Inventors list |
Assignees list |
Classification tree browser |
Top 100 Inventors |
Top 100 Assignees |
Patent application title: MORAXELLA (BRANHAMELLA) CATARRHALIS ANTIGENS
Inventors:
Denis Martin (St.augustin-De-Desmaures, CA)
Josee Hamel (Sillery, CA)
Bernard R. Brodeur (Sillery, CA)
Stephane Rioux (Beauport, CA)
Julie Couture (St-Augustin-De-Desmaures, CA)
Assignees:
ID BIOMEDICAL CORPORATION
IPC8 Class: AA61K3902FI
USPC Class:
4241901
Class name: Disclosed amino acid sequence derived from bacterium (e.g., Mycoplasma, Anaplasma, etc.)
Publication date: 03/19/2009
Patent application number: 20090074807
Sign up to receive free email alerts when patent applications with chosen keywords are published SIGN UP
Abstract:
The present invention relates to polypeptides of Moraxella (Branhamella)
catarrhalis which may be useful for prophylaxis, diagnostic and/or
therapy purposes.Claims:
1.-22. (canceled)
23. A method for prophylactic or therapeutic treatment of Moraxella catarrhalis infection in a host susceptible to Moraxella catarrhalis infection, said method comprising administering to the host a prophylactic or therapeutic amount of a pharmaceutical composition that comprises (a) a pharmaceutically acceptable carrier or diluent and (b) a polypeptide comprising a polypeptide fragment that comprises at least 15 contiguous amino acids of the amino acid sequence set forth in SEQ ID NO: 10, wherein the polypeptide fragment is capable of eliciting an immune response in the host against Moraxella catarrhalis, and wherein the polypeptide fragment is capable of eliciting antibodies that specifically bind to a polypeptide consisting of the amino acid sequence set forth as SEQ ID NO: 10.
24. The method according to claim 23 wherein the host is a neonate, an infant, a child, or an adult.
25. The method according to claim 23 wherein the host is an immunocompromised host.
26.-31. (canceled)
32. The method according to claim 23 wherein the pharmaceutical composition further comprises a pharmaceutically acceptable adjuvant.
33. The method of claim 23 wherein the Moraxella catarrhalis infection comprises otitis media, sinusitis, persistent cough, acute laryngitis, suppurative keratitis, or conjunctivitis neonatorum.
34. A method for prophylactic or therapeutic treatment of Moraxella catarrhalis infection in a host susceptible to Moraxella catarrhalis infection, said method comprising administering to the host a prophylactic or therapeutic amount of a pharmaceutical composition that comprises (a) a pharmaceutically acceptable carrier or diluent and (b) (i) an isolated polypeptide comprising an amino acid sequence at least 90% identical to the amino acid sequence set forth as SEQ ID NO: 10; or (ii) an isolated polypeptide that consists of an amino acid sequence at least 90% identical to the amino acid sequence set forth as SEQ ID NO: 10 and from which the signal peptide amino acid sequence set forth as SEQ ID NO:32 is deleted,wherein the isolated polypeptide is capable of eliciting an immune response in the host against Moraxella catarrhalis, and wherein the isolated polypeptide is capable of eliciting antibodies that specifically bind to a polypeptide consisting of the amino acid sequence set forth as SEQ ID NO: 10.
35. The method according to claim 34 wherein the polypeptide comprises an amino acid sequence at least 95% identical to the amino acid sequence set forth as SEQ ID NO: 10.
36. The method according to claim 34 wherein the polypeptide comprises the amino acid sequence set forth as SEQ ID NO:10.
37. The method according to claim 34 wherein the pharmaceutical composition further comprises a pharmaceutically acceptable adjuvant.
38. The method of claim 34 wherein the host is a neonate, an infant, a child, or an adult.
39. The method of claim 34 wherein the host is an immunocompromised host.
40. The method of claim 34 wherein the Moraxella catarrhalis infection comprises otitis media, sinusitis, persistent cough, acute laryngitis, suppurative keratitis, or conjunctivitis neonatorum.
41. A method for prophylactic or therapeutic treatment of Moraxella catarrhalis infection in a host susceptible to Moraxella catarrhalis infection, said method comprising administering to the host a prophylactic or therapeutic amount of a pharmaceutical composition that comprises (a) a pharmaceutically acceptable carrier or diluent and (b) a chimeric polypeptide comprising two or more polypeptide fragments wherein each of the two or more polypeptide fragments comprises at least 15 contiguous amino acids of the amino acid sequence set forth as SEQ ID NO: 10, wherein the two or more polypeptide fragments are linked to form the chimeric polypeptide, wherein the chimeric polypeptide is capable of eliciting an immune response in the host against Moraxella catarrhalis, and wherein the chimeric polypeptide is capable of eliciting antibodies that specifically bind to a polypeptide consisting of the amino acid sequence set forth as SEQ ID NO: 10.
42. The method of claim 41 wherein the pharmaceutical composition further comprises a pharmaceutically acceptable adjuvant.
43. The method of claim 41 wherein the Moraxella catarrhalis infection comprises otitis media, sinusitis, persistent cough, acute laryngitis, suppurative keratitis, or conjunctivitis neonatorum.
44. The method of claim 41 wherein the host is a neonate, an infant, a child, or an adult.
45. The method of claim 41 wherein the host is an immunocompromised host.
Description:
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001]This application is a continuation of U.S. patent application Ser. No. 10/477,592, now allowed, which has a filing date of Jun. 2, 2004, and which is a national stage application filed under 35 U.S.C. § 371 of International Patent Application PCT/CA02/00706, accorded an international filing date of May 15, 2002, which claims the benefit U.S. Provisional Application No. 60/290,653, filed May 15, 2001, all of which applications are incorporated herein by reference in their entireties.
STATEMENT REGARDING SEQUENCE LISTING
[0002]The Sequence Listing associated with this application is provided in text format in lieu of a paper copy, and is hereby incorporated by reference into the specification. The name of the text file containing the Sequence Listing is 484112--425C1_SEQUENCE_LISTING.txt. The text file is 46 KB, was created on Jul. 15, 2008, and is being submitted electronically via EFS-Web.
FIELD OF THE INVENTION
[0003]The present invention is related to polypeptides, more particularly polypeptides of Moraxella (Branhamella) catarrhalis which may be used to prevent, diagnose and/or treat Moraxella (Branhamella) catarrhalis infection.
BACKGROUND OF THE INVENTION
[0004]Moraxella (Branhamella) catarrhalis is a Gram-negative diplococcus that causes respiratory tract infections in humans. M. catarrhalis is now accepted as the third most common cause of otitis media in infants and children, after Streptococcus pneumoniae and Haemophilus influenzae. M. catarrhalis has also been associated with several other types of infection, including sinusitis, persistent cough, acute laryngitis in adults, suppurative keratitis, conjunctivitis neonatorum, and invasive diseases in the immunocompromised host.
[0005]Since approximately 90% of M. catarrhalis strains are resistant to antibiotics (β-lactamase positive) and that recurrent otitis media is associated with high morbidity, there is a need for the development of a vaccine that will protect hosts from M. catarrhalis infection. An infection by M. catarrhalis induces an immune response against antigens found at the surface of the bacterial cells. However, many of these surface proteins are still not characterized, nor has the immune response resulting in protection from infection by different strains been determined.
[0006]To develop a vaccine that will protect hosts from M. catarrhalis infection, efforts have mainly been concentrated on outer membrane proteins such as the high-molecular-mass protein named ubiquitous surface protein A (UspA). This protein is considered a promising vaccine candidate because a monoclonal antibody and polyclonal antibodies were both shown to be bactericidal and protective in the murine pulmonary-clearance model. However, this protein was shown to be highly variable among the different strains of M. catarrhalis. In addition to this protein, other M. catarrhalis proteins have generated interest as potential vaccine candidates. The transferrin-binding protein which possesses conserved epitopes exposed on the bacterial surface. However, there was divergence in the degree of antibody cross-reactivity with the protein from one strain to another. Other investigators have also focused on the 45-kDa protein CD (OMP CD). This protein is highly conserved among strains of M. catarrhalis, however adults with chronic obstructive pulmonary disease show variability in the immune response against the OMP CD.
[0007]Therefore there remains an unmet need for M. catarrhalis polypeptides which may be used to prevent, diagnose and/or treat Moraxella (Branhamella) catarrhalis infection.
SUMMARY OF THE INVENTION
[0008]According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 70% identity to a second polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof.
[0009]According to one aspect, the present invention relates to polypeptides comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof.
[0010]In other aspects, there are provided polypeptides encoded by polynucleotides of the invention, pharmaceutical compositions, vectors comprising polynucleotides of the invention operably linked to an expression control region, as well as host cells transfected with said vectors and processes for producing polypeptides comprising culturing said host cells under conditions suitable for expression.
BRIEF DESCRIPTION OF THE DRAWINGS
[0011]FIG. 1 represents the DNA sequence of BVH-MC2 gene from M. catarrhalis strain ETSU C-2; SEQ ID NO: 1. The underlined portion of the sequence represents the region coding for the leader peptide.
[0012]FIG. 2 represents the amino acid sequence of BVH-MC2 polypeptide from M. catarrhalis strain ETSU C-2; SEQ ID NO: 2. The underline sequence represents the 30 amino acid residues leader peptide.
[0013]FIG. 3 represents the partial DNA sequence of BVH-MC2 gene from M. catarrhalis strain ETSU 658; SEQ ID NO: 3.
[0014]FIG. 4 represents the partial amino acid sequence of BVH-MC2 polypeptide from M. catarrhalis strain ETSU 658; SEQ ID NO: 4.
[0015]FIG. 5 represents the partial DNA sequence of BVH-MC2 gene from M. catarrhalis strain ETSU T-25; SEQ ID NO: 5.
[0016]FIG. 6 represents the partial amino acid sequence of BVH-MC2 polypeptide from M. catarrhalis strain ETSU T-25; SEQ ID NO: 6.
[0017]FIG. 7 represents the partial DNA sequence of BVH-MC2 gene from M. catarrhalis strain M-12; SEQ ID NO: 7.
[0018]FIG. 8 represents the partial amino acid sequence of BVH-MC2 polypeptide from M. catarrhalis strain M-12; SEQ ID NO: 8.
[0019]FIG. 9 represents the DNA sequence of BVH-MC3 gene from M. catarrhalis strain ETSU C-2; SEQ ID NO: 9. The underlined portion of the sequence represents the region coding for the leader peptide.
[0020]FIG. 10 represents the amino acid sequence of BVH-MC3 polypeptide from M. catarrhalis strain ETSU C-2; SEQ ID NO: 10. The underline sequence represents the 46 amino acid residues leader peptide.
[0021]FIG. 11 represents the DNA sequence of BVH-MC4 gene from M. catarrhalis strain ETSU C-2; SEQ ID NO: 11. The underlined portion of the sequence represents the region coding for the leader peptide.
[0022]FIG. 12 represents the amino acid sequence of BVH-MC4 polypeptide M. catarrhalis strain ETSU C-2; SEQ ID NO: 12. The underline sequence represents the 42 amino acid residues leader peptide.
[0023]FIG. 13 represents the DNA sequence of BVH-MC5 gene from M. catarrhalis strain ETSU C-2; SEQ ID NO: 13. The underlined portion of the sequence represents the region coding for the leader peptide.
[0024]FIG. 14 represents the amino acid sequence of BVH-MC5 polypeptide M. catarrhalis strain ETSU C-2; SEQ ID NO: 14. The underline sequence represents the 60 amino acid residues leader peptide.
[0025]FIG. 15 depicts the comparison of the partial nucleotide sequences (SEQ ID NO:35, 3, 5, and 7) of the BVH-MC2 genes from ETSU C-2, ETSU 658, ETSU T-25, and M-12 M. catarrhalis strains, respectively, by using the program Clustal W from MacVector sequence analysis software (version 6.5). Underneath the alignment, there is a consensus line where * and blank spaces respectively represent identical nucleotides and differences between sequences.
[0026]FIG. 16 depicts the comparison of the predicted amino acid sequences (SEQ ID NO:36, 4, 6, and 8) of the BVH-MC2 partial open reading frames from ETSU C-2, ETSU 658, ETSU T-25, and M-12 M. catarrhalis strains, respectively, by using the program Clustal W from MacVector sequence analysis software (version 6.5). Underneath the alignment, there is a consensus line where * characters represent identical amino acid residues.
DETAILED DESCRIPTION OF THE INVENTION
[0027]The present invention provides purified and isolated polynucleotides, which encode Moraxella polypeptides which may be used to prevent, diagnose and/or treat Moraxella infection.
[0028]According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 70% identity to a second polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof.
[0029]According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 80% identity to a second polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof.
[0030]According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 95% identity to a second polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof.
[0031]According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 70% identity to a second polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14.
[0032]According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 80% identity to a second polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14.
[0033]According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 95% identity to a second polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14.
[0034]According to one aspect, the present invention relates to polypeptides comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof.
[0035]According to one aspect, the present invention relates to polypeptides characterized by the amino acid sequence comprising SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14.
[0036]According to one aspect, the present invention provides a polynucleotide encoding an epitope bearing portion of a polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof.
[0037]According to one aspect, the present invention provides a polynucleotide encoding an epitope bearing portion of a polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14.
[0038]According to one aspect, the present invention relates to epitope bearing portions of a polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof.
[0039]According to one aspect, the present invention relates to epitope bearing portions of a polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14.
[0040]According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 70% identity to a second polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14.
[0041]According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 80% identity to a second polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14.
[0042]According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 90% identity to a second polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14.
[0043]According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 95% identity to a second polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14.
[0044]According to one aspect, the present invention relates to polypeptides comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14.
[0045]According to one aspect, the present invention provides an isolated polynucleotide comprising a polynucleotide chosen from:
[0046](a) a polynucleotide encoding a polypeptide having at least 70% identity to a second polypeptide comprising a sequence chosen from: SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof;
[0047](b) a polynucleotide encoding a polypeptide having at least 80% identity to a second polypeptide comprising a sequence chosen from: SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof;
[0048](c) a polynucleotide encoding a polypeptide having at least 95% identity to a second polypeptide comprising a sequence chosen from: SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof;
[0049](d) a polynucleotide encoding a polypeptide comprising a sequence chosen from: SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof;
[0050](e) a polynucleotide encoding a polypeptide capable of generating antibodies having binding specificity for a polypeptide comprising a sequence chosen from: SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof;
[0051](f) a polynucleotide encoding an epitope bearing portion of a polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof;
[0052](g) a polynucleotide comprising a sequence chosen from SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or fragments or analogs thereof;
[0053](h) a polynucleotide that is complementary to a polynucleotide in (a), (b), (c), (d), (e), (f) or (g).
[0054]According to one aspect, the present invention provides an isolated polynucleotide comprising a polynucleotide chosen from:
[0055](a) a polynucleotide encoding a polypeptide having at least 70% identity to a second polypeptide comprising a sequence chosen from: SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14;
[0056](b) a polynucleotide encoding a polypeptide having at least 80% identity to a second polypeptide comprising a sequence chosen from: SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14;
[0057](c) a polynucleotide encoding a polypeptide having at least 95% identity to a second polypeptide comprising a sequence chosen from: SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14;
[0058](d) a polynucleotide encoding a polypeptide comprising a sequence chosen from: SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14;
[0059](e) a polynucleotide encoding a polypeptide capable of raising antibodies having binding specificity for a polypeptide comprising a sequence chosen from: SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14;
[0060](f) a polynucleotide encoding an epitope bearing portion of a polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14;
[0061](g) a polynucleotide comprising a sequence chosen from SEQ ID NO: 1, 3, 5, 7, 9, 11 and 13;
[0062](h) a polynucleotide that is complementary to a polynucleotide in (a), (b), (c), (d), (e), (f) or (g).
[0063]According to one aspect, the present invention provides an isolated polypeptide comprising a polypeptide chosen from:
[0064](a) a polypeptide having at least 70% identity to a second polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof;
[0065](b) a polypeptide having at least 80% identity to a second polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof;
[0066](c) a polypeptide having at least 95% identity to a second polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof;
[0067](d) a polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof;
[0068](e) a polypeptide capable of raising antibodies having binding specificity for a polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof;
[0069](f) an epitope bearing portion of a polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof;
[0070](g) the polypeptide of (a), (b), (c), (d), (e) or (f) wherein the N-terminal Met residue is deleted;
[0071](h) the polypeptide of (a), (b), (c), (d), (e) or (f) wherein the secretory amino acid sequence is deleted.
