag gct tct tat agc att cag gct tct gcc ggt tct tac gta gct att
2585Gln Ala Ser Tyr Ser Ile Gln Ala Ser Ala Gly Ser Tyr Val Ala Ile615
620 625 630tct aaa gat gga
gtt ttg tat gga aca ggt gtt gct aat gcc agc ggt 2633Ser Lys Asp Gly
Val Leu Tyr Gly Thr Gly Val Ala Asn Ala Ser Gly 635
640 645gtt gcg act gtg agt atg act aag cag att
acg gaa aat ggt aat tat 2681Val Ala Thr Val Ser Met Thr Lys Gln Ile
Thr Glu Asn Gly Asn Tyr 650 655
660gat gta gtt atc act cgc tct aat tat ctt cct gtg atc aag caa att
2729Asp Val Val Ile Thr Arg Ser Asn Tyr Leu Pro Val Ile Lys Gln Ile
665 670 675cag gta ggt gag cct agc ccc
tac cag ccc gtt tcc aac ttg aca gct 2777Gln Val Gly Glu Pro Ser Pro
Tyr Gln Pro Val Ser Asn Leu Thr Ala 680 685
690aca acg cag ggt cag aaa gta acg ctc aag tgg gaa gca ccg agc gca
2825Thr Thr Gln Gly Gln Lys Val Thr Leu Lys Trp Glu Ala Pro Ser Ala695
700 705 710aag aag gca gaa
ggt tcc cgt gaa gta aaa cgg atc gga gac ggt ctt 2873Lys Lys Ala Glu
Gly Ser Arg Glu Val Lys Arg Ile Gly Asp Gly Leu 715
720 725ttc gtt acg atc gaa cct gca aac gat gta
cgt gcc aac gaa gcc aag 2921Phe Val Thr Ile Glu Pro Ala Asn Asp Val
Arg Ala Asn Glu Ala Lys 730 735
740gtt gtg ctt gcg gca gac aac gta tgg gga gac aat acg ggt tac cag
2969Val Val Leu Ala Ala Asp Asn Val Trp Gly Asp Asn Thr Gly Tyr Gln
745 750 755ttc ttg ttg gat gcc gat cac
aat aca ttc gga agt gtc att ccg gca 3017Phe Leu Leu Asp Ala Asp His
Asn Thr Phe Gly Ser Val Ile Pro Ala 760 765
770acc ggt cct ctc ttt acc gga aca gct tct tcc aat ctt tac agt gcg
3065Thr Gly Pro Leu Phe Thr Gly Thr Ala Ser Ser Asn Leu Tyr Ser Ala775
780 785 790aac ttc gag tat
ttg gtc ccg gcc aat gcc gat cct gtt gtt act aca 3113Asn Phe Glu Tyr
Leu Val Pro Ala Asn Ala Asp Pro Val Val Thr Thr 795
800 805cag aat att atc gtt aca gga cag ggt gaa
gtt gta atc ccc ggt ggt 3161Gln Asn Ile Ile Val Thr Gly Gln Gly Glu
Val Val Ile Pro Gly Gly 810 815
820gtt tac gac tat tgc att acg aac ccg gaa cct gca tcc gga aag atg
3209Val Tyr Asp Tyr Cys Ile Thr Asn Pro Glu Pro Ala Ser Gly Lys Met
825 830 835tgg atc gca gga gat gga ggc
aac cag cct gca cgt tat gac gat ttc 3257Trp Ile Ala Gly Asp Gly Gly
Asn Gln Pro Ala Arg Tyr Asp Asp Phe 840 845
850aca ttc gaa gca ggc aag aag tac acc ttc acg atg cgt cgc gcc gga
3305Thr Phe Glu Ala Gly Lys Lys Tyr Thr Phe Thr Met Arg Arg Ala Gly855
860 865 870atg gga gat gga
act gat atg gaa gtc gaa gac gat tca cct gca agc 3353Met Gly Asp Gly
Thr Asp Met Glu Val Glu Asp Asp Ser Pro Ala Ser 875
880 885tat acc tac acg gtg tat cgt gac ggc acg
aag atc aag gaa ggt ctg 3401Tyr Thr Tyr Thr Val Tyr Arg Asp Gly Thr
Lys Ile Lys Glu Gly Leu 890 895
900aca gct acg aca ttc gaa gaa gac ggt gta gct gca ggc aat cat gag
3449Thr Ala Thr Thr Phe Glu Glu Asp Gly Val Ala Ala Gly Asn His Glu
905 910 915tat tgc gtg gaa gtt aag tac
aca gcc ggc gta tct ccg aag gta tgt 3497Tyr Cys Val Glu Val Lys Tyr
Thr Ala Gly Val Ser Pro Lys Val Cys 920 925
930aaa gac gtt acg gta gaa gga tcc aat gaa ttt gct cct gta cag aac
3545Lys Asp Val Thr Val Glu Gly Ser Asn Glu Phe Ala Pro Val Gln Asn935
940 945 950ctg acc ggt agt
tca gta ggt cag aaa gta acg ctt aag tgg gat gca 3593Leu Thr Gly Ser
Ser Val Gly Gln Lys Val Thr Leu Lys Trp Asp Ala 955
960 965cct aat ggt acc ccg aat ccg aat cca aat
ccg aat ccg aat ccg gga 3641Pro Asn Gly Thr Pro Asn Pro Asn Pro Asn
Pro Asn Pro Asn Pro Gly 970 975
980aca aca ctt tcc gaa tca ttc gaa aat ggt att ccg gca tct tgg aag
3689Thr Thr Leu Ser Glu Ser Phe Glu Asn Gly Ile Pro Ala Ser Trp Lys
985 990 995acg atc gat gca gac ggt gac
ggg cat ggc tgg aaa cct gga aat gct 3737Thr Ile Asp Ala Asp Gly Asp
Gly His Gly Trp Lys Pro Gly Asn Ala 1000 1005
1010ccc gga atc gct ggc tac aat agc aat ggt tgt gta tat tca gag tca
3785Pro Gly Ile Ala Gly Tyr Asn Ser Asn Gly Cys Val Tyr Ser Glu
Ser1015 1020 1025 1030ttc
ggt ctt ggt ggt ata gga gtt ctt acc cct gac aac tat ctg ata 3833Phe
Gly Leu Gly Gly Ile Gly Val Leu Thr Pro Asp Asn Tyr Leu Ile
1035 1040 1045aca ccg gca ttg gat ttg cct
aac gga ggt aag ttg act ttc tgg gta 3881Thr Pro Ala Leu Asp Leu Pro
Asn Gly Gly Lys Leu Thr Phe Trp Val 1050 1055
1060tgc gca cag gat gct aat tat gca tcc gag cac tat gcg gtg
tat gca 3929Cys Ala Gln Asp Ala Asn Tyr Ala Ser Glu His Tyr Ala Val
Tyr Ala 1065 1070 1075tct tcg acc
ggt aac gat gca tcc aac ttc acg aat gct ttg ttg gaa 3977Ser Ser Thr
Gly Asn Asp Ala Ser Asn Phe Thr Asn Ala Leu Leu Glu 1080
1085 1090gag acg att acg gca aaa ggt gtt cgc tcg ccg aaa
gct att cgt ggt 4025Glu Thr Ile Thr Ala Lys Gly Val Arg Ser Pro Lys
Ala Ile Arg Gly1095 1100 1105
1110cgt ata cag ggt act tgg cgc cag aag acg gta gac ctt ccc gca ggt
4073Arg Ile Gln Gly Thr Trp Arg Gln Lys Thr Val Asp Leu Pro Ala Gly
1115 1120 1125acg aaa tat gtt gct
ttc cgt cac ttc caa agc acg gat atg ttc tac 4121Thr Lys Tyr Val Ala
Phe Arg His Phe Gln Ser Thr Asp Met Phe Tyr 1130