[0072]According to one aspect, the present invention provides an isolated polypeptide comprising a polypeptide chosen from:
[0073](a) a polypeptide having at least 70% identity to a second polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14;
[0074](b) a polypeptide having at least 80% identity to a second polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14;
[0075](c) a polypeptide having at least 95% identity to a second polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14;
[0076](d) a polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14;
[0077](e) a polypeptide capable of raising antibodies having binding specificity for a polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14;
[0078](f) an epitope bearing portion of a polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14;
[0079](g) the polypeptide of (a), (b), (c), (d), (e) or (f) wherein the N-terminal Met residue is deleted;
[0080](h) the polypeptide of (a), (b), (c), (d), (e) or (f) wherein the secretory amino acid sequence is deleted.
[0081]Those skilled in the art will appreciate that the invention includes DNA molecules, i.e. polynucleotides and their complementary sequences that encode analogs such as mutants, variants, homologues and derivatives of such polypeptides, as described herein in the present patent application. The invention also includes RNA molecules corresponding to the DNA molecules of the invention. In addition to the DNA and RNA molecules, the invention includes the corresponding polypeptides and monospecific antibodies that specifically bind to such polypeptides.
[0082]In a further embodiment, the polypeptides in accordance with the present invention are antigenic.
[0083]In a further embodiment, the polypeptides in accordance with the present invention are immunogenic.
[0084]In a further embodiment, the polypeptides in accordance with the present invention can elicit an immune response in a host.
[0085]In a further embodiment, the present invention also relates to polypeptides which are able to raise antibodies having binding specificity to the polypeptides of the present invention as defined above.
[0086]An antibody that "has binding specificity" is an antibody that recognizes and binds the selected polypeptide but which does not substantially recognize and bind other molecules in a sample, e.g., a biological sample, which naturally includes the selected peptide. Specific binding can be measured using an ELISA assay in which the selected polypeptide is used as an antigen.
[0087]In accordance with the present invention, "protection" in the biological studies is defined by a significant increase in the survival curve, rate or period. Statistical analysis using the Log rank test to compare survival curves, and Fisher exact test to compare survival rates and numbers of days to death, respectively, might be useful to calculate P values and determine whether the difference between the two groups is statistically significant. P values of 0.05 are regarded as not significant.
[0088]In an additional aspect of the invention there are provided antigenic/immunogenic fragments of the polypeptides of the invention, or of analogs thereof.
[0089]The fragments of the present invention should include one or more such epitopic regions or be sufficiently similar to such regions to retain their antigenic/immunogenic properties. Thus, for fragments according to the present invention the degree of identity is perhaps irrelevant, since they may be 100% identical to a particular part of a polypeptide or analog thereof as described herein. The present invention further provides fragments having at least 10 contiguous amino acid residues from the polypeptide sequences of the present invention. In one embodiment, at least 15 contiguous amino acid residues. In one embodiment, at least 20 contiguous amino acid residues.
[0090]The skilled person will appreciate that analogs of the polypeptides of the invention will also find use in the context of the present invention, i.e. as antigenic/immunogenic material. Thus, for instance proteins or polypeptides which include one or more additions, deletions, substitutions or the like are encompassed by the present invention.
[0091]As used herein, "fragments", "analogs" or "derivatives" of the polypeptides of the invention include those polypeptides in which one or more of the amino acid residues are substituted with a conserved or non-conserved amino acid residue (preferably conserved) and which may be natural or unnatural. In one embodiment, derivatives and analogs of polypeptides of the invention will have about 80% identity with those sequences illustrated in the figures or fragments thereof. That is, 80% of the residues are the same. In a further embodiment, polypeptides will have greater than 80% identity. In a further embodiment, polypeptides will have greater than 85% identity. In a further embodiment, polypeptides will have greater than 90% identity. In a further embodiment, polypeptides will have greater than 95% identity. In a further embodiment, polypeptides will have greater than 99% identity. In a further embodiment, analogs of polypeptides of the invention will have fewer than about 20 amino acid residue substitutions, modifications or deletions and more preferably less than 10.
[0092]These substitutions are those having a minimal influence on the secondary structure and hydropathic nature of the polypeptide. Preferred substitutions are those known in the art as conserved, i.e. the substituted residues share physical or chemical properties such as hydrophobicity, size, charge or functional groups. These include substitutions such as those described by Dayhoff, M. in Atlas of Protein Sequence and Structure 5, 1978 and by Argos, P. in EMBO J. 8, 779-785, 1989. For example, amino acids, either natural or unnatural, belonging to one of the following groups represent conservative changes:
[0093]ala, pro, gly, gln, asn, ser, thr, val;
[0094]cys, ser, tyr, thr;
[0095]val, ile, leu, met, ala, phe;
[0096]lys, arg, orn, his; and
[0097]phe, tyr, trp, his.
The preferred substitutions also include substitutions of D-enantiomers for the corresponding L-amino acids.
[0098]In an alternative approach, the analogs could be fusion polypeptides, incorporating moieties which render purification easier, for example by effectively tagging the desired polypeptide. It may be necessary to remove the "tag" or it may be the case that the fusion polypeptide itself retains sufficient antigenicity to be useful.
[0099]The percentage of homology is defined as the sum of the percentage of identity plus the percentage of similarity or conservation of amino acid type.
[0100]In one embodiment, analogs of polypeptides of the invention will have about 70% identity with those sequences illustrated in the figures or fragments thereof. That is, 70% of the residues are the same. In a further embodiment, polypeptides will have greater than 80% identity. In a further embodiment, polypeptides will have greater than 85% identity. In a further embodiment, polypeptides will have greater than 90% identity. In a further embodiment, polypeptides will have greater than 95% identity. In a further embodiment, polypeptides will have greater than 99% identity. In a further embodiment, analogs of polypeptides of the invention will have fewer than about 20 amino acid residue substitutions, modifications or deletions and more preferably less than 10.
[0101]In one embodiment, analogs of polypeptides of the invention will have about 70% homology with those sequences illustrated in the figures or fragments thereof. In a further embodiment, polypeptides will have greater than 80% homology. In a further embodiment, polypeptides will have greater than 85% homology. In a further embodiment, polypeptides will have greater than 90% homology. In a further embodiment, polypeptides will have greater than 95% homology. In a further embodiment, polypeptides will have greater than 99% homology. In a further embodiment, analogs of polypeptides of the invention will have fewer than about 20 amino acid residue substitutions, modifications or deletions and more preferably less than 10.
[0102]One can use a program such as the CLUSTAL program to compare amino acid sequences. This program compares amino acid sequences and finds the optimal alignment by inserting spaces in either sequence as appropriate. It is possible to calculate amino acid identity or homology for an optimal alignment. A program like BLASTx will align the longest stretch of similar sequences and assign a value to the fit. It is thus possible to obtain a comparison where several regions of similarity are found, each having a different score. Both types of identity analysis are contemplated in the present invention.
[0103]In an alternative approach, the analogs or derivatives could be fusion polypeptides, incorporating moieties which render purification easier, for example by effectively tagging the desired protein or polypeptide, it may be necessary to remove the "tag" or it may be the case that the fusion polypeptide itself retains sufficient antigenicity to be useful.
[0104]It is well known that it is possible to screen an antigenic polypeptide to identify epitopic regions, i.e. those regions which are responsible for the polypeptide's antigenicity or immunogenicity. Methods for carrying out such screening are well known in the art. Thus, the fragments of the present invention should include one or more such epitopic regions or be sufficiently similar to such regions to retain their antigenic/immunogenic properties.
[0105]Thus, for fragments according to the present invention the degree of identity is perhaps irrelevant, since they may be 100% identical to a particular part of a polypeptide, analog as described herein.
[0106]Thus, what is important for analogs, derivatives and fragments is that they possess at least a degree of the antigenicity/immunogenicity of the protein or polypeptide from which they are derived.
[0107]Also included are polypeptides which have fused thereto other compounds which alter the polypeptides biological or pharmacological properties i.e. polyethylene glycol (PEG) to increase half-life; leader or secretory amino acid sequences for ease of purification; prepro- and pro-sequences; and (poly)saccharides.
[0108]Furthermore, in those situations where amino acid regions are found to be polymorphic, it may be desirable to vary one or more particular amino acids to more effectively mimic the different epitopes of the different Moraxella strains.
[0109]Moreover, the polypeptides of the present invention can be modified by terminal --NH2 acylation (e.g., by acetylation, or thioglycolic acid amidation, terminal carboxy amidation, e.g. with ammonia or methylamine) to provide stability, increased hydrophobicity for linking or binding to a support or other molecule.
[0110]Also contemplated are hetero and homo polypeptide multimers of the polypeptide fragments and analogues. These polymeric forms include, for example, one or more polypeptides that have been cross-linked with cross-linkers such as avidin/biotin, gluteraldehyde or dimethylsuperimidate. Such polymeric forms also include polypeptides containing two or more tandem or inverted contiguous sequences, produced from multicistronic mRNAs generated by recombinant DNA technology.
[0111]In a further embodiment, the present invention also relates to chimeric polypeptides which comprise one or more polypeptides or fragments or analogs thereof as defined in the figures of the present application.
[0112]In a further embodiment, the present invention also relates to chimeric polypeptides comprising two or more polypeptides having a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof; provided that the polypeptides are linked as to formed a chimeric polypeptide.
[0113]In a further embodiment, the present invention also relates to chimeric polypeptides comprising two or more polypeptides comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14 provided that the polypeptides are linked as to formed a chimeric polypeptide.
[0114]Preferably, a fragment, analog or derivative of a polypeptide of the invention will comprise at least one antigenic region i.e. at least one epitope.
[0115]In order to achieve the formation of antigenic polymers (i.e. synthetic multimers), polypeptides may be utilized having bishaloacetyl groups, nitroarylhalides, or the like, where the reagents being specific for thio groups. Therefore, the link between two mercapto groups of the different polypeptides may be a single bond or may be composed of a linking group of at least two, typically at least four, and not more than 16, but usually not more than about 14 carbon atoms.
[0116]In a particular embodiment, polypeptide fragments and analogs of the invention do not contain a starting residue, such as methionine (Met) or valine (Val). Preferably, polypeptides will not incorporate a leader or secretory sequence (signal sequence). The signal portion of a polypeptide of the invention may be determined according to established molecular biological techniques. In general, the polypeptide of interest may be isolated from a Moraxella culture and subsequently sequenced to determine the initial residue of the mature protein and therefore the sequence of the mature polypeptide.
[0117]It is understood that polypeptides can be produced and/or used without their start codon (methionine or valine) and/or without their leader peptide to favor production and purification of recombinant polypeptides. It is known that cloning genes without sequences encoding leader peptides will restrict the polypeptides to the cytoplasm of E. coli and will facilitate their recovery (Glick, B. R. and Pasternak, J. J. (1998) Manipulation of gene expression in prokaryotes. In "Molecular biotechnology: Principles and applications of recombinant DNA", 2nd edition, ASM Press, Washington D.C., p. 109-143).
[0118]According to another aspect of the invention, there are also provided (i) a composition of matter containing a polypeptide of the invention, together with a carrier, diluent or adjuvant; (ii) a pharmaceutical composition comprising a polypeptide of the invention and a carrier, diluent or adjuvant; (iii) a vaccine comprising a polypeptide of the invention and a carrier, diluent or adjuvant; (iv) a method for inducing an immune response against Moraxella, in a host, by administering to the host, an immunogenically effective amount of a polypeptide of the invention to elicit an immune response, e.g., a protective immune response to Moraxella; and particularly, (v) a method for preventing and/or treating a Moraxella infection, by administering a prophylactic or therapeutic amount of a polypeptide of the invention to a host in need.
[0119]According to another aspect of the invention, there are also provided (i) a composition of matter containing a polynucleotide of the invention, together with a carrier, diluent or adjuvant; (ii) a pharmaceutical composition comprising a polynucleotide of the invention and a carrier, diluent or adjuvant; (iii) a method for inducing an immune response against Moraxella, in a host, by administering to the host, an immunogenically effective amount of a polynucleotide of the invention to elicit an immune response, e.g., a protective immune response to Moraxella; and particularly, (iv) a method for preventing and/or treating a Moraxella infection, by administering a prophylactic or therapeutic amount of a polynucleotide of the invention to a host in need.
[0120]Before immunization, the polypeptides of the invention can also be coupled or conjugated to carrier proteins such as tetanus toxin, diphtheria toxin, hepatitis B virus surface antigen, poliomyelitis virus VP1 antigen or any other viral or bacterial toxin or antigen or any suitable proteins to stimulate the development of a stronger immune response. This coupling or conjugation can be done chemically or genetically. A more detailed description of peptide-carrier conjugation is available in Van Regenmortel, M. H. V., Briand J. P., Muller S., Plaue S., <<Synthetic Polypeptides as antigens>> in Laboratory Techniques in Biochemistry and Molecular Biology, Vol. 19 (ed.) Burdou, R. H. & Van Knippenberg P. H. (1988), Elsevier N.Y.
[0121]According to another aspect, there are provided pharmaceutical compositions comprising one or more Moraxella polypeptides of the invention in a mixture with a pharmaceutically acceptable adjuvant. Suitable adjuvants include (1) oil-in-water emulsion formulations such as MF59®, SAF®, Ribi®; (2) Freund's complete or incomplete adjuvant; (3) salts i.e. AlK(SO4)2, AlNa(SO4)2, AlNH4(SO4)2, Al(OH)3, AlPO4, silica, kaolin; (4) saponin derivatives such as Stimulon® or particles generated therefrom such as ISCOMs (immunostimulating complexes); (5) cytokines such as interleukins, interferons, macrophage colony stimulating factor (M-CSF), tumor necrosis factor (TNF); (6) other substances such as carbon polynucleotides i.e. poly IC and poly AU, detoxified cholera toxin (CTB) and E. coli heat labile toxin for induction of mucosal immunity. A more detailed description of adjuvant is available in a review by M. Z. I Khan et al. in Pharmaceutical Research, vol. 11, No. 1 (1994) pp 2-11, and also in another review by Gupta et al., in Vaccine, Vol. 13, No. 14, pp 1263-1276 (1995) and in WO 99/24578. Preferred adjuvants include QuilA®, QS21®, Alhydrogel® and Adjuphos®.
[0122]Pharmaceutical compositions of the invention may be administered parenterally by injection, rapid infusion, nasopharyngeal absorption, dermoabsorption, or buccal or oral.
[0123]Pharmaceutical compositions of the invention are used for the prophylaxis of Moraxella infection and/or diseases and symptoms mediated by Moraxella infection as described in Manual of Clinical Microbiology, P. R. Murray (Ed, in chief), E. J. Baron, M. A. Pfaller, F. C. Tenover and R. H. Yolken. ASM Press, Washington, D.C. seventh edition, 1999, 1773p. In one embodiment, pharmaceutical compositions of the present invention are used for the treatment or prophylaxis of otitis media, sinusitis, persistent cough, acute laryngitis, suppurative keratitis, conjunctivitis neonatorum. In one embodiment, vaccine compositions of the invention are used for the treatment or prophylaxis of Moraxella infection and/or diseases and symptoms mediated by Moraxella infection. In a further embodiment, the Moraxella infection is Moraxella catarrhalis.
[0124]In a further embodiment, the invention provides a method for prophylaxis or treatment of Moraxella infection in a host susceptible to Moraxella infection comprising administering to said host a prophylactic or therapeutic amount of a composition of the invention.
[0125]As used in the present application, the term "host" includes mammals. In a further embodiment, the mammal is human.
[0126]In a particular embodiment, pharmaceutical compositions are administered to those hosts at risk of Moraxella infection such as neonates, infants, children, elderly and immunocompromised hosts.
[0127]In a particular embodiment, pharmaceutical compositions are administered to those hosts at risk of Moraxella infection such as adults.
[0128]Pharmaceutical compositions are preferably in unit dosage form of about 0.001 to 100 μg/kg (antigen/body weight) and more preferably 0.01 to 10 μg/kg and most preferably 0.1 to 1 μg/kg 1 to 3 times with an interval of about 1 to 6 week intervals between immunizations.
[0129]Pharmaceutical compositions are preferably in unit dosage form of about 0.1 μg to 10 mg and more preferably 1 μg to 1 mg and most preferably 10 to 100 μg 1 to 3 times with an interval of about 1 to 6 week intervals between immunizations.
[0130]According to another aspect, there are provided polynucleotides encoding polypeptides characterized by the amino acid sequence comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14 or fragments or analogs thereof.
[0131]In one embodiment, polynucleotides are those illustrated in SEQ ID No: 1, 3, 5, 7, 9, 11, 13 which may include the open reading frames (ORF), encoding the polypeptides of the invention.
[0132]It will be appreciated that the polynucleotide sequences illustrated in the figures may be altered with degenerate codons yet still encode the polypeptides of the invention. Accordingly the present invention further provides polynucleotides which hybridize to the polynucleotide sequences herein above described (or the complement sequences thereof) having 70% identity between sequences. In one embodiment, at least 80% identity between sequences. In one embodiment, at least 85% identity between sequences. In one embodiment, at least 90% identity between sequences. In a further embodiment, polynucleotides are hybridizable under stringent conditions i.e. having at least 95% identity. In a further embodiment, more than 97% identity.
[0133]Suitable stringent conditions for hybridization can be readily determined by one of skilled in the art (see for example Sambrook et al., (1989) Molecular cloning: A Laboratory Manual, 2nd ed, Cold Spring Harbor, N.Y.; Current Protocols in Molecular Biology, (1999) Edited by Ausubel F. M. et al., John Wiley & Sons, Inc., N.Y.).
[0134]In a further embodiment, the present invention provides polynucleotides that hybridize under stringent conditions to either
[0135](a) a DNA sequence encoding a polypeptide or
[0136](b) the complement of a DNA sequence encoding a polypeptide;
[0137]wherein said polypeptide comprises a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14 or fragments or analogs thereof.
[0138]In a further embodiment, the present invention provides polynucleotides that hybridize under stringent conditions to either
[0139](a) a DNA sequence encoding a polypeptide or
[0140](b) the complement of a DNA sequence encoding a polypeptide;
[0141]wherein said polypeptide comprises a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14.
[0142]In a further embodiment, the present invention provides polynucleotides that hybridize under stringent conditions to either
[0143](a) a DNA sequence encoding a polypeptide or
[0144](b) the complement of a DNA sequence encoding a polypeptide;
[0145]wherein said polypeptide comprises at least 10 contiguous amino acid residues from a polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14 or fragments or analogs thereof.
[0146]In a further embodiment, the present invention provides polynucleotides that hybridize under stringent conditions to either
[0147](a) a DNA sequence encoding a polypeptide or
[0148](b) the complement of a DNA sequence encoding a polypeptide;
[0149]wherein said polypeptide comprises at least 10 contiguous amino acid residues from a polypeptide comprising a sequence chosen from SEQ ID NO: 2, 4, 6, 8, 10, 12 or 14.
[0150]In a further embodiment, polynucleotides are those illustrated in SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or fragments or analogs thereof encoding polypeptides of the invention.
[0151]In a further embodiment, polynucleotides are those illustrated in SEQ ID NO: 1, 3, 5, 7, 9, 11 or 13 encoding polypeptides of the invention.
[0152]As will be readily appreciated by one skilled in the art, polynucleotides include both DNA and RNA.
[0153]The present invention also includes polynucleotides complementary to the polynucleotides described in the present application.
[0154]In a further aspect, polynucleotides encoding polypeptides of the invention, or fragments, analogs or derivatives thereof, may be used in a DNA immunization method. That is, they can be incorporated into a vector which is replicable and expressible upon injection thereby producing the antigenic polypeptide in vivo. For example polynucleotides may be incorporated into a plasmid vector under the control of the CMV promoter which is functional in eukaryotic cells. Preferably the vector is injected intramuscularly.
[0155]According to another aspect, there is provided a process for producing polypeptides of the invention by recombinant techniques by expressing a polynucleotide encoding said polypeptide in a host cell and recovering the expressed polypeptide product. Alternatively, the polypeptides can be produced according to established synthetic chemical techniques i.e. solution phase or solid phase synthesis of oligopeptides which are ligated to produce the full polypeptide (block ligation).
[0156]General methods for obtention and evaluation of polynucleotides and polypeptides are described in the following references: Sambrook et al, Molecular Cloning: A Laboratory Manual, 2nd ed., Cold Spring Harbor, N.Y., 1989; Current Protocols in Molecular Biology, Edited by Ausubel F. M. et al., John Wiley and Sons, Inc. New York; PCR Cloning Protocols, from Molecular Cloning to Genetic Engineering, Edited by White B. A., Humana Press, Totowa, N.J., 1997, 490 pages; Protein Purification, Principles and Practices, Scopes R. K., Springer-Verlag, New York, 3rd Edition, 1993, 380 pages; Current Protocols in Immunology, Edited by Coligan J. E. et al., John Wiley & Sons Inc., New York.
[0157]The present invention provides a process for producing a polypeptide comprising culturing a host cell of the invention under conditions suitable for expression of said polypeptide.
[0158]For recombinant production, host cells are transfected with vectors which encode the polypeptides of the invention, and then cultured in a nutrient media modified as appropriate for activating promoters, selecting transformants or amplifying the genes. Suitable vectors are those that are viable and replicable in the chosen host and include chromosomal, non-chromosomal and synthetic DNA sequences e.g. bacterial plasmids, phage DNA, baculovirus, yeast plasmids, vectors derived from combinations of plasmids and phage DNA. The polypeptide sequence may be incorporated in the vector at the appropriate site using restriction enzymes such that it is operably linked to an expression control region comprising a promoter, ribosome binding site (consensus region or Shine-Dalgarno sequence), and optionally an operator (control element). One can select individual components of the expression control region that are appropriate for a given host and vector according to established molecular biology principles (Sambrook et al, Molecular Cloning: A Laboratory Manual, 2nd ed, Cold Spring Harbor, N.Y., 1989; Current Protocols in Molecular Biology, Edited by Ausubel F. M. et al., John Wiley and Sons, Inc. New York). Suitable promoters include but are not limited to LTR or SV40 promoter, E. coli lac, tac or trp promoters and the phage lambda PL promoter. Vectors will preferably incorporate an origin of replication as well as selection markers i.e. ampicilin resistance gene. Suitable bacterial vectors include pET, pQE70, pQE60, pQE-9, pD10 phagescript, psiX174, pbluescript SK, pbsks, pNH8A, pNH16a, pNH18A, pNH46A, ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5 and eukaryotic vectors pBlueBacIII, pWLNEO, pSV2CAT, pOG44, pXT1, pSG, pSVK3, pBPV, pMSG and pSVL. Host cells may be bacterial i.e. E. coli, Bacillus subtilis, Streptomyces; fungal i.e. Aspergillus niger, Aspergillus nidulins; yeast i.e. Saccharomyces or eukaryotic i.e. CHO, COS.
[0159]Upon expression of the polypeptide in culture, cells are typically harvested by centrifugation then disrupted by physical or chemical means (if the expressed polypeptide is not secreted into the media) and the resulting crude extract retained to isolate the polypeptide of interest. Purification of the polypeptide from culture media or lysate may be achieved by established techniques depending on the properties of the polypeptide i.e. using ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, hydroxylapatite chromatography and lectin chromatography. Final purification may be achieved using HPLC.
[0160]The polypeptides may be expressed with or without a leader or secretion sequence. In the former case the leader may be removed using post-translational processing (see U.S. Pat. No. 4,431,739; U.S. Pat. No. 4,425,437; and U.S. Pat. No. 4,338,397) or be chemically removed subsequent to purifying the expressed polypeptide.
[0161]According to a further aspect, the Moraxella polypeptides of the invention may be used in a diagnostic test for Moraxella infection, in particular Moraxella catarrhalis infection. Several diagnostic methods are possible, for example detecting Moraxella organism in a biological sample, the following procedure may be followed:
[0162]a) obtaining a biological sample from a host;
[0163]b) incubating an antibody or fragment thereof reactive with a Moraxella polypeptide of the invention with the biological sample to form a mixture; and
[0164]c) detecting specifically bound antibody or bound fragment in the mixture which indicates the presence of Moraxella.
[0165]Alternatively, a method for the detection of antibody specific to a Moraxella antigen in a biological sample containing or suspected of containing said antibody may be performed as follows:
[0166]a) obtaining a biological sample from a host;
[0167]b) incubating one or more Moraxella polypeptides of the invention or fragments thereof with the biological sample to form a mixture; and
[0168]c) detecting specifically bound antigen or bound fragment in the mixture which indicates the presence of antibody specific to Moraxella.
[0169]One of skill in the art will recognize that this diagnostic test may take several forms, including an immunological test such as an enzyme-linked immunosorbent assay (ELISA), a radioimmunoassay or a latex agglutination assay, essentially to determine whether antibodies specific for the protein are present in an organism.
[0170]The DNA sequences encoding polypeptides of the invention may also be used to design DNA probes for use in detecting the presence of Moraxella in a biological sample suspected of containing such bacteria. The detection method of this invention comprises:
[0171]a) obtaining the biological sample from a host;
[0172]b) incubating one or more DNA probes having a DNA sequence encoding a polypeptide of the invention or fragments thereof with the biological sample to form a mixture; and
[0173]c) detecting specifically bound DNA probe in the mixture which indicates the presence of Moraxella bacteria.
[0174]The DNA probes of this invention may also be used for detecting circulating Moraxella i.e. Moraxella nucleic acids in a sample, for example using a polymerase chain reaction, as a method of diagnosing Moraxella infections. The probe may be synthesized using conventional techniques and may be immobilized on a solid phase, or may be labelled with a detectable label. A preferred DNA probe for this application is an oligomer having a sequence complementary to at least about 6 contiguous nucleotides of the Moraxella polypeptides of the invention. In a further embodiment, the preferred DNA probe will be an oligomer having a sequence complementary to at least about 15 contiguous nucleotides of the Moraxella polypeptides of the invention. In a further embodiment, the preferred DNA probe will be an oligomer having a sequence complementary to at least about 30 contiguous nucleotides of the Moraxella polypeptides of the invention. In a further embodiment, the preferred DNA probe will be an oligomer having a sequence complementary to at least about 50 contiguous nucleotides of the Moraxella polypeptides of the invention.
[0175]Another diagnostic method for the detection of Moraxella in a host comprises:
[0176]a) labeling an antibody reactive with a polypeptide of the invention or fragment thereof with a detectable label;
[0177]b) administering the labeled antibody or labeled fragment to the host; and
[0178]c) detecting specifically bound labeled antibody or labeled fragment in the host which indicates the presence of Moraxella.
[0179]Alternatively, a method for the detection of antibody specific to a Moraxella antigen in a biological sample containing or suspected of containing said antibody may be performed as follows:
[0180]a) obtaining a biological sample from a host;
[0181]b) incubating one or more Moraxella polypeptides of the invention or fragments thereof with the biological sample to form a mixture; and
[0182]c) detecting specifically bound antigen or bound fragment in the mixture which indicates the presence of antibody specific to Moraxella.
[0183]One of skill in the art will recognize that the diagnostic test may take several forms, including an immunological test such as an enzyme-linked immunosorbent assay (ELISA), a radioimmunoassay or a latex agglutination assay, essentially to determine whether antibodies specific for the protein are present in an organism.
[0184]The DNA sequences encoding polypeptides of the invention may also be used to design DNA probes for use in detecting the presence of Moraxella in a biological sample suspected of containing such bacteria. The detection method of this invention comprises:
[0185]a) obtaining the biological sample from a host;
[0186]b) incubating one or more DNA probes having a DNA sequence encoding a polypeptide of the invention or fragments thereof with the biological sample to form a mixture; and
[0187]c) detecting specifically bound DNA probe in the mixture which indicates the presence of Moraxella bacteria.
[0188]According to one aspect, the present invention provides the use of an antibody for treatment and/or prophylaxis of Moraxella infections.
[0189]A further aspect of the invention is the use of the Moraxella polypeptides of the invention as immunogens for the production of specific antibodies for the diagnosis and in particular the treatment of Moraxella infection. Suitable antibodies may be determined using appropriate screening methods, for example by measuring the ability of a particular antibody to passively protect against Moraxella infection in a test model. One example of an animal model is the mouse model described in the examples herein. The antibody may be a whole antibody or an antigen-binding fragment thereof and may belong to any immunoglobulin class. The antibody or fragment may be of animal origin, specifically of mammalian origin and more specifically of murine, rat or human origin. It may be a natural antibody or a fragment thereof, or if desired, a recombinant antibody or antibody fragment. The term recombinant antibody or antibody fragment means antibody or antibody fragment which was produced using molecular biology techniques. The antibody or antibody fragments may be polyclonal, or preferably monoclonal. It may be specific for a number of epitopes associated with the Moraxella polypeptides but is preferably specific for one.
[0190]According to one aspect, the present invention provides the use of an antibody for prophylaxis and/or treatment of Moraxella infections.
[0191]A further aspect of the invention is the use of the Moraxella polypeptides of the invention as immunogens for the production of specific antibodies for the diagnosis and in particular the treatment of Moraxella infection. Suitable antibodies may be determined using appropriate screening methods, for example by measuring the ability of a particular antibody to passively protect against Moraxella infection in a test model. One example of an animal model is the mouse model described in the examples herein. The antibody may be a whole antibody or an antigen-binding fragment thereof and may belong to any immunoglobulin class. The antibody or fragment may be of animal origin, specifically of mammalian origin and more specifically of murine, rat or human origin. It may be a natural antibody or a fragment thereof, or if desired, a recombinant antibody or antibody fragment. The term recombinant antibody or antibody fragment means antibody or antibody fragment which was produced using molecular biology techniques. The antibody or antibody fragments may be polyclonal, or preferably monoclonal. It may be specific for a number of epitopes associated with the Moraxella polypeptides but is preferably specific for one.
[0192]A further aspect of the invention is the use of the antibodies directed to the polypeptides of the invention for passive immunization. One could use the antibodies described in the present application.
[0193]A further aspect of the invention is a method for immunization, whereby an antibody raised by a polypeptide of the invention is administered to a host in an amount sufficient to provide a passive immunization.
[0194]In a further embodiment, the invention provides the use of a pharmaceutical composition of the invention in the manufacture of a medicament for the prophylactic or therapeutic treatment of Moraxella infection.
[0195]In a further embodiment, the invention provides a kit comprising a polypeptide of the invention for detection or diagnosis of Moraxella infection.
[0196]Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.
EXAMPLE 1
[0197]This example illustrates the cloning and molecular characteristics of BVH-MC2 gene and corresponding polypeptide.
[0198]The coding region of M. catarrhalis BVH-MC2 (SEQ ID NO: 1) gene was amplified by PCR (DNA Thermal Cycler GeneAmp® PCR system 2400 Perkin Elmer, San Jose, Calif.) from genomic DNA of M. catarrhalis strain ETSU C-2 using the following oligos that contained base extensions for the addition of restriction sites NdeI (CATATG) and XhoI (CTCGAG): DMAR544 (5'-CATCAGTGCATATGAATACGACACACCATCACACG-3') (SEQ ID NO:15); DMAR545 (5'-GAGTTATTCTCGAGTTTGTCCAAATTTGGCTTAGTTTTAC-3') (SEQ ID NO: 15). PCR products were purified from agarose gel using a QIA® quick gel extraction kit from QIA®gen following the manufacturer's instructions (Chatsworth, Calif.), and digested with NdeI and XhoI (AMERSHAM Pharmacia Biotech, Inc, Baie d'Urfe, Canada). The pET21b(+) vector (NOVAGEN, Madison, Wis.) was digested with NdeI and XhoI and purified from agarose gel using a QIA® quick gel extraction kit from QIA®gen (Chatsworth, Calif.). The NdeI-XhoI PCR products were ligated to the NdeI-XhoI pET21b(+) expression vector. The ligated products were transformed into E. coli strain DH5α [φ80dlacZΔM15 Δ(lacZYA-argF)U169 endA1 recA1 hsdR17(rK-mK+) deoR thi-1 supE44λ-gyrA96 relA1] (GIBCO BRL, Gaithersburg, Md.) according to the method of Simanis (Hanahan, D. DNA Cloning, 1985, D. M. Glover (ed), pp. 109-135). Recombinant pET21b(+) plasmid (rpET21b(+)) containing BVH-MC2 gene was purified using a QIA®gen kit (Chatsworth, Calif.) and DNA insert was sequenced (Taq Dye Deoxy Terminator Cycle Sequencing kit, ABI, Foster City, Calif.).