1135 1140atc gac ctt gat gag gtt gag atc aag gcc aat ggc
aag cgc gca gac 4169Ile Asp Leu Asp Glu Val Glu Ile Lys Ala Asn Gly
Lys Arg Ala Asp 1145 1150 1155ttc
acg gaa acg ttc gag tct tct act cat gga gag gca cca gcg gaa 4217Phe
Thr Glu Thr Phe Glu Ser Ser Thr His Gly Glu Ala Pro Ala Glu 1160
1165 1170tgg act act atc gat gcc gat ggc gat ggt
cag ggt tgg ctc tgt ctg 4265Trp Thr Thr Ile Asp Ala Asp Gly Asp Gly
Gln Gly Trp Leu Cys Leu1175 1180 1185
1190tct tcc gga caa ttg gac tgg ctg aca gct cat ggc ggc agc aac
gta 4313Ser Ser Gly Gln Leu Asp Trp Leu Thr Ala His Gly Gly Ser Asn
Val 1195 1200 1205gta agc
tct ttc tca tgg aat gga atg gct ttg aat cct gat aac tat 4361Val Ser
Ser Phe Ser Trp Asn Gly Met Ala Leu Asn Pro Asp Asn Tyr 1210
1215 1220ctc atc tca aag gat gtt aca ggc gca
acg aag gta aag tac tac tat 4409Leu Ile Ser Lys Asp Val Thr Gly Ala
Thr Lys Val Lys Tyr Tyr Tyr 1225 1230
1235gca gtc aac gac ggt ttt ccc ggg gat cac tat gcg gtg atg atc tcc
4457Ala Val Asn Asp Gly Phe Pro Gly Asp His Tyr Ala Val Met Ile Ser
1240 1245 1250aag acg ggc acg aac gcc gga
gac ttc acg gtt gtt ttc gaa gaa acg 4505Lys Thr Gly Thr Asn Ala Gly
Asp Phe Thr Val Val Phe Glu Glu Thr1255 1260
1265 1270cct aac gga ata aat aag ggc gga gca aga ttc ggt
ctt tcc acg gaa 4553Pro Asn Gly Ile Asn Lys Gly Gly Ala Arg Phe Gly
Leu Ser Thr Glu 1275 1280
1285gcc aat ggc gcc aaa cct caa agt gta tgg atc gag cgt acg gta gat
4601Ala Asn Gly Ala Lys Pro Gln Ser Val Trp Ile Glu Arg Thr Val Asp
1290 1295 1300ttg cct gca ggc acg aag
tat gtt gct ttc cgt cac tac aat tgc tcg 4649Leu Pro Ala Gly Thr Lys
Tyr Val Ala Phe Arg His Tyr Asn Cys Ser 1305 1310
1315gat ttg aac tac att ctt ttg gat gat att cag ttc acc atg
ggt ggc 4697Asp Leu Asn Tyr Ile Leu Leu Asp Asp Ile Gln Phe Thr Met
Gly Gly 1320 1325 1330agc ccc acc ccg
acc gat tat acc tac acg gtg tat cgt gat ggt acg 4745Ser Pro Thr Pro
Thr Asp Tyr Thr Tyr Thr Val Tyr Arg Asp Gly Thr1335 1340
1345 1350aag atc aag gaa ggt ttg acc gaa acg
acc ttc gaa gaa gac ggc gta 4793Lys Ile Lys Glu Gly Leu Thr Glu Thr
Thr Phe Glu Glu Asp Gly Val 1355 1360
1365gct acg ggc aat cat gag tat tgc gtg gaa gtg aag tac aca gcc
ggc 4841Ala Thr Gly Asn His Glu Tyr Cys Val Glu Val Lys Tyr Thr Ala
Gly 1370 1375 1380gta tct ccg
aag aaa tgt gta gac gta act gtt aat tcg aca cag ttc 4889Val Ser Pro
Lys Lys Cys Val Asp Val Thr Val Asn Ser Thr Gln Phe 1385
1390 1395aat cct gta cag aac ctg acg gca gaa caa gct
cct aac agc atg gat 4937Asn Pro Val Gln Asn Leu Thr Ala Glu Gln Ala
Pro Asn Ser Met Asp 1400 1405 1410gca
atc ctt aaa tgg aat gca ccg gca tct aag cgt gcg gaa gtt ctg 4985Ala
Ile Leu Lys Trp Asn Ala Pro Ala Ser Lys Arg Ala Glu Val Leu1415
1420 1425 1430aac gaa gac ttc gaa aat
ggt att cct gcc tca tgg aag acg atc gat 5033Asn Glu Asp Phe Glu Asn
Gly Ile Pro Ala Ser Trp Lys Thr Ile Asp 1435
1440 1445gca gac ggt gac ggc aac aat tgg acg acg acc cct
cct ccc gga ggc 5081Ala Asp Gly Asp Gly Asn Asn Trp Thr Thr Thr Pro
Pro Pro Gly Gly 1450 1455
1460tcc tct ttt gca ggt cac aac agt gcg atc tgt gtc tct tca gct tct
5129Ser Ser Phe Ala Gly His Asn Ser Ala Ile Cys Val Ser Ser Ala Ser
1465 1470 1475cat atc aac ttt gaa ggt cct
cag aac cct gat aac tat ctg gtt aca 5177His Ile Asn Phe Glu Gly Pro
Gln Asn Pro Asp Asn Tyr Leu Val Thr 1480 1485
1490ccg gag ctt tct ctt cct ggc gga gga acg ctt act ttc tgg gta tgt
5225Pro Glu Leu Ser Leu Pro Gly Gly Gly Thr Leu Thr Phe Trp Val
Cys1495 1500 1505 1510gca
caa gat gcc aat tat gca tca gag cac tat gcc gtg tac gca tct 5273Ala
Gln Asp Ala Asn Tyr Ala Ser Glu His Tyr Ala Val Tyr Ala Ser
1515 1520 1525tct acg ggt aac gac gct tcc
aac ttc gcc aac gct ttg ttg gaa gaa 5321Ser Thr Gly Asn Asp Ala Ser
Asn Phe Ala Asn Ala Leu Leu Glu Glu 1530 1535
1540gtg ctg acg gcc aag aca gtt gtt acg gca cct gaa gcc att
cgt ggt 5369Val Leu Thr Ala Lys Thr Val Val Thr Ala Pro Glu Ala Ile
Arg Gly 1545 1550 1555act cgt gct
cag ggc acc tgg tat caa aag acg gta cag ttg cct gcg 5417Thr Arg Ala
Gln Gly Thr Trp Tyr Gln Lys Thr Val Gln Leu Pro Ala 1560
1565 1570ggt act aag tat gtt gcc ttc cgt cac ttc ggc tgt
acg gac ttc ttc 5465Gly Thr Lys Tyr Val Ala Phe Arg His Phe Gly Cys
Thr Asp Phe Phe1575 1580 1585
1590tgg atc aac ctt gat gat gtt gta atc act tca ggg aac gct ccg tct
5513Trp Ile Asn Leu Asp Asp Val Val Ile Thr Ser Gly Asn Ala Pro Ser
1595 1600 1605tac acc tat acg atc
tat cgt aat aat aca cag ata gca tca ggc gta 5561Tyr Thr Tyr Thr Ile
Tyr Arg Asn Asn Thr Gln Ile Ala Ser Gly Val 1610
1615 1620acg gag act act tac cga gat ccg gac ttg gct acc
ggt ttt tac acg 5609Thr Glu Thr Thr Tyr Arg Asp Pro Asp Leu Ala Thr
Gly Phe Tyr Thr 1625 1630 1635tac
ggt gta aag gtt gtt tac ccg aac gga gaa tca gct atc gaa act 5657Tyr
Gly Val Lys Val Val Tyr Pro Asn Gly Glu Ser Ala Ile Glu Thr 1640
1645 1650gct acg ttg aat atc act tcg ttg gca gac
gta acg gct cag aag cct 5705Ala Thr Leu Asn Ile Thr Ser Leu Ala Asp