TABLE-US-00001 TABLE 1 Oligonucleotide primers used for PCR amplification of M. catarrhalis genes Primers Restriction Genes I.D. Site Vector Sequence BVH-MC2 DMAR544 NdeI pET21b (+) 5'-CATCAGTGCATATGAATACGACACACC ATC-ACACG-3' (SEQ ID No: 15) BVH-MC2 DMAR545 XhoI pET21b (+) 5'-GAGTTATTCTCGAGTTTGTCCAAATTTG GC-TTAGTTTTAC-3' (SEQ ID No: 16) BVH-MC2 DMAR544a BglII pCMV-GH 5'-TCAGTGAGATCTTGAATACGACACACC ATC-3' (SEQ ID No: 17) BVH-MC2 DMAR545a SalI pCMV-GH 5'-GATTTGAGTTGTCGACTTATTTGTCCAA AT-TTG-3' (SEQ ID No: 18) BVH-MC3 DMAR592 NdeI pET21b (+) 5'-CGGAGTGCCATATGAGCTTAATTAATA AAT-TAAATG-3' (SEQ ID No: 19) BVH-MC3 BMAR593 XhoI pET21b (+) 5'-TATAACTCGAGGTTTTGTGCAACAGGTG TTG-3' (SEQ ID No: 20) BVH-MC3 DMAR592a BglII pCMV-GH 5'-CGCTTGAGATCTTGGAAGATGTGTATCA GC-GTGC-3' (SEQ ID No: 21) BVH-MC3 DMAR593a HindIII pCMV-GH 5'-CAATAACAAAGCTTTCAGTTTTGTGCAA CA-GGTGTTG-3' (SEQ ID No: 22) BVH-MC4 RIOS71 NdeI pET21b (+) 5'-AACCGCACATATGTATCGCTTGGTGTCA CC-ACC-3' (SEQ ID No: 23) BVH-MC4 RIOS72 XhoI pET21b (+) 5'-GGTGACTCGAGGTACTCATCACCAACT AAT-CGCAC-3' (SEQ ID No: 24) BVH-MC4 RIOS71a BamHI pCMV-GH 5'-GCAGGATCCTTATCGCTTGGTGTCACC-3' (SEQ ID No: 25) BVH-MC4 RIOS72a SalI pCMV-GH 5'-ATCAATCGGGTCGACTTAGTACTCATCA CCA-3' (SEQ ID No: 26) BVH-MC5 RIOS59 NdeI pET21b (+) 5'-AAAGCTTCATATGGCCCAAAGTCAAGA ATC-TGCC-3' (SEQ ID No: 27) BVH-MC5 RIOS60 XhoI pET21b (+) 5'-CGATAACTCGAGTTGAACATCAGGCAC CTGC-3' (SEQ ID No: 28) BVH-MC5 RIOS59a BglII pCMV-GH 5'-ACCATTCAAAAGAGATCTTGGCCCAAA GTC-AAGAATCTG-3' (SEQ ID No: 29) BVH-MC5 RIOS60a SalI pCMV-GH 5'-GTTAGACCGAGTCGACTCATTGAACATC AG-GCA-3' (SEQ ID No: 30)
[0199]It was determined that the open reading frame (ORF) which codes for BVH-MC2 polypeptide contains 1467-bp and encodes a 488 amino acid residues polypeptide with a predicted pI of 6.08 and a predicted molecular mass of 53754.35 Da. Analysis of the predicted amino acid residues sequence (SEQ ID NO: 2) using the Spscan software (Wisconsin Sequence Analysis Package; Genetics Computer Group) suggested the existence of a 30 amino acid residues signal peptide (MDTDMKHLTKHRLSAAIIGVLLFISPSVQA) (SEQ ID NO:31), which ends with a cleavage site located between an alanine and an asparagine residues.
[0200]To confirm the presence by PCR amplification of BVH-MC2 (SEQ ID NO: 1) gene, the following 4 distinct M. catarrhalis strains were used: M. catarrhalis ETSU C-2, ETSU T-25, and ETSU 658 clinical isolates were provided by the East Tennessee State University; M. catarrhalis strain M-12 was provided by the centre de recherche en infectiologie du centre hospitalier de l'universite Laval. The E. coli XL1-Blue MRF' was used in these experiments as negative control. BVH-MC2 (SEQ ID NO: 1) gene was amplified by PCR (DNA Thermal Cycler GeneAmp PCR system 2400 Perkin Elmer, San Jose, Calif.) from genomic DNA from the 4 M. catarrhalis strains, and the control E. coli strain using the oligonucleotides primers DMAR544 and DMAR545 (Table 1). PCR was performed with 30 cycles of 30 sec at 94° C., 30 sec at 51° C. and 1 min 20 sec at 72° C. and a final elongation period of 7 min at 72° C. The PCR products were size fractionated in 1% agarose gels and were visualized by ethidium bromide staining. The results of these PCR amplifications are presented in Table 2. The analysis of the amplification products revealed that BVH-MC2 (SEQ ID NO: 1) gene was present in the genome of all of the 4 M. catarrhalis strains tested. No such product was detected when the control E. coli DNA was submitted to identical PCR amplifications with these oligonucleotide primers.
[0201]Sequencing of additional BVH-MC2 genes from other strains confirmed the high level of molecular conservation of this gene among M. catarrhalis strains. The respective coding region of M. catarrhalis BVH-MC2 gene from strains ETSU 658 (SEQ ID NO: 3), ETSU T-25 (SEQ ID NO: 5), and M-12 (SEQ ID NO: 7) were amplified by PCR using the oligonucleotide primers DMAR544 and DMAR545 as described above. PCR products were purified from agarose gel using a QIA® quick gel extraction kit from QIA®gen following the manufacturer's instructions (Chatsworth, Calif.) and the DNA insert were sequenced (Taq Dye Deoxy Terminator Cycle Sequencing kit, ABI, Foster City, Calif.). The total sequence could be obtained in the same manner as in Example 1. The predicted amino acid sequences from strains ETSU C-2 (SEQ ID NO: 2), ETSU 658 (SEQ ID NO: 4), ETSU T-25 (SEQ ID NO:6), and M-12 (SEQ ID NO: 8) were respectively presented in the following FIGS. 2, 4, 6, and 8. The FIGS. 15 and 16 respectively depict the consensus nucleotide and predicted amino acid sequences established for M. catarrhalis BVH-MC2. Pairwise comparison of the BVH-MC2 predicted polypeptide sequences revealed 100% identity. This latter result clearly demonstrates the high level of molecular conservation of BVH-MC2 polypeptides among M. catarrhalis isolates.
TABLE-US-00002 TABLE 2 Identification of M. catarrhalis genes by PCR amplification Strain Identification by PCR amplification of Identification BVH-MC2 BVH-MC3 BVH-MC4 BVH-MC5 ETSU C-2 + + + + ETSU 658 + + + + ETSU T-25 + + + + M-12 + + + + E. coli - - - -
EXAMPLE 2
[0202]This example illustrates the cloning and molecular characteristics of BVH-MC3 gene and corresponding polypeptide.
[0203]The coding region of M. catarrhalis BVH-MC3 (SEQ ID NO: 9) gene was amplified by PCR (DNA Thermal Cycler GeneAmp® PCR system 2400 Perkin Elmer, San Jose, Calif.) from genomic DNA of M. catarrhalis strain ETSU C-2 using the following oligos that contained base extensions for the addition of restriction sites NdeI (CATATG) and XhoI (CTCGAG): DMAR592 and DMAR593, which are presented in Table 1. The methods used for cloning BVH-MC3 into an expression vector and sequencing are similar to the methods described in Example 1.
[0204]It was determined that the open reading frame (ORF) which codes for BVH-MC3 contains 1656-bp and encodes a 551 amino acid residues polypeptide with a predicted pI of 4.68 and a predicted molecular mass of 58910.13 Da. Analysis of the predicted amino acid residues sequence (SEQ ID NO: 10) using the Spscan software (Wisconsin Sequence Analysis Package; Genetics Computer Group) suggested the existence of a 46 amino acid residues signal peptide (MSLINKLNER ITPHVLTSIKNQDGDNADKSNLLTAFYTIFAGRLSN) (SEQ ID NO:32), which ends with a cleavage site located between an asparagine and a glutamic acid residues.
[0205]The BVH-MC3 gene was shown to be present after PCR amplification using the oligonucleotide primers DMAR592 and DMAR593 in the 4 M. catarrhalis strains tested (Table 2). The methods used for PCR amplification of the BVH-MC3 gene were similar to the methods presented in Example 1. No such product was detected when the control E. coli DNA was submitted to identical PCR amplification with these oligonucleotide primers.
EXAMPLE 3
[0206]This example illustrates the cloning and molecular characteristics of BVH-MC4 gene and corresponding polypeptide.
[0207]The coding region of M. catarrhalis BVH-MC4 (SEQ ID NO: 11) gene was amplified by PCR (DNA Thermal Cycler GeneAmp PCR system 2400 Perkin Elmer, San Jose, Calif.) from genomic DNA of M. catarrhalis strain ETSU C-2 using the following oligos that contained base extensions for the addition of restriction sites NdeI (CATATG) and XhoI (CTCGAG): RIOS71 and RIOS72, which are presented in Table 1. The methods used for cloning BVH-MC4 into an expression vector and sequencing are similar to the methods described in Example 1.
[0208]It was determined that the open reading frame (ORF) which codes for BVH-MC4 contains 1251-bp and encodes a 416 amino acid residues polypeptide with a predicted pI of 4.84 and a predicted molecular mass of 46125.11 Da. Analysis of the predicted amino acid residues sequence (SEQ ID NO: 12) using the Spscan software (Wisconsin Sequence Analysis Package; Genetics Computer Group) suggested the existence of a 42 amino acid residues signal peptide (MDTKHIQQNWLLPDGVADVLFTDAQKQESLRDALLFVLTAHG) (SEQ ID NO:33), which ends with a cleavage site located between a glycine and a tyrosine residues.
[0209]The BVH-MC4 gene was shown to be present after PCR amplification using the oligonucleotide primers RIOS71 and RIOS72 in the 4 M. catarrhalis strains tested (Table 2). The methods used for PCR amplification of the BVH-MC4 gene were similar to the methods presented in Example 1. No such product was detected when the control E. coli DNA was submitted to identical PCR amplification with these oligonucleotide primers.
EXAMPLE 4
[0210]This example illustrates the cloning and molecular characteristics of BVH-MC5 gene and corresponding polypeptide.
[0211]The coding region of M. catarrhalis BVH-MC5 (SEQ ID NO: 13) gene was amplified by PCR (DNA Thermal Cycler GeneAmp PCR system 2400 Perkin Elmer, San Jose, Calif.) from genomic DNA of M. catarrhalis strain ETSU C-2 using the following oligos that contained base extensions for the addition of restriction sites NdeI (CATATG) and XhoI (CTCGAG): RIOS59 and RIOS60, which are presented in Table 1. The methods used for cloning BVH-MC5 into an expression vector and sequencing are similar to the methods described in Example 1.
[0212]It was determined that the open reading frame (ORF) which codes for BVH-MC5 contains 639-bp and encodes a 212 amino acid residues polypeptide with a predicted pI of 7.45 and a predicted molecular mass of 24020.08 Da. Analysis of the predicted amino acid residues sequence (SEQ ID NO: 14) using the Spscan software (Wisconsin Sequence Analysis Package; Genetics Computer Group) suggested the existence of a 60 amino acid residues signal peptide (MNNFVYQLQSFWYELNQVNRHTIAQSPKYIQLTVLGLIVMIIGIFGWLLAIL PTIQKLNA) (SEQ ID NO:34), which ends with a cleavage site located between two alanine residues.
[0213]The BVH-MC5 gene was shown to be present after PCR amplification using the oligonucleotide primers RIOS59 and RIOS60 in the 4 M. catarrhalis strains tested (Table 2). The methods used for PCR amplification of the BVH-MC5 gene were similar to the methods presented in Example 1. No such product was detected when the control E. coli DNA was submitted to identical PCR amplification with these oligonucleotide primers.
EXAMPLE 5
[0214]This example illustrates the cloning of M. catarrhalis genes in CMV plasmid pCMV-GH.
[0215]The DNA coding regions of a M. catarrhalis polypeptides were inserted in phase downstream of a human growth hormone (hGH) gene which was under the transcriptional control of the cytomegalovirus (CMV) promoter in the plasmid vector pCMV-GH (Tang et al., Nature, 1992, 356: 152). The CMV promoter is non-functional plasmid in E. coli cells but active upon administration of the plasmid in eukaryotic cells. The vector also incorporated the ampicillin resistance gene.
[0216]The coding regions of BVH-MC2 (SEQ ID NO: 1), BVH-MC3 (SEQ ID NO: 9), BVH-MC4 (SEQ ID NO: 11), and BVH-MC5 (SEQ ID NO: 13) genes without their leader peptide regions were amplified by PCR (DNA Thermal Cycler GeneAmp® PCR system 2400 Perkin Elmer, San Jose, Calif.) from genomic DNA of M. catarrhalis strain ETSU C-2 using oligonucleotide primers that contained base extensions for the addition of restriction sites BamHI (GGATCC), BglII (AGATCT), SalI (GTCGAC), or HindIII (AAGCTT) which are described in Table 1. The PCR products were purified from agarose gel using a QIA® quick gel extraction kit from QIA®gen (Chatsworth, Calif.), digested with restriction enzymes (AMERSHAM Pharmacia Biotech, Inc, Baie d'Urfe, Canada). The pCMV-GH vector (Laboratory of Dr. Stephen A. Johnston, Department of Biochemistry, The University of Texas, Dallas, Tex.) was digested with BamHI, BglII, SalI, or HindIII and purified from agarose gel using the QIA® quick gel extraction kit from QIA®gen (Chatsworth, Calif.). The digested DNA fragments were ligated to the digested pCMV-GH vector to create the hGH-BVH-MC2, hGH-BVH-MC3, hGH-BVH-MC4, and hGH-BVH-MC5 fusion polypeptides under the control of the CMV promoter. The ligated products were transformed into E. coli strain DH5α [φ80dlacZΔM15 Δ(lacZYA-argF)U169 endA1 recA1 hsdR17(rK-mK+) deoR thi-1 supE44λ-gyrA96 relA1] (Gibco BRL, Gaithersburg, Md.) according to the method of Simanis (Hanahan, D. DNA Cloning, 1985, D. M. Glover (ed.), pp. 109-135). The recombinant pCMV plasmids were purified using a QIA®gen kit (Chatsworth, Calif.) and the nucleotides sequence of the DNA inserts were verified by DNA sequencing.
EXAMPLE 6
[0217]This example illustrates the use of DNA to elicit an immune response to M. catarrhalis polypeptide antigens.
[0218]A group of 8 female BALB/c mice (Charles River, St-Constant, Quebec, Canada) are immunized by intramuscular injection of 100 μl three times at two- or three-week intervals with 50 μg of recombinant pCMV-GH encoding BVH-MC2 (SEQ ID NO: 1), BVH-MC3 (SEQ ID NO: 9), BVH-MC4 (SEQ ID NO: 11), and BVH-MC5 (SEQ ID NO: 13) genes in presence of 50 μg of granulocyte-macrophage colony-stimulating factor (GM-CSF)-expressing plasmid pCMV-GH-GM-CSF (Laboratory of Dr. Stephen A. Johnston, Department of Biochemistry, The University of Texas, Dallas, Tex.). As control, a group of mice are injected with 50 μg of pCMV-GH in the presence of 50 μg of pCMV-GH-GM-CSF. Blood samples are collected from the orbital sinus prior to each immunization and seven days following the third injection and serum antibody responses are determined by ELISA using the corresponding His-Tag labeled M. catarrhalis recombinant polypeptides as coating antigen. The production and purification of these His-tagged labeled M. catarrhalis recombinant polypeptides are presented in Example 7.