Val Thr Ala Gln Lys Pro1655 1660 1665
1670tac acg ctg aca gtt gta gga aag acg atc acg gta act tgc caa
ggc 5753Tyr Thr Leu Thr Val Val Gly Lys Thr Ile Thr Val Thr Cys Gln
Gly 1675 1680 1685gaa gct
atg atc tac gac atg aac ggt cgt cgt ctg gca gcg ggt cgc 5801Glu Ala
Met Ile Tyr Asp Met Asn Gly Arg Arg Leu Ala Ala Gly Arg 1690
1695 1700aac acg gtt gtt tac acg gct cag ggc
ggc cac tat gca gtc atg gtt 5849Asn Thr Val Val Tyr Thr Ala Gln Gly
Gly His Tyr Ala Val Met Val 1705 1710
1715gtc gtt gac ggc aag tct tac gta gag aaa ctc gct gta aag
5891Val Val Asp Gly Lys Ser Tyr Val Glu Lys Leu Ala Val Lys 1720
1725 1730taaatctgtc ttggactcgg agactttgtg
cagacacttt taagataggt ctgtaattgt 5951ctcagagtat gaatcggtcg cccgacttcc
ttaaaaggag gtcgggcga 6000241732PRTPorphyromonas gingivalis
24Met Arg Lys Leu Leu Leu Leu Ile Ala Ala Ser Leu Leu Gly Val Gly1
5 10 15Leu Tyr Ala Gln Ser Ala
Lys Ile Lys Leu Asp Ala Pro Thr Thr Arg 20 25
30Thr Thr Cys Thr Asn Asn Ser Phe Lys Gln Phe Asp Ala
Ser Phe Ser 35 40 45Phe Asn Glu
Val Glu Leu Thr Lys Val Glu Thr Lys Gly Gly Thr Phe 50
55 60Ala Ser Val Ser Ile Pro Gly Ala Phe Pro Thr Gly
Glu Val Gly Ser65 70 75
80Pro Glu Val Pro Ala Val Arg Lys Leu Ile Ala Val Pro Val Gly Ala
85 90 95Thr Pro Val Val Arg Val
Lys Ser Phe Thr Glu Gln Val Tyr Ser Leu 100
105 110Asn Gln Tyr Gly Ser Glu Lys Leu Met Pro His Gln
Pro Ser Met Ser 115 120 125Lys Ser
Asp Asp Pro Glu Lys Val Pro Phe Val Tyr Asn Ala Ala Ala 130
135 140Tyr Ala Arg Lys Gly Phe Val Gly Gln Glu Leu
Thr Gln Val Glu Met145 150 155
160Leu Gly Thr Met Arg Gly Val Arg Ile Ala Ala Leu Thr Ile Asn Pro
165 170 175Val Gln Tyr Asp
Val Val Ala Asn Gln Leu Lys Val Arg Asn Asn Ile 180
185 190Glu Ile Glu Val Ser Phe Gln Gly Ala Asp Glu
Val Ala Thr Gln Arg 195 200 205Leu
Tyr Asp Ala Ser Phe Ser Pro Tyr Phe Glu Thr Ala Tyr Lys Gln 210
215 220Leu Phe Asn Arg Asp Val Tyr Thr Asp His
Gly Asp Leu Tyr Asn Thr225 230 235
240Pro Val Arg Met Leu Val Val Ala Gly Ala Lys Phe Lys Glu Ala
Leu 245 250 255Lys Pro Trp
Leu Thr Trp Lys Ala Gln Lys Gly Phe Tyr Leu Asp Val 260
265 270His Tyr Thr Asp Glu Ala Glu Val Gly Thr
Thr Asn Ala Ser Ile Lys 275 280
285Ala Phe Ile His Lys Lys Tyr Asn Asp Gly Leu Ala Ala Ser Ala Ala 290
295 300Pro Val Phe Leu Ala Leu Val Gly
Asp Thr Asp Val Ile Ser Gly Glu305 310
315 320Lys Gly Lys Lys Thr Lys Lys Val Thr Asp Leu Tyr
Tyr Ser Ala Val 325 330
335Asp Gly Asp Tyr Phe Pro Glu Met Tyr Thr Phe Arg Met Ser Ala Ser
340 345 350Ser Pro Glu Glu Leu Thr
Asn Ile Ile Asp Lys Val Leu Met Tyr Glu 355 360
365Lys Ala Thr Met Pro Asp Lys Ser Tyr Leu Glu Lys Val Leu
Leu Ile 370 375 380Ala Gly Ala Asp Tyr
Ser Trp Asn Ser Gln Val Gly Gln Pro Thr Ile385 390
395 400Lys Tyr Gly Met Gln Tyr Tyr Tyr Asn Gln
Glu His Gly Tyr Thr Asp 405 410
415Val Tyr Asn Tyr Leu Lys Ala Pro Tyr Thr Gly Cys Tyr Ser His Leu
420 425 430Asn Thr Gly Val Ser
Phe Ala Asn Tyr Thr Ala His Gly Ser Glu Thr 435
440 445Ala Trp Ala Asp Pro Leu Leu Thr Thr Ser Gln Leu
Lys Ala Leu Thr 450 455 460Asn Lys Asp
Lys Tyr Phe Leu Ala Ile Gly Asn Cys Cys Ile Thr Ala465
470 475 480Gln Phe Asp Tyr Val Gln Pro
Cys Phe Gly Glu Val Ile Thr Arg Val 485
490 495Lys Glu Lys Gly Ala Tyr Ala Tyr Ile Gly Ser Ser
Pro Asn Ser Tyr 500 505 510Trp
Gly Glu Asp Tyr Tyr Trp Ser Val Gly Ala Asn Ala Val Phe Gly 515
520 525Val Gln Pro Thr Phe Glu Gly Thr Ser
Met Gly Ser Tyr Asp Ala Thr 530 535
540Phe Leu Glu Asp Ser Tyr Asn Thr Val Asn Ser Ile Met Trp Ala Gly545
550 555 560Asn Leu Ala Ala
Thr His Ala Gly Asn Ile Gly Asn Ile Thr His Ile 565
570 575Gly Ala His Tyr Tyr Trp Glu Ala Tyr His
Val Leu Gly Asp Gly Ser 580 585
590Val Met Pro Tyr Arg Ala Met Pro Lys Thr Asn Thr Tyr Thr Leu Pro
595 600 605Ala Ser Leu Pro Gln Asn Gln
Ala Ser Tyr Ser Ile Gln Ala Ser Ala 610 615
620Gly Ser Tyr Val Ala Ile Ser Lys Asp Gly Val Leu Tyr Gly Thr
Gly625 630 635 640Val Ala
Asn Ala Ser Gly Val Ala Thr Val Ser Met Thr Lys Gln Ile
645 650 655Thr Glu Asn Gly Asn Tyr Asp
Val Val Ile Thr Arg Ser Asn Tyr Leu 660 665
670Pro Val Ile Lys Gln Ile Gln Val Gly Glu Pro Ser Pro Tyr
Gln Pro 675 680 685Val Ser Asn Leu
Thr Ala Thr Thr Gln Gly Gln Lys Val Thr Leu Lys 690
695 700Trp Glu Ala Pro Ser Ala Lys Lys Ala Glu Gly Ser
Arg Glu Val Lys705 710 715
720Arg Ile Gly Asp Gly Leu Phe Val Thr Ile Glu Pro Ala Asn Asp Val
725 730 735Arg Ala Asn Glu Ala
Lys Val Val Leu Ala Ala Asp Asn Val Trp Gly 740
745 750Asp Asn Thr Gly Tyr Gln Phe Leu Leu Asp Ala Asp
His Asn Thr Phe 755 760 765Gly Ser
Val Ile Pro Ala Thr Gly Pro Leu Phe Thr Gly Thr Ala Ser 770
775 780Ser Asn Leu Tyr Ser Ala Asn Phe Glu Tyr Leu
Val Pro Ala Asn Ala785 790 795
800Asp Pro Val Val Thr Thr Gln Asn Ile Ile Val Thr Gly Gln Gly Glu
805 810 815Val Val Ile Pro
Gly Gly Val Tyr Asp Tyr Cys Ile Thr Asn Pro Glu 820
825 830Pro Ala Ser Gly Lys Met Trp Ile Ala Gly Asp
Gly Gly Asn Gln Pro 835 840 845Ala