EXAMPLE 7
[0219]This example illustrates the production and purification of M. catarrhalis recombinant polypeptides.
[0220]The recombinant pET21b(+) plasmid with BVH-MC2 (SEQ ID NO: 1), BVH-MC3 (SEQ ID NO: 9), BVH-MC4 (SEQ ID NO: 11), and BVH-MC5 (SEQ ID NO: 13) genes were used to transform by electroporation (Gene Pulser® II apparatus, BIO-RAD Labs, Mississauga, Canada) E. coli strain AD494 (DE3) [Δara-leu7697 ΔlacX74 ΔphoA PvuII phoR ΔmalF3 F'[lac.sup.+(lac.sup.q) pro] trxB::Kan (DE3)] (NOVAGEN, Madison, Wis.). In this strain of E. coli, the T7 promoter controlling expression of the recombinant polypeptide is specifically recognized by the T7 RNA polymerase (present on the λDE3 prophage) whose gene is under the control of the lac promoter which is inducible by isopropyl-β-d-thio-galactopyranoside (IPTG). The transformant AD494(DE3)/rpET21b(+) was grown at 37° C. with agitation at 250 rpm in LB broth (peptone 10 g/L, yeast extract 5 g/L, NaCl 10 g/L) containing 100 μg of carbenicillin (SIGMA-ALDRICH Canada Ltd., Oakville, Canada) per ml until the A600 reached a value of 0.5. In order to induce the production of His-tagged M. catarrhalis recombinant polypeptides, the cells were incubated for 3 additional hours in the presence of IPTG at a final concentration of 1 mM. Induced cells from a 500 ml culture were pelleted by centrifugation and frozen at -70° C.
[0221]The purification of the recombinant polypeptides from the soluble cytoplasmic fraction of IPTG-induced AD494(DE3)/rpET21b(+) was done by affinity chromatography based on the properties of the His•Tag sequence (6 consecutive histidine residues) to bind to divalent cations (Ni2+) immobilized on the His•Bind metal chelation resin. Briefly, the pelleted cells obtained from a 500 mL culture induced with IPTG was resuspended in lysis buffer (20 mM Tris, 500 mM NaCl, 10 mM imidazole, pH 7.9) containing 1 mM PMSF, sonicated and centrifuged at 12,000×g for 20 min to remove debris. The supernatant was deposited on a Ni-NTA agarose column (QIA®gen, Mississauga, Ontario, Canada). The His-tagged labeled M. catarrhalis recombinant polypeptides were eluted with 250 mM imidazole-500 mM NaCl-20 mM Tris pH 7.9. The removal of the salt and imidazole from the sample was done by dialysis against PBS at 4° C. The quantities of recombinant polypeptides obtained from the soluble fraction of E. coli were estimated by MicroBCAR (Pierce, Rockford, Ill.).
EXAMPLE 8
[0222]This example illustrates the reactivity of the His-tagged M. catarrhalis recombinant polypeptides with human palatine tonsils and sera collected from mice after immunization with M. catarrhalis antigenic preparations.
[0223]As shown in Table 3, BVH-MC2, BVH-MC3, and BVH-MC4 His-tagged recombinant polypeptides were recognized in immunoblots by the antibodies present in the human palatine tonsils. It indicates that humans, which are normally in contact with M. catarrhalis do develop antibodies that are specific to these polypeptides. These particular human antibodies might be implicated in the protection against M. catarrhalis infection. In addition, immunoblots also revealed that sera collected from mice immunized with M. catarrhalis antigenic preparation enriched membrane polypeptides which induced significant lung clearance in a mouse model also developed antibodies that recognized BVH-MC2 His-tagged recombinant polypeptides. These results indicate that this polypeptide was present in M. catarrhalis antigenic preparation that protected mice against infection and that it induced antibodies that reacted with the corresponding BVH-MC2 His-tagged recombinant polypeptide.
TABLE-US-00003 TABLE 3 Reactivity in immunoblots of human palatine tonsils and sera collected from mice after immunization with M. catarrhalis antigenic preparations with M. catarrhalis His-tagged fusion recombinant polypeptides Reactivity in immunoblots with Purified recombinant Apparent molecular Human palatine Mouse polypeptide I.D.1 weight (kDa)2 tonsils3 sera4 BVH-MC2 50 + - BVH-MC3 70 + + BVH-MC4 40 + - BVH-MC5 20 - - 1His-tagged recombinant polypeptides produced and purified as described in Example 7 were used to perform the immunoblots. 2Molecular weight of the His-tagged recombinant polypeptide was estimated after SDS-PAGE. 3Human palatine tonsils were undiluted to perform the immunoblots. 4Mouse sera collected after immunization with M. catarrhalis antigenic preparations enriched membrane polypeptides were pooled and diluted 1/500 to perform the immunoblots. These mice were protected against a M. catarrhalis challenge
EXAMPLE 9
[0224]This example illustrates the accessibility to antibodies of the BVH-MC2, BVH-MC3, BVH-MC4, and BVH-MC5 polypeptides at the surface of M. catarrhalis strain.
[0225]Bacteria were grown in Brain Heart Infusion (BHI) broth containing 0.25% dextrose at 37° C. in a 8% CO2 atmosphere to give an OD490nm of 0.650 (˜108 CFU/ml). Dilutions of anti-BVH-MC2, anti-BVH-MC3, anti-BVH-MC4, anti-BVH-MC5, or control sera were then added and allowed to bind to the cells, which were incubated for 2 h at 4° C. with rotation. Samples were washed 4 times in blocking buffer [phosphate-buffered saline (PBS) containing 2% bovine serum albumin (BSA)], and then 1 ml of goat fluorescein (FITC)-conjugated anti-mouse IgG Fc (gamma) fragment specific diluted in blocking buffer was added. After an additional incubation of 60 min at room temperature with rotation in the dark, samples were washed 4 times in blocking buffer and fixed with 0.25% formaldehyde in PBS buffer for 18 h at 4° C. Cells were washed 2 times in PBS buffer and resuspended in 0.5 ml of PBS buffer. Cells were kept in the dark at 4° C. until analyzed by flow cytometry (Epics® XL; Beckman Coulter, Inc.). Flow cytometric analysis revealed that BVH-MC2-, BVH-MC3-, BVH-MC4-, and BVH-MC5-specific antibodies efficiently recognized their corresponding surface exposed epitopes on the homologous (ETSU C-2) M. catarrhalis strain tested (Table 4). It was determined that more than 70% of the 10,000 Moraxella cells analyzed were labeled with the antibodies present in the specific sera. These observations clearly demonstrate that these polypeptides are accessible at the surface where they can be easily recognized by antibodies. Anti-M. catarrhalis antibodies were shown to play an important role in the protection against M. catarrhalis infection.
TABLE-US-00004 TABLE 4 Evaluation of the attachment of BVH-MC2-, BVH-MC3-, BVH-MC4-, and BVH-MC5-specific antibodies at the surface of intact cells of M. catarrhalis strain ETSU-C2 Fluorescence % of labeled Serum Identification Index2 cells3 Pool of BVH-MC2-specific sera1 3.6 72.8 Pool of BVH-MC3-specific sera 7.5 82.8 Pool of BVH-MC4-specific sera 10.9 92.4 Pool of BVH-MC5-specific sera 6.7 77.4 Pool of negative control sera4 1 7.4 Positive control serum5 43.8 98.7 1The mice were injected subcutaneously five times at two-week intervals with 20 μg of purified recombinant polypeptides mixed with 10 μg of QuilA ® adjuvant (Cedarlane Laboratories, Hornby, Canada). The sera were diluted 1/50. 2The fluorescence index was calculated as the median fluorescence value obtained after labeling the cells with an immune serum divided by the fluorescence value obtained for a control mouse serum. A fluorescence value of 1 indicated that there was no binding of antibodies at the surface of intact Moraxella cells. 3% of labeled cells out of the 10,000 cells analyzed. 4Sera collected from unimmunized or sham-immunized mice were pooled, diluted 1/50, and used as negative controls for this assay. 5Serum obtained from a mouse immunized with 20 μg of purified outer membrane polypeptides was diluted 1/1000 and was used as a positive control for the assay.
EXAMPLE 10
[0226]This example illustrates the bactericidal activities of anti-BVH-MC2 mouse sera.
[0227]Bacteria were plated on chocolate agar plate and incubated at 37° C. in a 8% CO2 atmosphere for 18 h. Bacterial cells were then resuspended in bacteriolysis buffer [10% Hanks' Balanced Salt Solution (HBSS) and 1% hydrolyzed casein, pH 7.3] to an OD490nm of 0.25 and diluted to 8×104 CFU/ml. The bactericidal assay was performed by mixing 25 μl of the bacterial suspension with 50 μl of diluted heat-inactivated test serum and 15 μl of HBSS and incubating for 15 min at 37° C., 8% CO2 with agitation (200 rpm). The rabbit complement-containing serum was then added to a final concentration of 10%, and the mixture was incubated for an additional 60 min at 37° C., 8% CO2 with agitation (200 rpm). At the end of the incubation period, the number of viable bacteria was determined by plating 10 μl of the assay mixture on chocolate agar plate. The plates were incubated at 37° C. in an 8% CO2 atmosphere for 18-24 h. The control consisted of bacteria incubated with heat-inactivated sera collected from mice before immunization and rabbit complement.
[0228]The % of lysis was determined by the following mathematical formula:
100 - [ A B × 100 ] ##EQU00001##
[0229]A=CFU obtained when the bacteria were incubated with immune sera
[0230]B=CFU obtained with pre-bleed sera
[0231]The M. catarrhalis strain ETSU 658 was used to evaluate the bactericidal activity of the sera. Percentage of lysis of 71.3 was determined for mouse sera collected after immunization with purified recombinant BVH-MC2 polypeptide (SEQ ID NO: 2) (Table 5).
TABLE-US-00005 TABLE 5 Evaluation of the bactericidal activities of anti-BVH-MC2 mouse sera Identification Bactericidal titer % of lysis Pool of BVH-MC2-specific 1/35 71.3 sera1 Positive control serum2 1/35 92.7 1The mice were injected subcutaneously five times at two-week intervals with 20 μg of purified recombinant polypeptides mixed with 10 μg of QuilA ® adjuvant (Cedarlane Laboratories, Hornby, Canada). 2Serum obtained from a mouse immunized with 20 μg of purified outer membrane polypeptides was diluted 1/35 and was used as a positive control for the assay.
EXAMPLE 11
[0232]This example illustrates the bactericidal activities of anti-BVH-MC3 mouse sera.
[0233]Bacteria were plated on chocolate agar plates and incubated at 37° C. in a 8% CO2 atmosphere for 18 h. Bacterial cells were then resuspended in bacteriolysis buffer [10% Hanks' Balanced Salt Solution (HBSS) and 1% hydrolyzed casein, pH 7.3] to an OD490nm of 0.25 and diluted to 8×104 CFU/ml. The bactericidal assay was performed by mixing 25 μl of the bacterial suspension with 50 μl of diluted heat-inactivated test serum and 15 μl of HBSS and incubating for 15 min at 37° C., 8% CO2 with agitation (200 rpm). The rabbit complement-containing serum was then added to a final concentration of 10%, and the mixture was incubated for an additional 60 min at 37° C., 8% CO2 with agitation (200 rpm). At the end of the incubation period, the number of viable bacteria was determined by plating 10 μl of the assay mixture on chocolate agar plate. The plates were incubated at 37° C. in an 8% CO2 atmosphere for 18-24 h. The control consisted of bacteria incubated with heat-inactivated sera collected from mice before immunization and rabbit complement. The M. catarrhalis strain ETSU 658 was used to evaluate the bactericidal activity of the sera. The % of lysis was determined by the following mathematical formula:
100 - [ A B × 100 ] ##EQU00002##
[0234]A=CFU obtained when the bacteria were incubated with immune sera
[0235]B=CFU obtained with pre-bleed sera
[0236]Bactericidal antibodies were found to be present in the sera collected from the 7 mice that were immunized with the purified recombinant BVH-MC3 polypeptide (Table 6). No bactericidal activity was recorded in the sera collected from control mice (data not shown).
TABLE-US-00006 TABLE 6 Evaluation of the bactericidal activity of anti-BVH-MC3 mouse sera Serum identification1 % of lysis S12 33.3 S2 67.9 S3 89.6 S4 66.2 S5 78.0 S6 90.1 S7 37.1 Positive control serum2 77.3 1The mice S1 to S7 were injected subcutaneously five times at two-week intervals with 20 μg of purified recombinant polypeptide mixed with 10 μg of QuilA ® adjuvant (Cedarlane Laboratories, Hornby, Canada). 2Each mouse serum collected from BVH-MC3 immunized mouse were diluted 1/50. 3Serum obtained from a mouse immunized with 20 μg of purified outer membrane polypeptides was diluted 1/50 and was used as a positive control for the assay.
EXAMPLE 12
[0237]This example illustrates the protection of mice against M. catarrhalis infection induced by immunization with purified recombinant BVH-MC3 polypeptide.
[0238]Groups of female BALB/c mice (Charles River) were immunized subcutaneously five times at two-week intervals with 20 μg of affinity purified His-tagged M. catarrhalis recombinant BVH-MC3 polypeptide in presence of 10% of QuilA® adjuvant (Cedarlane Laboratories Ltd, Hornby, Canada) or, as control, with QuilA® adjuvant alone in PBS. Blood samples were collected from the orbital sinus on day 0, 14, 28, 42, and 56 prior to each immunization and 14 days (day 70) following the fifth injection. One week later the mice were challenged intrapulmonary with approximately 1×106 CFU of the M. catarrhalis strain ETSU 658. Samples of the M. catarrhalis challenge inoculum were plated on chocolate agar plates to determine the CFU and to verify the challenge dose. Mice were killed by an intraperitoneal injection of sodium pentobarbital (Euthanyl®) 5 h after infection. The intact lungs were excised and homogenised in a tissue homogeniser. The lung homogenate were assessed for bacterial clearance by plating the serial dilutions for CFU determination. The % of clearance was determined by the following mathematical formula:
100 - [ A B × 100 ] ##EQU00003##
[0239]A=CFU obtained with the mice immunized with the BVH-MC3 polypeptide
[0240]B=CFU obtained in the control mice
[0241]As shown in Table 7, a reduction of 54% in the number of living bacteria were determined for mice immunized with BVH-MC3 polypeptide comparatively to mice in the control group. Thus, immunization with recombinant BVH-MC3 polypeptide promoted rapid clearance of a heterologous strain of M. catarrhalis from the lungs of the mice.
TABLE-US-00007 TABLE 7 Pulmonary clearance of Moraxella catarrhalis by mice immunized with purified recombinant BVH-MC3 polypeptide Bacterial recovery from Bacterial recovery from Bacterial control group (CFU/ml of BVH-MC3 group (CFU/ml of clearance lung homogenate)a lung homogenate)b (%)c 2.4 × 105 ± 1.9 × 105 1.1 × 105 ± 7.9 × 104 54 aMeans ± standard deviations for six mice. bMeans ± standard deviations for seven mice. cMice were challenged intrapulmonary with 1 × 106 CFU of bacteria, and viable bacteria were recovered from lung 5 h after challenge. The % of clearance was calculated with the mathematical formula described above.