Arg Tyr Asp Asp Phe Thr Phe Glu Ala Gly Lys Lys Tyr Thr Phe 850
855 860Thr Met Arg Arg Ala Gly Met Gly Asp Gly
Thr Asp Met Glu Val Glu865 870 875
880Asp Asp Ser Pro Ala Ser Tyr Thr Tyr Thr Val Tyr Arg Asp Gly
Thr 885 890 895Lys Ile Lys
Glu Gly Leu Thr Ala Thr Thr Phe Glu Glu Asp Gly Val 900
905 910Ala Ala Gly Asn His Glu Tyr Cys Val Glu
Val Lys Tyr Thr Ala Gly 915 920
925Val Ser Pro Lys Val Cys Lys Asp Val Thr Val Glu Gly Ser Asn Glu 930
935 940Phe Ala Pro Val Gln Asn Leu Thr
Gly Ser Ser Val Gly Gln Lys Val945 950
955 960Thr Leu Lys Trp Asp Ala Pro Asn Gly Thr Pro Asn
Pro Asn Pro Asn 965 970
975Pro Asn Pro Asn Pro Gly Thr Thr Leu Ser Glu Ser Phe Glu Asn Gly
980 985 990Ile Pro Ala Ser Trp Lys
Thr Ile Asp Ala Asp Gly Asp Gly His Gly 995 1000
1005Trp Lys Pro Gly Asn Ala Pro Gly Ile Ala Gly Tyr Asn Ser
Asn Gly 1010 1015 1020Cys Val Tyr Ser
Glu Ser Phe Gly Leu Gly Gly Ile Gly Val Leu Thr1025 1030
1035 1040Pro Asp Asn Tyr Leu Ile Thr Pro Ala
Leu Asp Leu Pro Asn Gly Gly 1045 1050
1055Lys Leu Thr Phe Trp Val Cys Ala Gln Asp Ala Asn Tyr Ala Ser
Glu 1060 1065 1070His Tyr Ala
Val Tyr Ala Ser Ser Thr Gly Asn Asp Ala Ser Asn Phe 1075
1080 1085Thr Asn Ala Leu Leu Glu Glu Thr Ile Thr Ala
Lys Gly Val Arg Ser 1090 1095 1100Pro
Lys Ala Ile Arg Gly Arg Ile Gln Gly Thr Trp Arg Gln Lys Thr1105
1110 1115 1120Val Asp Leu Pro Ala Gly
Thr Lys Tyr Val Ala Phe Arg His Phe Gln 1125
1130 1135Ser Thr Asp Met Phe Tyr Ile Asp Leu Asp Glu Val
Glu Ile Lys Ala 1140 1145
1150Asn Gly Lys Arg Ala Asp Phe Thr Glu Thr Phe Glu Ser Ser Thr His
1155 1160 1165Gly Glu Ala Pro Ala Glu Trp
Thr Thr Ile Asp Ala Asp Gly Asp Gly 1170 1175
1180Gln Gly Trp Leu Cys Leu Ser Ser Gly Gln Leu Asp Trp Leu Thr
Ala1185 1190 1195 1200His
Gly Gly Ser Asn Val Val Ser Ser Phe Ser Trp Asn Gly Met Ala
1205 1210 1215Leu Asn Pro Asp Asn Tyr Leu
Ile Ser Lys Asp Val Thr Gly Ala Thr 1220 1225
1230Lys Val Lys Tyr Tyr Tyr Ala Val Asn Asp Gly Phe Pro Gly
Asp His 1235 1240 1245Tyr Ala Val
Met Ile Ser Lys Thr Gly Thr Asn Ala Gly Asp Phe Thr 1250
1255 1260Val Val Phe Glu Glu Thr Pro Asn Gly Ile Asn Lys
Gly Gly Ala Arg1265 1270 1275
1280Phe Gly Leu Ser Thr Glu Ala Asn Gly Ala Lys Pro Gln Ser Val Trp
1285 1290 1295Ile Glu Arg Thr Val
Asp Leu Pro Ala Gly Thr Lys Tyr Val Ala Phe 1300
1305 1310Arg His Tyr Asn Cys Ser Asp Leu Asn Tyr Ile Leu
Leu Asp Asp Ile 1315 1320 1325Gln
Phe Thr Met Gly Gly Ser Pro Thr Pro Thr Asp Tyr Thr Tyr Thr 1330
1335 1340Val Tyr Arg Asp Gly Thr Lys Ile Lys Glu
Gly Leu Thr Glu Thr Thr1345 1350 1355
1360Phe Glu Glu Asp Gly Val Ala Thr Gly Asn His Glu Tyr Cys Val
Glu 1365 1370 1375Val Lys
Tyr Thr Ala Gly Val Ser Pro Lys Lys Cys Val Asp Val Thr 1380
1385 1390Val Asn Ser Thr Gln Phe Asn Pro Val
Gln Asn Leu Thr Ala Glu Gln 1395 1400
1405Ala Pro Asn Ser Met Asp Ala Ile Leu Lys Trp Asn Ala Pro Ala Ser
1410 1415 1420Lys Arg Ala Glu Val Leu Asn
Glu Asp Phe Glu Asn Gly Ile Pro Ala1425 1430
1435 1440Ser Trp Lys Thr Ile Asp Ala Asp Gly Asp Gly Asn
Asn Trp Thr Thr 1445 1450
1455Thr Pro Pro Pro Gly Gly Ser Ser Phe Ala Gly His Asn Ser Ala Ile
1460 1465 1470Cys Val Ser Ser Ala Ser
His Ile Asn Phe Glu Gly Pro Gln Asn Pro 1475 1480
1485Asp Asn Tyr Leu Val Thr Pro Glu Leu Ser Leu Pro Gly Gly
Gly Thr 1490 1495 1500Leu Thr Phe Trp
Val Cys Ala Gln Asp Ala Asn Tyr Ala Ser Glu His1505 1510
1515 1520Tyr Ala Val Tyr Ala Ser Ser Thr Gly
Asn Asp Ala Ser Asn Phe Ala 1525 1530
1535Asn Ala Leu Leu Glu Glu Val Leu Thr Ala Lys Thr Val Val Thr
Ala 1540 1545 1550Pro Glu Ala
Ile Arg Gly Thr Arg Ala Gln Gly Thr Trp Tyr Gln Lys 1555
1560 1565Thr Val Gln Leu Pro Ala Gly Thr Lys Tyr Val
Ala Phe Arg His Phe 1570 1575 1580Gly
Cys Thr Asp Phe Phe Trp Ile Asn Leu Asp Asp Val Val Ile Thr1585
1590 1595 1600Ser Gly Asn Ala Pro Ser
Tyr Thr Tyr Thr Ile Tyr Arg Asn Asn Thr 1605
1610 1615Gln Ile Ala Ser Gly Val Thr Glu Thr Thr Tyr Arg
Asp Pro Asp Leu 1620 1625
1630Ala Thr Gly Phe Tyr Thr Tyr Gly Val Lys Val Val Tyr Pro Asn Gly
1635 1640 1645Glu Ser Ala Ile Glu Thr Ala
Thr Leu Asn Ile Thr Ser Leu Ala Asp 1650 1655
1660Val Thr Ala Gln Lys Pro Tyr Thr Leu Thr Val Val Gly Lys Thr
Ile1665 1670 1675 1680Thr
Val Thr Cys Gln Gly Glu Ala Met Ile Tyr Asp Met Asn Gly Arg
1685 1690 1695Arg Leu Ala Ala Gly Arg Asn
Thr Val Val Tyr Thr Ala Gln Gly Gly 1700 1705
1710His Tyr Ala Val Met Val Val Val Asp Gly Lys Ser Tyr Val
Glu Lys 1715 1720 1725Leu Ala Val
Lys 1730
User Contributions:
Comment about this patent or add new information about this topic:
People who visited this patent also read: | |
Patent application number | Title |
---|---|
20130171094 | USE OF VANADIUM COMPOUNDS TO ACCELERATE BONE HEALING |
20130171093 | HEALING POWDER AND METHOD OF USE THEREOF |
20130171092 | ALPHA-CYANOACRYLATE ESTER SYNTHESIS |
20130171091 | Nanocell Drug Delivery System |
20130171090 | METHODS OF TREATING HEPATIC ENCEPHALOPATHY |