Sequence CWU
1
3611467DNAMoraxella catarrhalis 1atggacactg acatgaaaca tttaacaaaa
catcgcctat cagctgccat cattggcgtt 60ttattattca ttagcccatc agtgcaagca
aatacgacac accatcacac gctaaccagt 120agcgagctta aacttgctga tgatagtatt
attgatagta tcaatcaatt gggtgagctg 180accgtcaata ttccaaatac acaatatttt
caaaccaaca acggtgtgag cgttgctttt 240acgccattac atgagctgcc tattgtcgat
atcagcttgt attttaatgc agggtcagcg 300tatgaccatc aggttggcaa atcaggcacg
gctaacatgg ttgcaaccat gctcacccaa 360ggaactgaca gcctttctga agatgagttt
gttgctgcca aagagcgtct tggcattgat 420tttaccagta cagcaaataa ggataactta
actttatcat taagaagctt gtctgatcaa 480tcattattaa atcaagccgc cgatttaatg
gtcgatgctg tcactcaacc tgcttttgat 540gataagactc tacaacgcaa caaaaatcag
ctcatcacca gtttaaaaca aaaaaagcaa 600aacccttatc atgtagcttc tgttgcttat
catcaagccg tatatgaaaa tcatccttat 660gcacacgcaa ccacaggcga tgaagatagt
attgccaaaa ttgatcgtga tgagctgctt 720aatttttggc atacttttat taatgcaaat
aatgcgacac tggtgattac aggtgatatg 780accgccgagc aagccaaatc acttgccaac
catctgaccg ccaaattacc gacaggcaag 840tcgtataaaa atacgctgga tttgacaaaa
ccagttaagg ctcgtcatat ccatattcct 900cacaacagta gtcaaaccca aatcatcatc
ggtcatccca ccagtaaagt acgcacggac 960aaagcaggtc gtcaagagtt cagcgatttt
tcattaggta atgaaatttt ggcaggtggt 1020gattttaatg ccagattgat gaaaaccatt
cgagagcaaa aaggctacac ttatggcatt 1080tatggcggta tggaacgcct cagagcaggt
ggtaattatg tggttgaatt ttcaaccgat 1140ggcgataaag cagccgatgc cattttagag
acgctacaca tcattaatga gtcgctgaat 1200gaaggcataa cccaagaaga gcttgagttg
gtgcgtttgg gcaataaaaa tggttttgcc 1260aatatttttt caagcaatgc cagtattcat
cgtgtcattg gtgctttatt tgttgccgat 1320tatccaaaag atcatcttaa ccatacgctc
aatcgcttgg ataatgccac gataaatagt 1380gttaataccg cactgaactt gcgtatcaag
cctgatgaat ttatcatcat caccgtgggt 1440aaaactaagc caaatttgga caaataa
14672488PRTMoraxella catarrhalis 2Met
Asp Thr Asp Met Lys His Leu Thr Lys His Arg Leu Ser Ala Ala1
5 10 15Ile Ile Gly Val Leu Leu Phe Ile
Ser Pro Ser Val Gln Ala Asn Thr20 25
30Thr His His His Thr Leu Thr Ser Ser Glu Leu Lys Leu Ala Asp Asp35
40 45Ser Ile Ile Asp Ser Ile Asn Gln Leu Gly
Glu Leu Thr Val Asn Ile50 55 60Pro Asn
Thr Gln Tyr Phe Gln Thr Asn Asn Gly Val Ser Val Ala Phe65
70 75 80Thr Pro Leu His Glu Leu Pro
Ile Val Asp Ile Ser Leu Tyr Phe Asn85 90
95Ala Gly Ser Ala Tyr Asp His Gln Val Gly Lys Ser Gly Thr Ala Asn100
105 110Met Val Ala Thr Met Leu Thr Gln Gly
Thr Asp Ser Leu Ser Glu Asp115 120 125Glu
Phe Val Ala Ala Lys Glu Arg Leu Gly Ile Asp Phe Thr Ser Thr130
135 140Ala Asn Lys Asp Asn Leu Thr Leu Ser Leu Arg
Ser Leu Ser Asp Gln145 150 155
160Ser Leu Leu Asn Gln Ala Ala Asp Leu Met Val Asp Ala Val Thr
Gln165 170 175Pro Ala Phe Asp Asp Lys Thr
Leu Gln Arg Asn Lys Asn Gln Leu Ile180 185
190Thr Ser Leu Lys Gln Lys Lys Gln Asn Pro Tyr His Val Ala Ser Val195
200 205Ala Tyr His Gln Ala Val Tyr Glu Asn
His Pro Tyr Ala His Ala Thr210 215 220Thr
Gly Asp Glu Asp Ser Ile Ala Lys Ile Asp Arg Asp Glu Leu Leu225
230 235 240Asn Phe Trp His Thr Phe
Ile Asn Ala Asn Asn Ala Thr Leu Val Ile245 250
255Thr Gly Asp Met Thr Ala Glu Gln Ala Lys Ser Leu Ala Asn His
Leu260 265 270Thr Ala Lys Leu Pro Thr Gly
Lys Ser Tyr Lys Asn Thr Leu Asp Leu275 280
285Thr Lys Pro Val Lys Ala Arg His Ile His Ile Pro His Asn Ser Ser290
295 300Gln Thr Gln Ile Ile Ile Gly His Pro
Thr Ser Lys Val Arg Thr Asp305 310 315
320Lys Ala Gly Arg Gln Glu Phe Ser Asp Phe Ser Leu Gly Asn
Glu Ile325 330 335Leu Ala Gly Gly Asp Phe
Asn Ala Arg Leu Met Lys Thr Ile Arg Glu340 345
350Gln Lys Gly Tyr Thr Tyr Gly Ile Tyr Gly Gly Met Glu Arg Leu
Arg355 360 365Ala Gly Gly Asn Tyr Val Val
Glu Phe Ser Thr Asp Gly Asp Lys Ala370 375
380Ala Asp Ala Ile Leu Glu Thr Leu His Ile Ile Asn Glu Ser Leu Asn385
390 395 400Glu Gly Ile Thr
Gln Glu Glu Leu Glu Leu Val Arg Leu Gly Asn Lys405 410
415Asn Gly Phe Ala Asn Ile Phe Ser Ser Asn Ala Ser Ile His
Arg Val420 425 430Ile Gly Ala Leu Phe Val
Ala Asp Tyr Pro Lys Asp His Leu Asn His435 440
445Thr Leu Asn Arg Leu Asp Asn Ala Thr Ile Asn Ser Val Asn Thr
Ala450 455 460Leu Asn Leu Arg Ile Lys Pro
Asp Glu Phe Ile Ile Ile Thr Val Gly465 470
475 480Lys Thr Lys Pro Asn Leu Asp
Lys48531299DNAMoraxella catarrhalis 3gagcttaaac ttgctgatga tagtattatt
gatagtatca atcaattggg tgagctgacc 60gtcaatattc caaatacaca atattttcaa
accaacaacg gtgtgagcgt tgcttttacg 120ccattacatg agctgcctat tgtcgatatc
agcttgtatt ttaatgcagg gtcagcgtat 180gaccatcagg ttggcaaatc aggcacggct
aacatggttg caaccatgct cacccaagga 240actgacagcc tttctgaaga tgagtttgtt
gctgccaaag agcgtcttgg cattgatttt 300accagtacag caaataagga taacttaact
ttatcattaa gaagcttgtc tgatcaatca 360ttattaaatc aagccgccga tttaatggtc
gatgctgtca ctcaacctgc ttttgatgat 420aagactctac aacgcaacaa aaatcagctc
atcaccagtt taaaacaaaa aaagcaaaac 480ccttatcatg tagcttctgt tgcttatcat
caagccgtat atgaaaatca tccttatgca 540cacgcaacca caggcgatga agatagtatt
gccaaaattg atcgtgatga gctgcttaat 600ttttggcata cttttattaa tgcaaataat
gcgacactgg tgattacagg tgatatgacc 660gccgagcaag ccaaatcact tgccaaccat
ctgaccgcca aattaccgac aggcaagtcg 720tataaaaata cgctggattt gacaaaacca
gttaaggctc gccatatcca tattcctcac 780aacagtagtc aaacccaaat catcatcggt
caccccacca gtaaagtacg cacggacaaa 840gcaggtcgtc aagagttcag cgatttttca
ttaggtaatg aaattttggc aggtggtgat 900tttaatgcca gattgatgaa aaccattcga
gagcaaaaag gctacactta tggcatttat 960ggcggtatgg aacgcctcag agcaggtggt
aattatgtgg ttgaattttc aaccgatggc 1020gataaagcag ccgatgccat tttagagacg
ctacacatca ttaatgagtc gctgaatgaa 1080ggcataaccc aagaagagct tgaattggtg
cgtttgggta ataaaaatgg ttttgccaat 1140attttttcaa gcaatgccag tattcatcgt
gtcattggtg ctttatttgt tgccgattat 1200ccaaaagatc atcttaacca tacgctcaat
cgcttggata atgccacgat aaatagtgtt 1260aataccgcac tgaacttgcg tatcaagcct
gatgaattt 12994433PRTMoraxella catarrhalis 4Glu
Leu Lys Leu Ala Asp Asp Ser Ile Ile Asp Ser Ile Asn Gln Leu1
5 10 15Gly Glu Leu Thr Val Asn Ile Pro
Asn Thr Gln Tyr Phe Gln Thr Asn20 25
30Asn Gly Val Ser Val Ala Phe Thr Pro Leu His Glu Leu Pro Ile Val35
40 45Asp Ile Ser Leu Tyr Phe Asn Ala Gly Ser
Ala Tyr Asp His Gln Val50 55 60Gly Lys
Ser Gly Thr Ala Asn Met Val Ala Thr Met Leu Thr Gln Gly65
70 75 80Thr Asp Ser Leu Ser Glu Asp
Glu Phe Val Ala Ala Lys Glu Arg Leu85 90
95Gly Ile Asp Phe Thr Ser Thr Ala Asn Lys Asp Asn Leu Thr Leu Ser100
105 110Leu Arg Ser Leu Ser Asp Gln Ser Leu
Leu Asn Gln Ala Ala Asp Leu115 120 125Met
Val Asp Ala Val Thr Gln Pro Ala Phe Asp Asp Lys Thr Leu Gln130
135 140Arg Asn Lys Asn Gln Leu Ile Thr Ser Leu Lys
Gln Lys Lys Gln Asn145 150 155
160Pro Tyr His Val Ala Ser Val Ala Tyr His Gln Ala Val Tyr Glu
Asn165 170 175His Pro Tyr Ala His Ala Thr
Thr Gly Asp Glu Asp Ser Ile Ala Lys180 185
190Ile Asp Arg Asp Glu Leu Leu Asn Phe Trp His Thr Phe Ile Asn Ala195
200 205Asn Asn Ala Thr Leu Val Ile Thr Gly
Asp Met Thr Ala Glu Gln Ala210 215 220Lys
Ser Leu Ala Asn His Leu Thr Ala Lys Leu Pro Thr Gly Lys Ser225
230 235 240Tyr Lys Asn Thr Leu Asp
Leu Thr Lys Pro Val Lys Ala Arg His Ile245 250
255His Ile Pro His Asn Ser Ser Gln Thr Gln Ile Ile Ile Gly His
Pro260 265 270Thr Ser Lys Val Arg Thr Asp
Lys Ala Gly Arg Gln Glu Phe Ser Asp275 280
285Phe Ser Leu Gly Asn Glu Ile Leu Ala Gly Gly Asp Phe Asn Ala Arg290
295 300Leu Met Lys Thr Ile Arg Glu Gln Lys
Gly Tyr Thr Tyr Gly Ile Tyr305 310 315
320Gly Gly Met Glu Arg Leu Arg Ala Gly Gly Asn Tyr Val Val
Glu Phe325 330 335Ser Thr Asp Gly Asp Lys
Ala Ala Asp Ala Ile Leu Glu Thr Leu His340 345
350Ile Ile Asn Glu Ser Leu Asn Glu Gly Ile Thr Gln Glu Glu Leu
Glu355 360 365Leu Val Arg Leu Gly Asn Lys
Asn Gly Phe Ala Asn Ile Phe Ser Ser370 375
380Asn Ala Ser Ile His Arg Val Ile Gly Ala Leu Phe Val Ala Asp Tyr385
390 395 400Pro Lys Asp His
Leu Asn His Thr Leu Asn Arg Leu Asp Asn Ala Thr405 410
415Ile Asn Ser Val Asn Thr Ala Leu Asn Leu Arg Ile Lys Pro
Asp Glu420 425 430Phe51299DNAMoraxella
catarrhalis 5gagcttaaac ttgctgatga tagtattatt gatagtatca atcaattggg
tgagctgacc 60gtcaatattc caaatacaca atattttcaa accaacaacg gtgtgagcgt
tgcttttacg 120ccattacatg agctgcctat tgtcgatatc agcttgtatt ttaatgcagg
gtcagcgtat 180gaccatcagg ttggcaaatc aggcacggct aacatggttg caaccatgct
cacccaagga 240actgacagcc tttctgaaga tgagtttgtt gctgccaaag agcgtcttgg
cattgatttt 300accagtacag caaataagga taacttaact ttatcattaa gaagcttgtc
tgatcaatca 360ttattaaatc aagccgccga tttaatggtc gatgctgtca ctcaacctgc
ttttgatgat 420aagactctac aacgcaacaa aaatcagctc atcaccagtt taaaacaaaa
aaagcaaaac 480ccttatcatg tagcttctgt tgcttatcat caagccgtat atgaaaatca
tccttatgca 540cacgcaacca caggcgatga agatagtatt gccaaaattg atcgtgatga
gctgcttaat 600ttttggcata cttttattaa tgcaaataat gcgacactgg tgattacagg
tgatatgacc 660gccgagcaag ccaaatcact tgccaaccat ctgaccgcca aattaccgac
aggcaagtct 720tataaaaata cgctggattt gacaaaacca gttaaggctc gccatatcca
tattcctcac 780aacagtagtc aaacccaaat catcatcggt caccccacca gtaaagtacg
cacggacaaa 840gcaggtcgtc aagagttcag cgatttttca ttaggtaatg aaattttggc
aggtggtgat 900tttaatgcca gattgatgaa aaccattcga gagcaaaaag gctacactta
tggcatttat 960ggcggtatgg aacgcctcag agcaggtggt aattatgtgg ttgaattttc
aaccgatggc 1020gataaagcag ccgatgccat tttagagacg ctacacatca ttaatgagtc
gctgaatgaa 1080ggcataaccc aagaagagct tgagttggtg cgtttgggca ataaaaatgg
ttttgccaat 1140attttttcaa gcaatgccag tattcatcgt gtcattggtg ctttatttgt
tgccgattat 1200ccaaaagatc atcttaacca tacgctcaat cgcttggata atgccacgat
aaatagtgtt 1260aataccgcac tgaacttgcg tatcaagcct gatgaattt
12996433PRTMoraxella catarrhalis 6Glu Leu Lys Leu Ala Asp Asp
Ser Ile Ile Asp Ser Ile Asn Gln Leu1 5 10
15Gly Glu Leu Thr Val Asn Ile Pro Asn Thr Gln Tyr Phe Gln
Thr Asn20 25 30Asn Gly Val Ser Val Ala
Phe Thr Pro Leu His Glu Leu Pro Ile Val35 40
45Asp Ile Ser Leu Tyr Phe Asn Ala Gly Ser Ala Tyr Asp His Gln Val50
55 60Gly Lys Ser Gly Thr Ala Asn Met Val
Ala Thr Met Leu Thr Gln Gly65 70 75
80Thr Asp Ser Leu Ser Glu Asp Glu Phe Val Ala Ala Lys Glu
Arg Leu85 90 95Gly Ile Asp Phe Thr Ser
Thr Ala Asn Lys Asp Asn Leu Thr Leu Ser100 105
110Leu Arg Ser Leu Ser Asp Gln Ser Leu Leu Asn Gln Ala Ala Asp
Leu115 120 125Met Val Asp Ala Val Thr Gln
Pro Ala Phe Asp Asp Lys Thr Leu Gln130 135
140Arg Asn Lys Asn Gln Leu Ile Thr Ser Leu Lys Gln Lys Lys Gln Asn145
150 155 160Pro Tyr His Val
Ala Ser Val Ala Tyr His Gln Ala Val Tyr Glu Asn165 170
175His Pro Tyr Ala His Ala Thr Thr Gly Asp Glu Asp Ser Ile
Ala Lys180 185 190Ile Asp Arg Asp Glu Leu
Leu Asn Phe Trp His Thr Phe Ile Asn Ala195 200
205Asn Asn Ala Thr Leu Val Ile Thr Gly Asp Met Thr Ala Glu Gln
Ala210 215 220Lys Ser Leu Ala Asn His Leu
Thr Ala Lys Leu Pro Thr Gly Lys Ser225 230
235 240Tyr Lys Asn Thr Leu Asp Leu Thr Lys Pro Val Lys
Ala Arg His Ile245 250 255His Ile Pro His
Asn Ser Ser Gln Thr Gln Ile Ile Ile Gly His Pro260 265
270Thr Ser Lys Val Arg Thr Asp Lys Ala Gly Arg Gln Glu Phe
Ser Asp275 280 285Phe Ser Leu Gly Asn Glu
Ile Leu Ala Gly Gly Asp Phe Asn Ala Arg290 295
300Leu Met Lys Thr Ile Arg Glu Gln Lys Gly Tyr Thr Tyr Gly Ile
Tyr305 310 315 320Gly Gly
Met Glu Arg Leu Arg Ala Gly Gly Asn Tyr Val Val Glu Phe325
330 335Ser Thr Asp Gly Asp Lys Ala Ala Asp Ala Ile Leu
Glu Thr Leu His340 345 350Ile Ile Asn Glu
Ser Leu Asn Glu Gly Ile Thr Gln Glu Glu Leu Glu355 360
365Leu Val Arg Leu Gly Asn Lys Asn Gly Phe Ala Asn Ile Phe
Ser Ser370 375 380Asn Ala Ser Ile His Arg
Val Ile Gly Ala Leu Phe Val Ala Asp Tyr385 390
395 400Pro Lys Asp His Leu Asn His Thr Leu Asn Arg
Leu Asp Asn Ala Thr405 410 415Ile Asn Ser
Val Asn Thr Ala Leu Asn Leu Arg Ile Lys Pro Asp Glu420
425 430Phe71299DNAMoraxella catarrhalis 7gagcttaaac
ttgctgatga tagtattatt gatagtatca atcaattggg tgagctgacc 60gtcaatattc
caaatacaca atattttcaa accaacaacg gtgtgagcgt tgcttttacg 120ccattacatg
agctgcctat tgtcgatatc agcttgtatt ttaatgcagg gtcagcgtat 180gaccatcagg
ttggcaaatc aggcacggct aacatggttg caaccatgct cacccaagga 240actgacagcc
tttctgaaga tgagtttgtt gctgccaaag agcgtcttgg cattgatttt 300accagtacag
caaataagga taacttaact ttatcattaa gaagcttgtc tgatcaatca 360ttattaaatc
aagccgccga tttaatggtc gatgctgtca ctcaacctgc ttttgatgat 420aagactctac
aacgcaacaa aaatcagctc atcaccagtt taaaacaaaa aaagcaaaac 480ccttatcatg
tagcttctgt tgcttatcat caagccgtat atgaaaatca tccttatgca 540cacgcaacca
caggcgatga agatagtatt gccaaaattg atcgtgatga gctgcttaat 600ttttggcata
cttttattaa tgcaaataat gcgacactgg tgattacagg tgatatgacc 660gccgagcaag
ccaaatcact tgccaaccat ctgaccgcca aattaccgac aggcaagtcg 720tataaaaata
cgctggattt gacaaaacca gttaaggctc gccatatcca tattcctcac 780aacagtagtc
aaacccaaat catcatcggt caccccacca gtaaagtacg cacggacaaa 840gcaggtcgtc
aagagttcag cgatttttca ttaggtaatg aaattttggc aggtggtgat 900tttaatgcca
gattgatgaa aaccattcga gagcaaaaag gctacactta tggcatttat 960ggcggtatgg
aacgcctcag agcaggtggt aattatgtgg ttgaattttc aaccgatggc 1020gataaagcag
ccgatgccat tttagagacg ctacacatca ttaatgagtc gctgaatgaa 1080ggcataaccc
aagaagagct tgaattggtg cgtttgggta ataaaaatgg ttttgccaat 1140attttttcaa
gcaatgccag tattcatcgt gtcattggtg ctttatttgt tgccgattat 1200ccaaaagacc
atcttaacca tacgctcaat cgcttggata atgccacgat aaatagtgtt 1260aataccgcac
tgaacttgcg tatcaagcct gatgaattt
12998433PRTMoraxella catarrhalis 8Glu Leu Lys Leu Ala Asp Asp Ser Ile Ile
Asp Ser Ile Asn Gln Leu1 5 10
15Gly Glu Leu Thr Val Asn Ile Pro Asn Thr Gln Tyr Phe Gln Thr Asn20
25 30Asn Gly Val Ser Val Ala Phe Thr Pro
Leu His Glu Leu Pro Ile Val35 40 45Asp
Ile Ser Leu Tyr Phe Asn Ala Gly Ser Ala Tyr Asp His Gln Val50
55 60Gly Lys Ser Gly Thr Ala Asn Met Val Ala Thr
Met Leu Thr Gln Gly65 70 75
80Thr Asp Ser Leu Ser Glu Asp Glu Phe Val Ala Ala Lys Glu Arg Leu85
90 95Gly Ile Asp Phe Thr Ser Thr Ala Asn
Lys Asp Asn Leu Thr Leu Ser100 105 110Leu
Arg Ser Leu Ser Asp Gln Ser Leu Leu Asn Gln Ala Ala Asp Leu115
120 125Met Val Asp Ala Val Thr Gln Pro Ala Phe Asp
Asp Lys Thr Leu Gln130 135 140Arg Asn Lys
Asn Gln Leu Ile Thr Ser Leu Lys Gln Lys Lys Gln Asn145
150 155 160Pro Tyr His Val Ala Ser Val
Ala Tyr His Gln Ala Val Tyr Glu Asn165 170
175His Pro Tyr Ala His Ala Thr Thr Gly Asp Glu Asp Ser Ile Ala Lys180
185 190Ile Asp Arg Asp Glu Leu Leu Asn Phe
Trp His Thr Phe Ile Asn Ala195 200 205Asn
Asn Ala Thr Leu Val Ile Thr Gly Asp Met Thr Ala Glu Gln Ala210
215 220Lys Ser Leu Ala Asn His Leu Thr Ala Lys Leu
Pro Thr Gly Lys Ser225 230 235
240Tyr Lys Asn Thr Leu Asp Leu Thr Lys Pro Val Lys Ala Arg His
Ile245 250 255His Ile Pro His Asn Ser Ser
Gln Thr Gln Ile Ile Ile Gly His Pro260 265
270Thr Ser Lys Val Arg Thr Asp Lys Ala Gly Arg Gln Glu Phe Ser Asp275
280 285Phe Ser Leu Gly Asn Glu Ile Leu Ala
Gly Gly Asp Phe Asn Ala Arg290 295 300Leu
Met Lys Thr Ile Arg Glu Gln Lys Gly Tyr Thr Tyr Gly Ile Tyr305
310 315 320Gly Gly Met Glu Arg Leu
Arg Ala Gly Gly Asn Tyr Val Val Glu Phe325 330
335Ser Thr Asp Gly Asp Lys Ala Ala Asp Ala Ile Leu Glu Thr Leu
His340 345 350Ile Ile Asn Glu Ser Leu Asn
Glu Gly Ile Thr Gln Glu Glu Leu Glu355 360
365Leu Val Arg Leu Gly Asn Lys Asn Gly Phe Ala Asn Ile Phe Ser Ser370
375 380Asn Ala Ser Ile His Arg Val Ile Gly
Ala Leu Phe Val Ala Asp Tyr385 390 395
400Pro Lys Asp His Leu Asn His Thr Leu Asn Arg Leu Asp Asn
Ala Thr405 410 415Ile Asn Ser Val Asn Thr
Ala Leu Asn Leu Arg Ile Lys Pro Asp Glu420 425
430Phe91656DNAMoraxella catarrhalis 9atgagcttaa ttaataaatt
aaatgaacgc attacgccgc atgtcttaac ttcgattaaa 60aatcaagatg gcgataatgc
tgataaatct aatttgttaa ccgcatttta taccattttt 120gcaggacgct tgagtaatga
agatgtgtat cagcgtgcca atgctttgcc tgataatgag 180cttgagcatg ggcatcatct
gctcaatgtt gcttttagtg atgtttcaac tggtgaagat 240cagattgctt ctttgagtaa
tcaattagcc gatgaatatc atgtttcgcc agtaacggca 300cgcaccgcaa tcgcaacggc
agcacctttg gctttggcac gcattaaaga gcaagcaggt 360gcattatctg taccgtcttt
tattcgtact caattggcta aagaagaaaa ccgtttgcca 420acttgggcgc atactttatt
gccagcaggg ctatttgcaa ccgctgccac aaccaccgcc 480gagcctgtaa cgacagcctc
tgctgttgtg aaagagcctg tcaaaccaag tgttgtgaca 540gaaccagttc atccagctgc
ggctaccacc ccagtcaaaa caccaactgc ccagcattac 600gaaaacaaag aaaaaagtcc
ttttctaaaa acgattctac cgattattgg attgattatt 660tttgcaggct tggcatggct
tttgttaaga gcatgtcaag acaaaccaac acctgttgcg 720gcacctgttg cgacagatac
agcacctgtg gtagcggata atgctgtaca ggcagaccca 780acacaaacag gtgttgccca
agcacctgca acgcttagct tgtctgttga tgaaacgggt 840caagcgttgt actcgcaccg
tgctcaggtt ggtagtgaag agcttgcagg tcatatccgt 900gcagctattg ctcaagtctt
tggcgtacaa gatttaacca ttcaaaatac caatgtacat 960accgctacga tgccagcggc
agaatactta ccagcaattt tgggtttgat gaaaggtgta 1020ccaaattcaa gcgttgtgat
tcatgatcat acggtacgct ttaatgcaac cacgccagaa 1080gatgtagcaa aactggtaga
gggtgctaaa aatattctac ccgctgattt tactgtagaa 1140gcagaacctg aacttgatat
taatactgcg gttgccgata gtattgaaac agcgcgtgtt 1200gctattgttg ctttgggtga
tacggttgaa gaaaatgaga tggatatttt aatcaatgca 1260ttaaataccc aaatcattaa
ctttgcttta gactcaaccg aaattcccca agaaaataaa 1320gaaatcttgg atttggctgc
cgaaaaatta aaggcagtgc ctgaaacaac tttgcgtatc 1380attggtcata cagacactca
aggcacacat gagtataatc aagatttatc agaatctcgt 1440gctgctgctg ttaaagagta
tttggtatca aaaggtgttg ctgctgaacg cttgaacact 1500caaggtgcaa gttttgatta
tccagttgca tcaaatgcta ccgaacaagg tcgcttccaa 1560aaccgtcgta ttgagtttgt
acttttccaa gaaggtgaag caattactca agtcggtcat 1620gctgaagatg caccaacacc
tgttgcacaa aactga 165610551PRTMoraxella
catarrhalis 10Met Ser Leu Ile Asn Lys Leu Asn Glu Arg Ile Thr Pro His Val
Leu1 5 10 15Thr Ser Ile
Lys Asn Gln Asp Gly Asp Asn Ala Asp Lys Ser Asn Leu20 25
30Leu Thr Ala Phe Tyr Thr Ile Phe Ala Gly Arg Leu Ser
Asn Glu Asp35 40 45Val Tyr Gln Arg Ala
Asn Ala Leu Pro Asp Asn Glu Leu Glu His Gly50 55
60His His Leu Leu Asn Val Ala Phe Ser Asp Val Ser Thr Gly Glu
Asp65 70 75 80Gln Ile
Ala Ser Leu Ser Asn Gln Leu Ala Asp Glu Tyr His Val Ser85
90 95Pro Val Thr Ala Arg Thr Ala Ile Ala Thr Ala Ala
Pro Leu Ala Leu100 105 110Ala Arg Ile Lys
Glu Gln Ala Gly Ala Leu Ser Val Pro Ser Phe Ile115 120
125Arg Thr Gln Leu Ala Lys Glu Glu Asn Arg Leu Pro Thr Trp
Ala His130 135 140Thr Leu Leu Pro Ala Gly
Leu Phe Ala Thr Ala Ala Thr Thr Thr Ala145 150
155 160Glu Pro Val Thr Thr Ala Ser Ala Val Val Lys
Glu Pro Val Lys Pro165 170 175Ser Val Val
Thr Glu Pro Val His Pro Ala Ala Ala Thr Thr Pro Val180
185 190Lys Thr Pro Thr Ala Gln His Tyr Glu Asn Lys Glu
Lys Ser Pro Phe195 200 205Leu Lys Thr Ile
Leu Pro Ile Ile Gly Leu Ile Ile Phe Ala Gly Leu210 215
220Ala Trp Leu Leu Leu Arg Ala Cys Gln Asp Lys Pro Thr Pro
Val Ala225 230 235 240Ala
Pro Val Ala Thr Asp Thr Ala Pro Val Val Ala Asp Asn Ala Val245
250 255Gln Ala Asp Pro Thr Gln Thr Gly Val Ala Gln
Ala Pro Ala Thr Leu260 265 270Ser Leu Ser
Val Asp Glu Thr Gly Gln Ala Leu Tyr Ser His Arg Ala275
280 285Gln Val Gly Ser Glu Glu Leu Ala Gly His Ile Arg
Ala Ala Ile Ala290 295 300Gln Val Phe Gly
Val Gln Asp Leu Thr Ile Gln Asn Thr Asn Val His305 310
315 320Thr Ala Thr Met Pro Ala Ala Glu Tyr
Leu Pro Ala Ile Leu Gly Leu325 330 335Met
Lys Gly Val Pro Asn Ser Ser Val Val Ile His Asp His Thr Val340
345 350Arg Phe Asn Ala Thr Thr Pro Glu Asp Val Ala
Lys Leu Val Glu Gly355 360 365Ala Lys Asn
Ile Leu Pro Ala Asp Phe Thr Val Glu Ala Glu Pro Glu370
375 380Leu Asp Ile Asn Thr Ala Val Ala Asp Ser Ile Glu
Thr Ala Arg Val385 390 395
400Ala Ile Val Ala Leu Gly Asp Thr Val Glu Glu Asn Glu Met Asp Ile405
410 415Leu Ile Asn Ala Leu Asn Thr Gln Ile
Ile Asn Phe Ala Leu Asp Ser420 425 430Thr
Glu Ile Pro Gln Glu Asn Lys Glu Ile Leu Asp Leu Ala Ala Glu435
440 445Lys Leu Lys Ala Val Pro Glu Thr Thr Leu Arg
Ile Ile Gly His Thr450 455 460Asp Thr Gln
Gly Thr His Glu Tyr Asn Gln Asp Leu Ser Glu Ser Arg465
470 475 480Ala Ala Ala Val Lys Glu Tyr
Leu Val Ser Lys Gly Val Ala Ala Glu485 490
495Arg Leu Asn Thr Gln Gly Ala Ser Phe Asp Tyr Pro Val Ala Ser Asn500
505 510Ala Thr Glu Gln Gly Arg Phe Gln Asn
Arg Arg Ile Glu Phe Val Leu515 520 525Phe
Gln Glu Gly Glu Ala Ile Thr Gln Val Gly His Ala Glu Asp Ala530
535 540Pro Thr Pro Val Ala Gln Asn545
550111251DNAMoraxella catarrhalis 11atggatacaa aacacattca gcaaaattgg
cttctacctg atggtgtggc tgatgtacta 60tttaccgatg ctcaaaaaca agaaagcctg
cgtgatgcct tgctatttgt gctaaccgca 120cacggttatc gcttggtgtc accaccatta
atagagtata ccgaaagtct gctaaataat 180gctgacgaag atctaaaacg ccaaactttc
aaatttatcg atcagctcaa tggtcgtttg 240atgggtttgc gtgccgatat tacgccacaa
attctacgca ttgatagcaa atatggtcaa 300ggcatcagcc gttactgtta tgttgggcaa
gttgtcaaaa ccctaccgac tggtctgttt 360gggctgcgta caccgcttca attgggtgct
gagatttttg ggatagatga tatccgtgcc 420gagcttgagc tgattgatct attggccgca
ttggcagatg agatcggact aggccgagag 480atgctacatg tggatattgg tcatgtcgct
atttttgatc gcttgtgtca gttgcatggc 540gtttcaaata aagatgctga tgagctgatt
ggcatttacc ataaaaaagc catgccagaa 600cttgccaaat ggtgccaaaa tattggcaat
agcctaaaca gcccaagcga tgcaaccgat 660tttttggtat tggctaagca tacattaagc
agtgatcgga caccaaatgc cgaggcttta 720ttaagtaaac tgtccgataa agctcgccaa
gataataaaa tcatccaagc ggcaaatgag 780cttgctactt tggcggcaca tatcagagcg
gtgggtatga gtgtgagtat tgatgtgact 840gaattgtcag gatatcatta tcatactggt
gtggtattta atgtctattt gggtaataga 900accacacaga ctcaagcttt ggtacgaggc
ggtcgctttg atggtatctc aactcacagc 960gtagcaaggg gcgcaactgg ttttagcatg
gatattaatc gtttgcttga atttgtagag 1020cttgaagaag atactgtgat tttggtggat
tatcacgatt tgcaaaatgc tgatgcagac 1080acaaaagctg atttggccac acaaattaaa
accttgcaat ctgaaggctg tattgtcatt 1140aagcctttga ctgtagatga taagcctaac
cagattgatg gtgttttgca ttgggacacc 1200gatcaagata agccgatttg ggcggtgcga
ttagttggtg atgagtacta a 125112416PRTMoraxella catarrhalis
12Met Asp Thr Lys His Ile Gln Gln Asn Trp Leu Leu Pro Asp Gly Val1
5 10 15Ala Asp Val Leu Phe Thr
Asp Ala Gln Lys Gln Glu Ser Leu Arg Asp20 25
30Ala Leu Leu Phe Val Leu Thr Ala His Gly Tyr Arg Leu Val Ser Pro35
40 45Pro Leu Ile Glu Tyr Thr Glu Ser Leu
Leu Asn Asn Ala Asp Glu Asp50 55 60Leu
Lys Arg Gln Thr Phe Lys Phe Ile Asp Gln Leu Asn Gly Arg Leu65
70 75 80Met Gly Leu Arg Ala Asp
Ile Thr Pro Gln Ile Leu Arg Ile Asp Ser85 90
95Lys Tyr Gly Gln Gly Ile Ser Arg Tyr Cys Tyr Val Gly Gln Val Val100
105 110Lys Thr Leu Pro Thr Gly Leu Phe
Gly Leu Arg Thr Pro Leu Gln Leu115 120
125Gly Ala Glu Ile Phe Gly Ile Asp Asp Ile Arg Ala Glu Leu Glu Leu130
135 140Ile Asp Leu Leu Ala Ala Leu Ala Asp
Glu Ile Gly Leu Gly Arg Glu145 150 155
160Met Leu His Val Asp Ile Gly His Val Ala Ile Phe Asp Arg
Leu Cys165 170 175Gln Leu His Gly Val Ser
Asn Lys Asp Ala Asp Glu Leu Ile Gly Ile180 185
190Tyr His Lys Lys Ala Met Pro Glu Leu Ala Lys Trp Cys Gln Asn
Ile195 200 205Gly Asn Ser Leu Asn Ser Pro
Ser Asp Ala Thr Asp Phe Leu Val Leu210 215
220Ala Lys His Thr Leu Ser Ser Asp Arg Thr Pro Asn Ala Glu Ala Leu225
230 235 240Leu Ser Lys Leu
Ser Asp Lys Ala Arg Gln Asp Asn Lys Ile Ile Gln245 250
255Ala Ala Asn Glu Leu Ala Thr Leu Ala Ala His Ile Arg Ala
Val Gly260 265 270Met Ser Val Ser Ile Asp
Val Thr Glu Leu Ser Gly Tyr His Tyr His275 280
285Thr Gly Val Val Phe Asn Val Tyr Leu Gly Asn Arg Thr Thr Gln
Thr290 295 300Gln Ala Leu Val Arg Gly Gly
Arg Phe Asp Gly Ile Ser Thr His Ser305 310
315 320Val Ala Arg Gly Ala Thr Gly Phe Ser Met Asp Ile
Asn Arg Leu Leu325 330 335Glu Phe Val Glu
Leu Glu Glu Asp Thr Val Ile Leu Val Asp Tyr His340 345
350Asp Leu Gln Asn Ala Asp Ala Asp Thr Lys Ala Asp Leu Ala
Thr Gln355 360 365Ile Lys Thr Leu Gln Ser
Glu Gly Cys Ile Val Ile Lys Pro Leu Thr370 375
380Val Asp Asp Lys Pro Asn Gln Ile Asp Gly Val Leu His Trp Asp
Thr385 390 395 400Asp Gln
Asp Lys Pro Ile Trp Ala Val Arg Leu Val Gly Asp Glu Tyr405
410 41513639DNAMoraxella catarrhalis 13atgaataatt
ttgtgtatca gctacaaagt ttttggtatg agcttaatca ggtcaatcgt 60cataccattg
ctcaatcacc caaatatata cagctgacgg tacttggttt gatcgtgatg 120atcattggca
tttttggctg gctacttgcg attttaccaa ccattcaaaa gcttaatgca 180gcccaaagtc
aagaatctgc cttaattgat gaatttgcca ctaaatatca taaagcccag 240cagtttgacc
atctaagcca tcaggtcata caaaaaaata cacaacttga aaatcagctc 300aatgctctgc
cacgcacagc accgatgagc gagattatcg gaatgataaa taccaaagca 360caagcggtta
atgtgcaggt ggtgagtgca tcagttcaag caggtcgtga acaggattat 420tataccgaac
gccctatcgc agtgagtgcg acaggggatt atcatgcttt gggtcgatgg 480ttacttgagt
tgtcagaggc taaccatttg ctgacagtgc atgattttga tctgaaggct 540ggtttgaacc
atcagctgat gatgattgct cagatgaaaa cttatcaagc aaacaaacgc 600ccaaaaccag
ttgctcagca ggtgcctgat gttcaatga
63914212PRTMoraxella catarrhalis 14Met Asn Asn Phe Val Tyr Gln Leu Gln
Ser Phe Trp Tyr Glu Leu Asn1 5 10
15Gln Val Asn Arg His Thr Ile Ala Gln Ser Pro Lys Tyr Ile Gln
Leu20 25 30Thr Val Leu Gly Leu Ile Val
Met Ile Ile Gly Ile Phe Gly Trp Leu35 40
45Leu Ala Ile Leu Pro Thr Ile Gln Lys Leu Asn Ala Ala Gln Ser Gln50
55 60Glu Ser Ala Leu Ile Asp Glu Phe Ala Thr
Lys Tyr His Lys Ala Gln65 70 75
80Gln Phe Asp His Leu Ser His Gln Val Ile Gln Lys Asn Thr Gln
Leu85 90 95Glu Asn Gln Leu Asn Ala Leu
Pro Arg Thr Ala Pro Met Ser Glu Ile100 105
110Ile Gly Met Ile Asn Thr Lys Ala Gln Ala Val Asn Val Gln Val Val115
120 125Ser Ala Ser Val Gln Ala Gly Arg Glu
Gln Asp Tyr Tyr Thr Glu Arg130 135 140Pro
Ile Ala Val Ser Ala Thr Gly Asp Tyr His Ala Leu Gly Arg Trp145
150 155 160Leu Leu Glu Leu Ser Glu
Ala Asn His Leu Leu Thr Val His Asp Phe165 170
175Asp Leu Lys Ala Gly Leu Asn His Gln Leu Met Met Ile Ala Gln
Met180 185 190Lys Thr Tyr Gln Ala Asn Lys
Arg Pro Lys Pro Val Ala Gln Gln Val195 200
205Pro Asp Val Gln2101535DNAArtificial SequencePrimer 15catcagtgca
tatgaatacg acacaccatc acacg
351640DNAArtificial SequencePrimer 16gagttattct cgagtttgtc caaatttggc
ttagttttac 401730DNAArtificial SequencePrimer
17tcagtgagat cttgaatacg acacaccatc
301833DNAArtificial SequencePrimer 18gatttgagtt gtcgacttat ttgtccaaat ttg
331936DNAArtificial SequencePrimer
19cggagtgcca tatgagctta attaataaat taaatg
362031DNAArtificial SequencePrimer 20tataactcga ggttttgtgc aacaggtgtt g
312134DNAArtificial SequencePrimer
21cgcttgagat cttggaagat gtgtatcagc gtgc
342237DNAArtificial SequencePrimer 22caataacaaa gctttcagtt ttgtgcaaca
ggtgttg 372333DNAArtificial SequencePrimer
23aaccgcacat atgtatcgct tggtgtcacc acc
332435DNAArtificial SequencePrimer 24ggtgactcga ggtactcatc accaactaat
cgcac 352527DNAArtificial SequencePrimer
25gcaggatcct tatcgcttgg tgtcacc
272631DNAArtificial SequencePrimer 26atcaatcggg tcgacttagt actcatcacc a
312734DNAArtificial SequencePrimer
27aaagcttcat atggcccaaa gtcaagaatc tgcc
342831DNAArtificial SequencePrimer 28cgataactcg agttgaacat caggcacctg c
312939DNAArtificial SequencePrimer
29accattcaaa agagatcttg gcccaaagtc aagaatctg
393033DNAArtificial SequencePrimer 30gttagaccga gtcgactcat tgaacatcag gca
333130PRTMoraxella catarrhalis 31Met Asp
Thr Asp Met Lys His Leu Thr Lys His Arg Leu Ser Ala Ala1 5
10 15Ile Ile Gly Val Leu Leu Phe Ile Ser
Pro Ser Val Gln Ala20 25
303246PRTMoraxella catarrhalis 32Met Ser Leu Ile Asn Lys Leu Asn Glu Arg
Ile Thr Pro His Val Leu1 5 10
15Thr Ser Ile Lys Asn Gln Asp Gly Asp Asn Ala Asp Lys Ser Asn Leu20
25 30Leu Thr Ala Phe Tyr Thr Ile Phe Ala
Gly Arg Leu Ser Asn35 40
453342PRTMoraxella catarrhalis 33Met Asp Thr Lys His Ile Gln Gln Asn Trp
Leu Leu Pro Asp Gly Val1 5 10
15Ala Asp Val Leu Phe Thr Asp Ala Gln Lys Gln Glu Ser Leu Arg Asp20
25 30Ala Leu Leu Phe Val Leu Thr Ala His
Gly35 403460PRTMoraxella catarrhalis 34Met Asn Asn Phe
Val Tyr Gln Leu Gln Ser Phe Trp Tyr Glu Leu Asn1 5
10 15Gln Val Asn Arg His Thr Ile Ala Gln Ser Pro
Lys Tyr Ile Gln Leu20 25 30Thr Val Leu
Gly Leu Ile Val Met Ile Ile Gly Ile Phe Gly Trp Leu35 40
45Leu Ala Ile Leu Pro Thr Ile Gln Lys Leu Asn Ala50
55 60351299DNAMoraxella catarrhalis
35gagcttaaac ttgctgatga tagtattatt gatagtatca atcaattggg tgagctgacc
60gtcaatattc caaatacaca atattttcaa accaacaacg gtgtgagcgt tgcttttacg
120ccattacatg agctgcctat tgtcgatatc agcttgtatt ttaatgcagg gtcagcgtat
180gaccatcagg ttggcaaatc aggcacggct aacatggttg caaccatgct cacccaagga
240actgacagcc tttctgaaga tgagtttgtt gctgccaaag agcgtcttgg cattgatttt
300accagtacag caaataagga taacttaact ttatcattaa gaagcttgtc tgatcaatca
360ttattaaatc aagccgccga tttaatggtc gatgctgtca ctcaacctgc ttttgatgat
420aagactctac aacgcaacaa aaatcagctc atcaccagtt taaaacaaaa aaagcaaaac
480ccttatcatg tagcttctgt tgcttatcat caagccgtat atgaaaatca tccttatgca
540cacgcaacca caggcgatga agatagtatt gccaaaattg atcgtgatga gctgcttaat
600ttttggcata cttttattaa tgcaaataat gcgacactgg tgattacagg tgatatgacc
660gccgagcaag ccaaatcact tgccaaccat ctgaccgcca aattaccgac aggcaagtcg
720tataaaaata cgctggattt gacaaaacca gttaaggctc gtcatatcca tattcctcac
780aacagtagtc aaacccaaat catcatcggt catcccacca gtaaagtacg cacggacaaa
840gcaggtcgtc aagagttcag cgatttttca ttaggtaatg aaattttggc aggtggtgat
900tttaatgcca gattgatgaa aaccattcga gagcaaaaag gctacactta tggcatttat
960ggcggtatgg aacgcctcag agcaggtggt aattatgtgg ttgaattttc aaccgatggc
1020gataaagcag ccgatgccat tttagagacg ctacacatca ttaatgagtc gctgaatgaa
1080ggcataaccc aagaagagct tgagttggtg cgtttgggca ataaaaatgg ttttgccaat
1140attttttcaa gcaatgccag tattcatcgt gtcattggtg ctttatttgt tgccgattat
1200ccaaaagatc atcttaacca tacgctcaat cgcttggata atgccacgat aaatagtgtt
1260aataccgcac tgaacttgcg tatcaagcct gatgaattt
129936433PRTMoraxella catarrhalis 36Glu Leu Lys Leu Ala Asp Asp Ser Ile
Ile Asp Ser Ile Asn Gln Leu1 5 10
15Gly Glu Leu Thr Val Asn Ile Pro Asn Thr Gln Tyr Phe Gln Thr
Asn20 25 30Asn Gly Val Ser Val Ala Phe
Thr Pro Leu His Glu Leu Pro Ile Val35 40
45Asp Ile Ser Leu Tyr Phe Asn Ala Gly Ser Ala Tyr Asp His Gln Val50
55 60Gly Lys Ser Gly Thr Ala Asn Met Val Ala
Thr Met Leu Thr Gln Gly65 70 75
80Thr Asp Ser Leu Ser Glu Asp Glu Phe Val Ala Ala Lys Glu Arg
Leu85 90 95Gly Ile Asp Phe Thr Ser Thr
Ala Asn Lys Asp Asn Leu Thr Leu Ser100 105
110Leu Arg Ser Leu Ser Asp Gln Ser Leu Leu Asn Gln Ala Ala Asp Leu115
120 125Met Val Asp Ala Val Thr Gln Pro Ala
Phe Asp Asp Lys Thr Leu Gln130 135 140Arg
Asn Lys Asn Gln Leu Ile Thr Ser Leu Lys Gln Lys Lys Gln Asn145
150 155 160Pro Tyr His Val Ala Ser
Val Ala Tyr His Gln Ala Val Tyr Glu Asn165 170
175His Pro Tyr Ala His Ala Thr Thr Gly Asp Glu Asp Ser Ile Ala
Lys180 185 190Ile Asp Arg Asp Glu Leu Leu
Asn Phe Trp His Thr Phe Ile Asn Ala195 200
205Asn Asn Ala Thr Leu Val Ile Thr Gly Asp Met Thr Ala Glu Gln Ala210
215 220Lys Ser Leu Ala Asn His Leu Thr Ala
Lys Leu Pro Thr Gly Lys Ser225 230 235
240Tyr Lys Asn Thr Leu Asp Leu Thr Lys Pro Val Lys Ala Arg
His Ile245 250 255His Ile Pro His Asn Ser
Ser Gln Thr Gln Ile Ile Ile Gly His Pro260 265
270Thr Ser Lys Val Arg Thr Asp Lys Ala Gly Arg Gln Glu Phe Ser
Asp275 280 285Phe Ser Leu Gly Asn Glu Ile
Leu Ala Gly Gly Asp Phe Asn Ala Arg290 295
300Leu Met Lys Thr Ile Arg Glu Gln Lys Gly Tyr Thr Tyr Gly Ile Tyr305
310 315 320Gly Gly Met Glu
Arg Leu Arg Ala Gly Gly Asn Tyr Val Val Glu Phe325 330
335Ser Thr Asp Gly Asp Lys Ala Ala Asp Ala Ile Leu Glu Thr
Leu His340 345 350Ile Ile Asn Glu Ser Leu
Asn Glu Gly Ile Thr Gln Glu Glu Leu Glu355 360
365Leu Val Arg Leu Gly Asn Lys Asn Gly Phe Ala Asn Ile Phe Ser
Ser370 375 380Asn Ala Ser Ile His Arg Val
Ile Gly Ala Leu Phe Val Ala Asp Tyr385 390
395 400Pro Lys Asp His Leu Asn His Thr Leu Asn Arg Leu
Asp Asn Ala Thr405 410 415Ile Asn Ser Val
Asn Thr Ala Leu Asn Leu Arg Ile Lys Pro Asp Glu420 425
430Phe
User Contributions:
Comment about this patent or add new information about this topic:
