Inventors list

Assignees list

Classification tree browser

Top 100 Inventors

Top 100 Assignees

Patent application title: LONG LASTING FUSION PEPTIDE INHIBITORS OF VIRAL INFECTION

Inventors:  Dominique P. Bridon (Outremont, CA)  Robert S. Dufresne (Wellseley, MA, US)  Nissab Boudjellab (Dorval, CA)  Martin Robitaille (Terrasse-Vaudreuil, CA)  Peter G. Milner (Los Altos Hills, CA, US)
Assignees:  Conjuchem Biotechnologies, Inc.
IPC8 Class: AA61K3900FI
USPC Class: 4241781
Class name: Drug, bio-affecting and body treating compositions conjugate or complex of monoclonal or polyclonal antibody, immunoglobulin, or fragment thereof with nonimmunoglobulin material
Publication date: 2008-08-21
Patent application number: 20080199483





Sign up to receive free email alerts when patent applications with chosen keywords are published SIGN UP

Abstract:

Peptides exhibiting anti-viral and anti-fusogenic activity are modified to provide greater stability and improved half-life in vivo. The selected peptides include fusion inhibitors DP178 and DP107 and related peptides and analogs thereof. The modified peptides are capable of forming covalent bonds with one or more blood components, preferably a mobile blood component.

Claims:

1. A modified anti-viral peptide comprising:a peptide that exhibits anti-viral activity against respiratory syncytial virus (RSV), anda reactive group which is reactive with amino groups, hydroxyl groups, or thiol groups on blood components to form stable covalent bonds.

2. The modified peptide of claim 1, wherein said reactive group is a succinimidyl or a maleimido group.

3. The modified peptide of claim 1, wherein said reactive group is a maleimido group which is reactive with a thiol group on a blood protein.

4.-8. (canceled)

9. The modified peptide of claim 1, wherein said peptide is selected from the group consisting of SEQ ID NO: 10 to SEQ ID NO: 30.

10. The modified peptide of claim 1, wherein said peptide is selected from the group consisting of SEQ ID N0: 14 to SEQ ID N0: 17 and SEQ ID NO: 29.

11. A modified anti-viral peptide comprising:a peptide exhibits antiviral activity against human parainfluenza virus (HPIV), anda reactive group which is reactive with amino groups, hydroxyl groups, or thiol groups on blood components to form stable covalent bonds.

12. The modified peptide of claim 11, wherein said peptide is selected from the group consisting of SEQ ID N0: 31 to SEQ ID N0: 62.

13. The modified peptide of claim 11, wherein said peptide is selected from the group consisting of SEQ ID NO: 35, SEQ ID N0: 38 to SEQ ID N0: 42, SEQ ID N0: 52 and SEQ ID N0: 58.

14. A modified anti-viral peptide comprising:a peptide exhibits antiviral activity against measles virus (MeV), anda reactive group which is reactive with amino groups, hydroxyl groups, or thiol groups on blood components to form stable covalent bonds.

15. The modified peptide of claim 14, wherein said peptide is selected from the group consisting of SEQ ID N0: 74 to SEQ ID N0: 86.

16. The modified peptide of claim 14, wherein said peptide is selected from the group consisting of SEQ ID N0: 77, SEQ ID N0: 79, SEQ ID N0: 81 and SEQ ID N0: 84.

17. A modified anti-viral peptide comprising:a peptide exhibits antiviral activity against simian immunodeficiency virus (SIV), anda reactive group which is reactive with amino groups, hydroxyl groups, or thiol groups on blood components to form stable covalent bonds.

18. The modified peptide of claim 17, wherein said peptide is selected from the group consisting of SEQ ID N0: 63 to SEQ ID N0: 73.

19. (canceled)

20. The modified peptide of claim 11, wherein said reactive group is a maleimido group which is reactive with a thiol group on a blood protein.

21.-22. (canceled)

23. The modified peptide of claim 14, wherein said reactive group is a maleimido group which is reactive with a thiol group on a blood protein.

24.-25. (canceled)

26. The modified peptide of claim 17, wherein said reactive group is a maleimido group which is reactive with a thiol group on a blood protein.

27.-30. (canceled)

31. The modified peptide of claim 11, wherein said reactive group is a succinimidyl or a maleimido group.

32. The modified peptide of claim 14, wherein said reactive group is a succinimidyl or a maleimido group.

33. The modified peptide of claim 17, wherein said reactive group is a succinimidyl or a maleimido group.

34. An anti-viral peptide-albumin conjugate comprising:a peptide that exhibits anti-viral activity against respiratory syncytial virus (RSV) that comprises an amino acid sequence and a reactive group which is reactive with amino groups, hydroxyl groups, or thiol groups on blood components to form stable covalent bonds; andalbumin, wherein the peptide is covalently bonded to the albumin through the reactive group.

35. The conjugate of claim 34, wherein said reactive group is a maleimido group which is reactive with a thiol group on the albumin.

36. The conjugate of claim 34, wherein said peptide is selected from the group consisting of SEQ ID NO: 10 to SEQ ID NO: 30.

37. The conjugate of claim 34, wherein said peptide is selected from the group consisting of SEQ ID N0: 14 to SEQ ID N0: 17 and SEQ ID NO: 29.

38. An anti-viral peptide-albumin conjugate comprising:a peptide that exhibits anti-viral activity against human parainfluenza virus (HPIV), that comprises an amino acid sequence and a reactive group which is reactive with amino groups, hydroxyl groups, or thiol groups on blood components to form stable covalent bonds; andalbumin, wherein the peptide is covalently bonded to the albumin through the reactive group.

39. The conjugate of claim 38, wherein said reactive group is a maleimido group which is reactive with a thiol group on the albumin.

40. The conjugate of claim 38, wherein said peptide is selected from the group consisting of SEQ ID N0: 31 to SEQ ID N0: 62.

41. The conjugate of claim 38, wherein said peptide is selected from the group consisting of SEQ ID N0: 35, SEQ ID N0: 38 to 42, SEQ ID N0: 52 and SEQ ID N0: 58.

42. An anti-viral peptide-albumin conjugate comprising:a peptide that exhibits anti-viral activity against measles virus (MeV), that comprises an amino acid sequence and a reactive group which is reactive with amino groups, hydroxyl groups, or thiol groups on blood components to form stable covalent bonds; andalbumin, wherein the peptide is covalently bonded to the albumin through the reactive group.

43. The conjugate of claim 42, wherein said reactive group is a maleimido group which is reactive with a thiol group on the albumin.

44. The conjugate of claim 42, wherein said peptide is selected from the group consisting of SEQ ID N0: 74 to SEQ ID N0: 86.

45. The conjugate of claim 42 wherein said peptide is selected from the group consisting of SEQ ID N0: 77, SEQ ID N0: 79, SEQ ID N0: 81 and SEQ ID N0: 84.

46. An anti-viral peptide-albumin conjugate comprising:a peptide that exhibits anti-viral activity against simian immunodeficiency virus (SIV), that comprises an amino acid sequence and a reactive group which is reactive with amino groups, hydroxyl groups, or thiol groups on blood components to form stable covalent bonds; andalbumin, wherein the peptide is covalently bonded to the albumin through the reactive group.

47. The conjugate of claim 46, wherein said reactive group is a maleimido group which is reactive with a thiol group on the albumin.

48. The conjugate of claim 46, wherein said peptide is selected from the group consisting of SEQ ID N0: 63 to SEQ ID N0: 73.

49. A composition comprising the modified anti-viral peptide of claim 1 and a physiologically acceptable medium.

50. A composition comprising the modified anti-viral peptide of claim 11 and a physiologically acceptable medium.

51. A composition comprising the modified anti-viral peptide of claim 14 and a physiologically acceptable medium.

52. A composition comprising the modified anti-viral peptide of claim 17 and a physiologically acceptable medium.

53. A composition comprising the conjugate of claim 34 and a physiologically acceptable medium.

54. A composition comprising the conjugate of claim 38 and a physiologically acceptable medium.

55. A composition comprising the conjugate of claim 42 and a physiologically acceptable medium.

56. A composition comprising the conjugate of claim 46 and a physiologically acceptable medium.

57. A method of inhibiting or reducing membrane fusion between respiratory syncytial virus (RSV) and a cell, comprising contacting the RSV with a modified peptide of claim 1.

58. A method of inhibiting or reducing membrane fusion between human parainfluenze virus (HPIV) and a cell, comprising contacting the HPIV with a modified peptide of claim 11.

59. A method of inhibiting or reducing membrane fusion between measles virus (MeV) and a cell, comprising contacting the MeV with a modified peptide of claim 14.

60. A method of inhibiting or reducing membrane fusion between simian immunodeficiency virus (SIV) and a cell, comprising contacting the SIV with a modified peptide of claim 17.

61. A method of inhibiting or reducing membrane fusion between respiratory syncytial virus (RSV) and a cell, comprising contacting the RSV with a conjugate of claim 34.

62. A method of inhibiting or reducing membrane fusion between human parainfluenze virus (HPIV) and a cell, comprising contacting the HPIV with a conjugate of claim 38.

63. A method of inhibiting or reducing membrane fusion between measles virus (MeV) and a cell, comprising contacting the MeV with a conjugate of claim 42.

64. A method of inhibiting or reducing membrane fusion between simian immunodeficiency virus (SIV) and a cell, comprising contacting the SIV with a conjugate of claim 46.

65. A method of making a conjugate of claim 34, comprising:contacting a modified peptide of claim 1 with albumin to form an anti-viral peptide-albumin conjugate.

66. The method of claim 65, wherein the modified anti-viral peptide is made by combining an anti-RSV peptide having a free amino group, N-[γ-maleimidobutyryloxy]succinimide ester (GMBS) and trietylamine or maleimidopropionic acid (MPA) to form a maleimide containing group at the free amino group, to form the modified anti-viral peptide.

67. A method of making a conjugate of claim 38, comprising:contacting a modified peptide of claim 11 with albumin to form an anti-viral peptide-albumin conjugate.

68. The method of claim 67, wherein the modified anti-viral peptide is made by combining an anti-HPIV peptide having a free amino group, N-[γ-maleimidobutyryloxy]succinimide ester (GMBS) and trietylamine or maleimidopropionic acid (MPA) to form a maleimide containing group at the free amino group, to form the modified anti-viral peptide.

69. A method of making a conjugate of claim 42, comprising:contacting a modified peptide of claim 14 with albumin to form an anti-viral peptide-albumin conjugate.

70. The method of claim 69, wherein the modified anti-viral peptide is made by combining an anti-MeV peptide having a free amino group, N-[γ-maleimidobutyryloxy]succinimide ester (GMBS) and trietylamine or maleimidopropionic acid (MPA) to form a maleimide containing group at the free amino group, to form the modified anti-viral peptide.

71. A method of making a conjugate of claim 46, comprising:contacting a modified peptide of claim 17 with albumin to form an anti-viral peptide-albumin conjugate.

72. The method of claim 71, wherein the modified anti-viral peptide is made by combining an anti-SIV peptide having a free amino group, N-[γ-maleimidobutyryloxy]succinimide ester (GMBS) and trietylamine or maleimidopropionic acid (MPA) to form a maleimide containing group at the free amino group, to form the modified anti-viral peptide.

73. A method of treating or preventing respiratory syncytial virus (RSV) infection in a subject, comprisingadministering a modified peptide of claim 1 to a subject having or at risk of RSV infection, thereby treating or preventing the infection.

74. The method of claim 73, wherein the subject has brochiolitis.

75. The method of claim 73, wherein the subject has pneumonia.

76. The method of claim 73, wherein the modified peptide is conjugated with albumin in vivo.

77. The method of claim 73, wherein the modified peptide is conjugated with albumin ex vivo.

78. A method of treating or preventing respiratory syncytial virus (RSV) infection in a subject, comprisingadministering a conjugate of claim 34 to a subject having or at risk of RSV infection, thereby treating or preventing the infection.

79. The method of claim 78, wherein the subject has brochiolitis.

80. The method of claim 78, wherein the subject has pneumonia.

81. A method of treating or preventing human parainfluenza virus (HPIV) infection in a subject, comprisingadministering a modified peptide of claim 11 to a subject having or at risk of HPIV infection, thereby treating or preventing the infection.

82. The method of claim 81, wherein the subject has respiratory tract disease.

83. The method of claim 81, wherein the subject has croup.

84. The method of claim 81, wherein the subject has brochiolitis.

85. The method of claim 81, wherein the subject has pneumonia.

86. The method of claim 81, wherein the modified peptide is conjugated with albumin in vivo.

87. The method of claim 81, wherein the modified peptide is conjugated with albumin ex vivo.

88. A method of treating or preventing human parainfluenza virus (HPIV) infection in a subject, comprisingadministering a conjugate of claim 38 to a subject having or at risk of HPIV infection, thereby treating or preventing the infection.

89. The method of claim 88, wherein the subject has respiratory tract disease.

90. The method of claim 88, wherein the subject has croup.

91. The method of claim 88, wherein the subject has brochiolitis.

92. The method of claim 88, wherein the subject has pneumonia.

93. A method of treating or preventing measles virus (MeV) infection in a subject, comprisingadministering a modified peptide of claim 14 to a subject having or at risk of MeV infection, thereby treating or preventing the infection.

94. The method of claim 93, wherein the modified peptide is conjugated with albumin in vivo.

95. The method of claim 93, wherein the modified peptide is conjugated with albumin ex vivo.

96. A method of treating or preventing measles virus (MeV) infection in a subject, comprisingadministering a conjugate of claim 42 to a subject having or at risk of MeV infection, thereby treating or preventing the infection.

97. A method of treating or preventing simian immunodeficiency virus (SIV) infection in a subject, comprisingadministering a modified peptide of claim 17 to a subject having or at risk of SIV infection, thereby treating or preventing the infection.

98. The method of claim 97, wherein the modified peptide is conjugated with albumin in vivo.

99. The method of claim 97, wherein the modified peptide is conjugated with albumin ex vivo.

100. A method of treating or preventing simian immunodeficiency virus (SIV) infection in a subject, comprisingadministering a conjugate of claim 46 to a subject having or at risk of SIV infection, thereby treating or preventing the infection.

Description:

FIELD OF THE INVENTION

[0001]This invention relates to modified peptides that are inhibitors of viral activity and/or exhibit antifusogenic properties. In particular, this invention relates to modified peptide inhibitors of human immunodeficiency virus (HIV), respiratory syncytial virus (RSV), human parainfluenza virus (HPV), measles virus (MeV), and simian immunodeficiency virus (SIV) with long duration of action for the treatment of the respective viral infections. The invention also relates to conjugates of the modified peptides and endogenous carriers, particularly conjugates of the modified peptides and various mobile blood components, particularly mobile endogenous proteins.

BACKGROUND OF THE INVENTION

[0002]Membrane fusion events, while commonplace in normal cell biological processes, are also involved in a variety of disease states, including, for example the entry of enveloped viruses into cells. Peptides are known that inhibit or otherwise disrupt membrane fusion-associated events, including, for example, inhibiting retroviral transmission to uninfected cells. As an example, the synthetic peptides DP-107 and DP-178 derived from separate domains within the human immunodeficiency virus type 1 ("HIV-1") transmembrane ("TM") glycoprotein gp41, are potent inhibitors of HIV-1 infection and HIV induced cell-cell fusion.

[0003]Lambert, et al., "Peptides from Conserved Regions of Paramyxovirus Fusion (F) Proteins are Potent Inhibitors of Viral Fusion," Proc. Natl. Acad. Science U.S.A., Mar. 5, 1996, Vol. 93 (5), pp. 2186-91, discloses that the synthetic peptides DP-107 and DP-178 (T-20), derived from separate domains within the human immunodeficiency virus type 1 (HIV-1) transmembrane (TM) protein, gp41, are potent inhibitors of HIV-1 infection and fusion. Using a computer searching strategy (computerized antiviral searching technology, C.A.S.T.) based on the predicted secondary structure of DP-107 and DP-178 (T-20), Lambert, et al. identified conserved heptad repeat domains analogous to the DP-107 and DP-178 regions of HIV-1 gp41 within the glycoproteins of other fusogenic viruses. Antiviral peptides derived from three representative paramyxoviruses, respiratory syncytial virus (RSV), human parainfluenza virus type 3 (HPIV-3), and measles virus (MV) blocked homologous virus-mediated syncytium formation and exhibited EC50 values in the range 0.015-0.250 μM. Moreover, these peptides were highly selective for the virus of origin.

[0004]U.S. Pat. Nos. 6,013,263, 6,017,536 and 6,020,459 incorporated herein in their entirety, likewise disclose that the 36 amino acid peptide DP178 corresponding to amino acids 638 to 673 of gp41 from the HIV-1 isolate LAI (HIV-1LAI), and the 38 amino acid peptide DP107 corresponding to amino acids 558-595 of gp41 from the HIV-1LAI, both exhibit potent anti-HIV-1 activity.

[0005]While many of the anti-viral or anti-fusogenic peptides described in the art exhibit potent anti-viral and/or anti-fusogenic activity, these peptides suffer from short plasma half-lifes in vivo, primarily due to rapid serum clearance and peptidase and protease activity. This in turn greatly reduces the effective anti-viral activity of the peptides. There is therefore a need for a method of prolonging the half-life of existing anti-viral and/or anti-fusogenic peptides and providing for longer duration of action of these peptides in vivo.

SUMMARY OF THE INVENTION

[0006]The present invention meets these and other needs and is directed to modified peptides having anti-viral activity and/or anti-fusogenic activity. These modified peptides provide for an increased stability in vivo and a reduced susceptibility to peptidase or protease degradation. These modified peptides thereby minimize, e.g., the need for more frequent, or even continual, administration of the peptides. The products of varying embodiments of the present invention can be used, e.g., as a prophylactic against and/or treatment for infection of a number of viruses, including human immunodeficiency virus (HIV), human respiratory syncytial virus (RSV), human parainfluenza virus (HPV), measles virus (MeV) and simian immunodeficiency virus (SIV). Modification of other peptides involved in viral transfection (e.g., Hepatitis, Epstein Barr and other related viruses) is also within the scope of the invention.

[0007]This invention relates to chemically reactive modifications of peptides exhibiting anti-viral and/or anti-fusogenic activity such that the modified peptides can react with available functionalities on blood components to form stable covalent bonds. In one embodiment of the invention, the modified peptides comprise a reactive group which is reactive with amino groups, hydroxyl groups, or thiol groups on blood components to form stable covalent bonds. In another embodiment of the invention, the reactive group can be a maleimide which is reactive with a thiol group on a blood protein, including a mobile blood protein such as albumin.

[0008]In particular, the invention relates to such chemically reactive modifications of DP107 and DP178 peptides and analogs thereof, including peptides comprised of amino acid sequences from other (non-HIV) viruses that correspond to the gp41 region of HIV from which DP107 and DP178 are derived and that exhibit anti-viral or anti-fusogenic activity. More particularly, these peptides can exhibit anti-viral activity against, among others, human respiratory syncytial virus (RSV), human parainfluenza virus (HPV), measles virus (MeV) and simian immunodeficiency virus (SIV). The invention also relates to such chemically reactive modifications of the peptides of SEQ ID NO:1 to SEQ ID NO:86.

[0009]The invention also relates to compositions for use in the prevention and/or treatment of viral infection comprising a peptide that exhibits anti-viral activity modified with a reactive group as described. More particularly, the invention relates to such compositions for use in the prevention and/or treatment of AIDS, human respiratory syncytial virus (RSV), human parainfluenza virus (HPV), measles virus (MeV) and simian immunodeficiency virus (SIV).

BRIEF DESCRIPTION OF THE TABLES

[0010]The invention will be better understood by reference to the Tables, in which:

[0011]Table 1 lists the commonly occurring amino acids together with their one letter and three letter abbreviations, and common protecting groups.

[0012]Table 2 shows DP178 carboxy truncations.

[0013]Table 3 shows DP178 amino truncations.

[0014]Table 4 shows DP107 carboxy truncations.

[0015]Table 5 shows DP107 amino truncations.

[0016]Table 6 shows HIV-2NIHZ DP178 analog carboxy truncations.

[0017]Table 7 shows HIV-2NIHZ DP178 analog amino truncations.

[0018]Table 8 shows RSV F2 region DP107 analog carboxy truncations.

[0019]Table 9 shows RSV F2 region DP107 analog amino truncations.

[0020]Table 10 shows RSV F1 region DP178 analog carboxy truncations.

[0021]Table 11 shows RSV F1 region DP178 analog amino truncations.

[0022]Table 12 shows HPV3 F1 region DP 178 analog carboxy truncations.

[0023]Table 13 shows HPV3 F1 region DP 178 analog amino truncations.

[0024]Table 14 shows HPV3 F1 region DP 107 analog carboxy truncations.

[0025]Table 15 shows HPV3 F1 region DP 107 analog amino truncations.

[0026]Table 16 shows representative anti-RSV peptides.

[0027]Table 17 shows representative anti-HPV3 peptides.

[0028]Table 18 shows representative anti-SIV peptides.

[0029]Table 19 shows representative anti-MeV peptides.

BRIEF DESCRIPTION OF SEQUENCE LISTING

[0030]The invention will be better understood by reference to the Sequence Listing, in which:

[0031]SEQ ID NO:1 shows the peptide sequence of DP 178.

[0032]SEQ ID NO:2 shows the peptide sequence of DP 107

[0033]SEQ ID NO:3-9 show peptide sequences of certain DP178 analogs.

[0034]SEQ ID NO:10-30 show the peptide sequences of RSV F1 region and F2 region corresponding to DP178 and DP107, and representative anti-RSV peptides;

[0035]SEQ ID NO:31-62 show the peptide sequences of HPIV3 F1 region corresponding to DP178 and DP107, and representative anti-HPIV3 peptides;

[0036]SEQ ID NO:63-73 show peptide sequences of SIV corresponding to DP178 and representative anti-SIV peptides; and

[0037]SEQ ID NO:74-78 show peptide sequences of MeV corresponding to DP178 and representative anti-MeV peptides.

DETAILED DESCRIPTION OF THE INVENTION

[0038]To ensure a complete understanding of the invention the following definitions are provided:

[0039]Anti-viral peptides: As used herein, anti-viral peptides shall refer to peptides that inhibit viral infection of cells, by, for example, inhibiting cell-cell fusion or free virus infection. The route of infection may involve membrane fusion, as occurs in the case of enveloped viruses, or some other fusion event involving viral and cellular structures. Peptides that inhibit viral infection by a particular virus may be referenced with respect to that particular virus, e.g., anti-HIV peptide, anti-RSV peptide, etc.

[0040]Antifusogenic peptides: Antifusogenic peptides are peptides demonstrating an ability to inhibit or reduce the level of membrane fusion events between two or more entities, e.g., virus-cell or cell-cell, relative to the level of membrane fusion that occurs in the absence of the peptide.

[0041]HIV and anti-HIV peptides: The human immunodeficiency virus (HIV), which is responsible for acquired immune deficiency syndrome (AIDS), is a member of the lentivirus family of retroviruses. There are two prevalent types of HIV, HIV-1 and HIV-2, with various strain of each having been identified. HIV targets CD-4+ cells, and viral entry depends on binding of the HIV protein gp41 to CD4+ cell surface receptors. Anti-HIV peptides refer to peptides that exhibit anti-viral activity against HIV, including inhibiting CD-4+ cell infection by free virus and/or inhibiting HIV-induced syncytia formation between infected and uninfected CD-4+ cells.

[0042]SIV and anti-SIV peptides: Simian immunodeficiency viruses (SIV) are lentiviruses that cause acquired immunodeficiency syndrome (AIDS)-like illnesses in susceptible monkeys. Anti-SIV peptides are peptides that exhibit anti-viral activity against SIV, including inhibiting of infection of cells by the SIV virus and inhibiting syncytia formation between infected and uninfected cells.

[0043]RSV and anti-RSV peptides: Respiratory syncytial virus (RSV) is a respiratory pathogen, especially dangerous in infants and small children where it can cause bronchiolitis (inflammation of the small air passages) and pneumonia. RSVs are negative sense, single stranded RNA viruses and are members of the Paramyxoviridae family of viruses. The route of infection of RSV is typically through the mucous membranes by the respiratory tract, i.e., nose, throat, windpipe and bronchi and bronchioles. Anti-RSV peptides are peptides that exhibit anti-viral activity against RSV, including inhibiting mucous membrane cell infection by free RSV virus and syncytia formation between infection and uninfected cells.

[0044]HPV and anti-HPV peptides: Human parainfluenza virus (HPIV or HPV), like RSV, is another leading cause of respiratory tract disease, and like RSVs, are negative sense, single stranded RNA viruses that are members of the Paramyxoviridae family of viruses. There are four recognized serotypes of HPIV--HPIV-1, HPIV-2, HPIV-3 and HPIV-4. HPIV-1 is the leading cause of croup in children, and both HPIV-1 and HPIV-2 cause upper and lower respiratory tract illnesses. HPIV-3 is more often associated with bronchiolitis and pneumonia. Anti-HPV peptides are peptides that exhibit anti-viral activity against HPV, including inhibiting infection by free HPV virus and syncytia formation between infected and uninfected cells.

[0045]MeV and anti-Mev peptides: Measles virus (VM or MeV) is an enveloped negative, single-stranded RNA virus belonging to the Paramyxoviridae family of viruses. Like RSV and HPV, MeV causes respiratory disease, and also produces an immuno-suppression responsible for additional, opportunistic infections. In some cases, MeV can establish infection of the brain leading to severe neurlogical complications. Anti-MeV peptides are peptides that exhibit anti-viral activity against MeV, including inhibiting infection by free MeV virus and syncytia formation between infected and uninfected cells.

[0046]DP-178 and DP178 analogs: Unless otherwise indicated explicitly or by context, DP-178 means the 36 amino acid DP-178 peptide corresponding to amino acid residues 638-673 of the gp41 glycoprotein of HIV-1 isolate LAI (HIVLAI) and having the sequence:

TABLE-US-00001 YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF (SEQ ID NO: 1)

as well as truncations, deletions and/or insertions thereof. Truncations of the DP178 peptide may comprise peptides of between 3-36 amino acids. Deletions consist of the removal of one or more amino acid residues from the DP178 peptide, and may involve the removal of a single contiguous portion of the peptide sequence or multiple portions. Insertions may comprise single amino acid residues or stretches of residues and may be made at the carboxy or amino terminal end of the DP178 peptide or at a position internal to the peptide.

[0047]DP178 peptide analogs are peptides whose amino acid sequences are comprised of the amino acid sequences of peptide regions of viruses other than HIV-1LAI that correspond to the gp41 region from which DP178 was derived, as well as an truncations, deletions or insertions thereof. Such other viruses may include, but are not limited to, other HIV isolates such as HIV-2NIHZ, respiratory syncytial virus (RSV), human parainfluenza virus (HPV), simian immunodeficiency virus (SIV), and measles virus (MeV). DP178 analogs also refer to those peptide sequences identified or recognized by the ALLMOTI5, 107×178×4 and PLZIP search motifs described in U.S. Pat. Nos. 6,013,263, 6,017,536 and 6,020,459 and incorporated herein, having structural and/or amino acid motif similarity to DP178. DP178 analogs further refer to peptides described as "DP178-like" as that term is defined in U.S. Pat. Nos. 6,013,263, 6,017,536 and 6,020,459.

[0048]DP-107 and DP107 analogs: Unless otherwise indicated explicitly or by context, DP-107 means the 38 amino acid DP-107 peptide corresponding to amino acid residues 558-595 of the gp41 protein of HIV-1 isolate LAI (HIVLAI) and having the sequence:

TABLE-US-00002 (SEQ ID NO: 2) NNLLRAIEAQQHLLQLTVWQIKQLQARILAVERYLKDQ

as well as truncations, deletions and/or insertions thereof. Truncations of the DP107 peptide may comprise peptides of between 3-38 amino acids. Deletions consist of the removal of one or more amino acid residues from the DP107 peptide, and may involve the removal of a single contiguous portion of the peptide sequence or multiple portions. Insertions may comprise single amino acid residues or stretches of residues and may be made at the carboxy or amino terminal end of the DP107 peptide or at a position internal to the peptide.

[0049]DP107 peptide analogs are peptides whose amino acid sequences are comprised of the amino acid sequences of peptide regions of viruses other than HIV-1LAI that correspond to the gp41 region from which DP107 was derived, as well as truncations, deletions and/or insertions thereof. Such other viruses may include, but are not limited to, other HIV isolates such as HIV-2NIHZ, respiratory syncytial virus (RSV), human parainfluenza virus (HPV), simian immunodeficiency virus (SIV), and measles virus (MeV). DP107 analogs also refer to those peptide sequences identified or recognized by the ALLMOTI5, 107×178×4 and PLZIP search motifs described in U.S. Pat. Nos. 6,013,263, 6,017,536 and 6,020,459 and incorporated herein, having structural and/or amino acid motif similarity to DP107. DP107 analogs further refer to peptides described as "DP107-like" as that term is defined in U.S. Pat. Nos. 6,013,263, 6,017,536 and 6,020,459.

[0050]Reactive Groups: Reactive groups are chemical groups capable of forming a covalent bond. Such reactive groups are coupled or bonded to a DP-107 or DP-178 peptide or analogs thereof or other anti-viral or anti-fusogenic peptide of interest. Reactive groups will generally be stable in an aqueous environment and will usually be carboxy, phosphoryl, or convenient acyl group, either as an ester or a mixed anhydride, or an imidate, thereby capable of forming a covalent bond with functionalities such as an amino group, a hydroxy or a thiol at the target site on mobile blood components. For the most part, the esters will involve phenolic compounds, or be thiol esters, alkyl esters, phosphate esters, or the like.

[0051]Functionalities: Functionalities are groups on blood components to which reactive groups on modified anti-viral peptides react to form covalent bonds. Functionalities include hydroxyl groups for bonding to ester reactive entities; thiol groups for bonding to maleimides, imidates and thioester groups; amino groups for bonding to carboxy, phosphoryl or acyl groups and carboxyl groups for bonding to amino groups.

[0052]Blood Components: Blood components may be either fixed or mobile. Fixed blood components are non-mobile blood components and include tissues, membrane receptors, interstitial proteins, fibrin proteins, collagens, platelets, endothelial cells, epithelial cells and their associated membrane and membraneous receptors, somatic body cells, skeletal and smooth muscle cells, neuronal components, osteocytes and osteoclasts and all body tissues especially those associated with the circulatory and lymphatic systems. Mobile blood components are blood components that do not have a fixed situs for any extended period of time, generally not exceeding 5, more usually one minute. These blood components are not membrane-associated and are present in the blood for extended periods of time and are present in a minimum concentration of at least 0.1 μg/ml. Mobile blood components include serum albumin, transferrin, ferritin and immunoglobulins such as IgM and IgG. The half-life of mobile blood components is at least about 12 hours.

[0053]Protective Groups: Protective groups are chemical moieties utilized to protect peptide derivatives from reacting with themselves. Various protective groups are disclosed herein and in U.S. Pat. No. 5,493,007, which is hereby incorporated by reference. Such protective groups include acetyl, fluorenylmethyloxycarbonyl (Fmoc), t-butyloxycarbonyl (Boc), benzyloxycarbonyl (CBZ), and the like. The specific protected amino acids are depicted in Table 1.

TABLE-US-00003 TABLE 1 NATURAL AMINO ACIDS AND THEIR ABBREVIATIONS 3-Letter 1-Letter Name Abbreviation Abbreviation Modified Amino Acids Alanine Ala A Fmoc-Ala-OH Arginine Arg R Fmoc-Arg(Pbf)-OH Asparagine Asn N Fmoc-Asn(Trt)-OH Aspartic acid Asp D Asp(tBu)-OH Cysteine Cys C Fmoc-Cys(Trt) Glutamic acid Glu E Fmoc-Glu(tBu)-OH Glutamine Gln Q Fmoc-Gln(Trt)-OH Glycine Gly G Fmoc-Gly-OH Histidine His H Fmoc-His(Trt)-OH Isoleucine Ile I Fmoc-Ile-OH Leucine Leu L Fmoc-Leu-OH Lysine Lys Z Boc-Lys(Aloc)-OH Lysine Lys X Fmoc-Lys(Aloc)-OH Lysine Lys K Fmoc-Lys(Mtt)-OH Methionine Met M Fmoc-Met-OH Phenylalanine Phe F Fmoc-Phe-OH Proline Pro P Fmoc-Pro-OH Serine Ser S Fmoc-Ser(tBu)-OH Threonine Thr T Fmoc-Thr(tBu)-OH Tryptophan Trp W Fmoc-Trp(Boc)-OH Tyrosine Tyr Y Boc-Tyr(tBu)-OH Valine Val V Fmoc-Val-OH

[0054]Linking Groups: Linking (spacer) groups are chemical moieties that link or connect reactive entities to antiviral or antifusogenic peptides. Linking groups may comprise one or more alkyl moeities, alkoxy moeity, alkenyl moeity, alkynyl moeity or amino moeity substituted by alkyl moeities, cycloalkyl moeity, polycyclic moeity, aryl moeity, polyaryl moeities, substituted aryl moeities, heterocyclic moeities, and substituted heterocyclic moeities. Linking groups may also comprise poly ethoxy amino acids, such as AEA ((2-amino) ethoxy acetic acid) or a preferred linking group AEEA ([2-(2-amino)ethoxy)]ethoxy acetic acid.

[0055]Sensitive Functional Groups--A sensitive functional group is a group of atoms that represents a potential reaction site on an antiviral and/or antifusogenic peptide. If present, a sensitive functional group may be chosen as the attachment point for the linker-reactive group modification. Sensitive functional groups include but are not limited to carboxyl, amino, thiol, and hydroxyl groups.

[0056]Modified Peptides--A modified peptide is an antiviral and/or antifusogenic peptide that has been modified by attaching a reactive group. The reactive group may be attached to the peptide either via a linking group, or optionally without using a linking group. It is also contemplated that one or more additional amino acids may be added to the peptide to facilitate the attachment of the reactive entity. Modified peptides may be administered in vivo such that conjugation with blood components occurs in vivo, or they may be first conjugated to blood components in vitro and the resulting conjugated peptide (as defined below) administered in vivo.

[0057]Conjugated Peptides--A conjugated peptide is a modified peptide that has been conjugated to a blood component via a covalent bond formed between the reactive group of the modified peptide and the functionalities of the blood component, with or without a linking group. As used throughout this application, the term "conjugated peptide" can be made more specific to refer to particular conjugated peptides, for example "conjugated DP178" or "conjugated DP107."

[0058]Taking into account these definitions, the present invention takes advantage of the properties of existing anti-viral and antifusogenic peptides. The viruses that may be inhibited by the peptides include, but are not limited to all strains of viruses listed, e.g., in U.S. Pat. Nos. 6,013,263, 6,017,536 and 6,020,459 at Tables V-VII and IX-XIV therein. These viruses include, e.g., human retroviruses, including HIV-1, HIV-2, and human T-lympocyte viruses (HTLV-I and HTLV-II), and non-human retroviruses, including bovine leukosis virus, feline sarcoma virus, feline leukemia virus, simian immunodeficiency virus (SIV), simian sarcoma virus, simian leukemia, and sheep progress pneumonia virus. Non-retroviral viruses may also be inhibited by the peptides of the present invention, including human respiratory syncytial virus (RSV), canine distemper virus, Newcastle Disease virus, human parainfluenza virus (HPIV), influenza viruses, measles viruses (MeV), Epstein-Barr viruses, hepatitis B viruses, and simian Mason-Pfizer viruses. Non-enveloped viruses may also be inhibited by the peptides of the present invention, and include, but are not limited to, picornaviruses such as polio viruses, hepatitis A virus, enteroviruses, echoviruses, coxsackie viruses, papovaviruses such as papilloma virus, parvoviruses, adenoviruses, and reoviruses.

[0059]As an example, the mechanism of action of HIV fusion peptides has been described as discussed in the background section of this application and antiviral and antifusogenic properties of the peptides have been well established. A synthetic peptide corresponding to the carboxyl-terminal ectodomain sequence (for instance, amino acid residues 643-678 of HIV-1 class B, of the LAI strain or residues 638-673 from similar strain as well as residues 558-595) has been shown to inhibit virus-mediated cell-cell fusion completely at low concentration. The fusion peptide competes with the leucine zipper region of the native viral gp41 thus resulting in the interference of the fusion/infection of the virus into the cell.

[0060]The focus of the present invention is to modify a selected anti-viral and/or antifusogenic peptide with the DAC (Drug Activity Complex) technology to confer to this peptide improved bio-availability, extended half-life and better distribution through selective conjugation of the peptide onto a protein carrier but without modifying the peptide's anti-viral properties. The carrier of choice (but not limited to) for this invention would be albumin conjugated through its free thiol by an anti-viral and/or antifusogenic peptide modified with a maleimide moiety.

[0061]Several peptide sequences have been described in the literature as highly potent for the prevention of HIV-1 fusion/infection. As examples, peptide DP 178 binds to a conformation of gp41 that is relevant for fusion. Thus in one embodiment of the invention, DP178 and DP178-like peptides are modified. Likewise, other embodiments of the invention include modification of DP107 and DP107-like peptide for use against HIV, as well as peptides analagous to DP107 and DP178 that are found in RSV, HPV, MeV and SIV viruses.

1. DP178 and DP107

[0062]A. DP178 Peptides

[0063]The DP178 peptide corresponds to amino acid residues 638 to 673 of the transmembrane protein gp41 from the HIV-1LAI isolate, and has the 36 amino acid sequence (reading from amino to carboxy terminus):

TABLE-US-00004 (SEQ ID NO: 1) NH2-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-COOH

[0064]In addition to the full-length DP178 36-mer, the peptides of this invention include truncations of the DP178 peptide comprising peptides of between 3 and 36 amino acid residues (i.e., peptides ranging in size from a tripeptide to a 36-mer polypeptide), These truncated peptides are shown in Tables 2 and 3.

[0065]In addition amino acid substitutions of the DP178 peptide are also within the scope of the invention. HIV-1 and HIV-2 enveloped proteins are structurally distinct, but there exists a striking amino acid conservation within the DP178-corresponding regions of HIV-1 and HIV-2. The amino acid conservation is of a periodic nature, suggesting some conservation of structure and/or function. Therefore, one possible class of amino acid substitutions would include those amino acid changes which are predicted to stabilize the structure of the DP178 peptides of the invention. Utilizing the DP178 and DP178 analog sequences described herein, the skilled artisan can readily compile DP178 consensus sequences and ascertain from these, conserved amino acid residues which would represent preferred amino acid substitutions.

[0066]The amino acid substitutions may be of a conserved or non-conserved nature. Conserved amino acid substitutions consist of replacing one or more amino acids of the DP178 peptide sequence with amino acids of similar charge, size, and/or hydrophobicity characteristics, such as, for example, a glutamic acid (E) to aspartic acid (D) amino acid substitution. Non-conserved substitutions consist of replacing one or more amino acids of the DP178 peptide sequence with amino acids possessing dissimilar charge, size, and/or hydrophobicity characteristics, such as, for example, a glutamic acid (E) to valine (V) substitution.

[0067]Amino acid insertions of DP178 may consist of single amino acid residues or stretches of residues. The insertions may be made at the carboxy or amino terminal end of the DP178 or DP178 truncated peptides, as well as at a position internal to the peptide.

[0068]Such insertions will generally range from 2 to 15 amino acids in length. It is contemplated that insertions made at either the carboxy or amino terminus of the peptide of interest may be of a broader size range, with about 2 to about 50 amino acids being preferred. One or more such insertions may be introduced into DP178 or DP178 truncations, as long as such insertions result in peptides which may still be recognized by the 107×178×4, ALLMOTI5 or PLZIP search motifs described above.

[0069]Preferred amino or carboxy terminal insertions are peptides ranging from about 2 to about 50 amino acid residues in length, corresponding to gp41 protein regions either amino to or carboxy to the actual DP178 gp41 amino acid sequence, respectively. Thus, a preferred amino terminal or carboxy terminal amino acid insertion would contain gp41 amino acid sequences found immediately amino to or carboxy to the DP178 region of the gp41 protein.

[0070]Deletions of DP178 or DP178 truncations are also within the scope of this invention. Such deletions consist of the removal of one or more amino acids from the DP178 or DP178-like peptide sequence, with the lower limit length of the resulting peptide sequence being 4 to 6 amino acids.

[0071]Such deletions may involve a single contiguous or greater than one discrete portion of the peptide sequences. One or more such deletions may be introduced into DP178 or DP178 truncations, as long as such deletions result in peptides which may still be recognized by the 107×178×4, ALLMOTI5 or PLZIP search motifs described above.

[0072]B. DP107 Peptides

[0073]DP107 is a 38 amino acid peptide which exhibits potent antiviral activity, and corresponds to residues 558 to 595 of HIV-1LAI isolate transmembrane (TM) gp41 glycoprotein, as shown here:

TABLE-US-00005 (SEQ ID NO: 2) NH2-NNLLRAIEAQQHLLQLTVWQIKQLQARILAVERYLKDQ-COOH

[0074]In addition to the full-length DP107 38-mer, the DP107 peptides include truncations of the DP107 peptide comprising peptides of between 3 and 38 amino acid residues (i.e., peptides ranging in size from a tripeptide to a 38-mer polypeptide), These peptides are shown in Tables 4 and 5, below.

[0075]In addition, amino acid substitutions of the DP178 peptide are also within the scope of the invention. As for DP178, there also exists a striking amino acid conservation within the DP107-corresponding regions of HIV-1 and HIV-2, again of a periodic nature, suggesting conservation of structure and/or function. Therefore, one possible class of amino acid substitutions includes those amino acid changes predicted to stabilize the structure of the DP107 peptides of the invention. Utilizing the DP107 and DP107 analog sequences described herein, the skilled artisan can readily compile DP107 consensus sequences and ascertain from these, conserved amino acid residues which would represent preferred amino acid substitutions.

[0076]The amino acid substitutions may be of a conserved or non-conserved nature. Conserved amino acid substitutions consist of replacing one or more amino acids of the DP107 peptide sequence with amino acids of similar charge, size, and/or hydrophobicity characteristics, such as, for example, a glutamic acid (E) to aspartic acid (D) amino acid substitution. Non-conserved substitutions consist of replacing one or more amino acids of the DP107 peptide sequence with amino acids possessing dissimilar charge, size, and/or hydrophobicity characteristics, such as, for example, a glutamic acid (E) to valine (V) substitution.

[0077]Amino acid insertions may consist of single amino acid residues or stretches of residues. The insertions may be made at the carboxy or amino terminal end of the DP107 or DP107 truncated peptides, as well as at a position internal to the peptide.

[0078]Such insertions will generally range from 2 to 15 amino acids in length. It is contemplated that insertions made at either the carboxy or amino terminus of the peptide of interest may be of a broader size range, with about 2 to about 50 amino acids being preferred. One or more such insertions may be introduced into DP107 or DP107 truncations, as long as such insertions result in peptides which may still be recognized by the 107×178×4, ALLMOTI5 or PLZIP search motifs described above.

[0079]Preferred amino or carboxy terminal insertions are peptides ranging from about 2 to about 50 amino acid residues in length, corresponding to gp41 protein regions either amino to or carboxy to the actual DP107 gp41 amino acid sequence, respectively. Thus, a preferred amino terminal or carboxy terminal amino acid insertion would contain gp41 amino acid sequences found immediately amino to or carboxy to the DP107 region of the gp41 protein.

[0080]Deletions of DP107 or DP107 truncations are also within the scope of this invention. Such deletions consist of the removal of one or more amino acids from the DP107 or DP107-like peptide sequence, with the lower limit length of the resulting peptide sequence being 4 to 6 amino acids.

[0081]Such deletions may involve a single contiguous or greater than one discrete portion of the peptide sequences. One or more such deletions may be introduced into DP107 or DP107 truncations, as long as such deletions result in peptides which may still be recognized by the 107×178×4, ALLMOTI5 or PLZIP search motifs.

[0082]DP107 and DP107 truncations are more fully described in U.S. Pat. No. 5,656,480, which is incorporated herein by reference in its entirety

2. DP107 and DP178 Analogs

[0083]Peptides corresponding to analogs of the DP178, DP178 truncations, DP107 and DP107 truncation sequences of the invention, described, above, may be found in other viruses, including, for example, non-HIV-1 enveloped viruses, non-enveloped viruses and other non-viral organisms.

[0084]Such DP178 and DP107 analogs may, for example, correspond to peptide sequences present in transmembrane ("TM") proteins of enveloped viruses and may, correspond to peptide sequences present in non enveloped and nonviral organisms. Such peptides may exhibit antifusogenic activity, antiviral activity, most particularly antiviral activity which is specific to the virus in which their native sequences are found, or may exhibit an ability to modulate intracellular processes involving coiled-coil peptide structures.

[0085]A. DP178 Analogs

[0086]DP178 analogs are peptides whose amino acid sequences are comprised of the amino acid sequences of peptide regions of, for example, other (i.e., other than HIV-1) viruses that correspond to the gp41 peptide region from which DP178 was derived. Such viruses may include, but are not limited to, other HIV-1 isolates and HIV-2 isolates.

[0087]DP178 analogs derived from the corresponding gp41 peptide region of other (i.e., non HIV-1LAI) HIV-1 isolates may include, for example, peptide sequences as shown below.

TABLE-US-00006 (SEQ ID NO: 3) NH2-YTNTIYTLLEESQNQQEKNEQELLELDKWASLWNWF-COOH (SEQ ID NO: 4) NH2-YTGIIYNLLEESQNQQEKNEQELLELDKWANLWNWF-COOH (SEQ ID NO: 5) NH2-YTSLIYSLLEKSQIQQEKNEQELLELDKWASLWNWF-COOH

[0088]The peptides of SEQ ID NO:3, SEQ ID NO:4 and SEQ ID NO:5 are derived from HIV-1SF2, HIV-1RF, and HIV-1MN, respectively. Other DP178 analogs include those derived from HIV-2, including the peptides of SEQ ID NO:6 and SEQ ID NO:7, which are derived from HIV-2ROD and HIV-2NIHZ, respectively. Still other useful analogs include the peptides of SEQ ID NO:8 and SEQ ID NO:9, which have been demonstrated to exhibit anti-viral activity.

[0089]In the present invention, it is preferred that the DP178 analogs represent peptides whose amino acid sequences correspond to the DP178 region of the gp41 protein, it is also contemplated that the peptides disclosed herein may, additionally, include amino sequences, ranging from about 2 to about 50 amino acid residues in length, corresponding to gp41 protein regions either amino to or carboxy to the actual DP178 amino acid sequence.

[0090]Table 6 and Table 7 show some possible truncations of the HIV-2NIHZ DP178 analog, which may comprise peptides of between 3 and 36 amino acid residues (i.e., peptides ranging in size from a tripeptide to a 36-mer polypeptide). Peptide sequences in these tables are listed from amino (left) to carboxy (right) terminus.

[0091]B. Additional DP178 Analogs and DP107 Analogs

[0092]DP178 and DP107 analogs are recognized or identified, for example, by utilizing one or more of the 107×178×4, ALLMOTI5 or PLZIP computer-assisted search strategies described above. The search strategy identifies additional peptide regions which are predicted to have structural and/or amino acid sequence features similar to those of DP107 and/or DP178.

[0093]The search strategies are described fully in the example presented in Section 9 of U.S. Pat. Nos. 6,013,263, 6,017,536 and 6,020,459. While this search strategy is based, in part, on a primary amino acid motif deduced from DP107 and DP178, it is not based solely on searching for primary amino acid sequence homologies, as such protein sequence homologies exist within, but not between major groups of viruses. For example, primary amino acid sequence homology is high within the TM protein of different strains of HIV-1 or within the TM protein of different isolates of simian immunodeficiency virus (SIV).

[0094]The computer search strategy disclosed in U.S. Pat. Nos. 6,013,263, 6,017,536 and 6,020,459 successfully identified regions of proteins similar to DP107 or DP178. This search strategy was designed to be used with a commercially-available sequence database package, preferably PC/Gene.

[0095]In U.S. Pat. Nos. 6,013,263, 6,017,536 and 6,020,459, a series of search motifs, the 107×178×4, ALLMOTI5 and PLZIP motifs, were designed and engineered to range in stringency from strict to broad, with 107×178×4 being preferred. The sequences identified via such search motifs, such as those listed in Tables V-XIV, of U.S. Pat. Nos. 6,013,263, 6,017,536 and 6,020,459 and included in this application by incorporation by reference, potentially exhibit antifusogenic, such as antiviral, activity, may additionally be useful in the identification of antifusogenic, such as antiviral, compounds.

3. Other Anti-Viral Peptides

[0096]A. Anti-RSV Peptides

[0097]Anti-RSV peptides include DP178 and/or DP107 analogs identified from corresponding peptide sequences in RSV which have further been identified to inhibit viral infection by RSV. Such peptides of interest include the peptides of Table 16 and peptides of SEQ ID NO:10 to SEQ ID NO:30. Of particular interest are the following peptides:

TABLE-US-00007 YTSVITIELSNIKENKCNGAKVKLIKQELDKYK (SEQ ID NO: 14) TSVITIELSNIKENKCNGAKVKLIKQELDKYKN (SEQ ID NO: 15) VITIELSNIKENKCNGAKVKLIKQELDKYKNAV (SEQ ID NO: 16) IALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDK (SEQ ID NO: 29)

The peptide of SEQ ID NO:10 is derived from the F2 region of RSV and was identified in U.S. Pat. Nos. 6,103,236 and 6,020,459 using the search motifs described as corresponding to DP107 and DP178 peptides (i.e., "DP107/178 like"). The peptides of SEQ ID NO:14 to SEQ ID NO:16 each have amino acid sequences contained within the peptide of SEQ ID NO:10 and each has been shown to exhibit anti-RSV activity, in particular, inhibiting fusion and syncytia formation between RSV-infected and uninfected Hep-2 cells at concentrations of less than 50 μg/ml.

[0098]The peptide of SEQ ID NO:11 is derived from the F1 region of RSV and was identified in U.S. Pat. Nos. 6,103,236 and 6,020,459 using the search motifs described as corresponding to DP107 (i.e., "DP107-like"). The peptide of SEQ ID NO:29 contains amino acid sequences contained within the peptide of SEQ ID NO:10 and likewise has been shown to exhibit anti-RSV activity, in particular, inhibiting fusion and syncytia formation between RSV-infected and uninfected Hep-2 cells at concentrations of less than 50 μg/ml.

[0099]B. Anti-HPIV Peptides

[0100]Anti-HPIV peptides include DP178 and/or DP107 analogs identified from corresponding peptide sequences in HPIV and which have further been identified to inhibit viral infection by HPIV. Such peptides of interest include the peptides of Table 17 and SEQ ID NO:31 to SEQ ID NO:62. Of particular interest are the following peptides:

TABLE-US-00008 (SEQ ID NO: 52) VEAKQARSDIEKLKEAIRDTNKAVQSVQSSIGNLI (SEQ ID NO: 58) RSDIEKLKEAIRDTNKAVQSVQSSIGNLIVAIKSV (SEQ ID NO: 35) NSVALDPIDISIELNKAKSDLEESKEWIRRSNQKL (SEQ ID NO: 38) ALDPIDISIELNKAKSDLEESKEWIRRSNQKLDSI (SEQ ID NO: 39) LDPIDISIELNKAKSDLEESKEWIRRSNQKLDSIG (SEQ ID NO: 40) DPIDISIELNKAKSDLEESKEWIRRSNQKLDSIGN (SEQ ID NO: 41) PIDISIELNKAKSDLEESKEWIRRSNQKLDSIGNW (SEQ ID NO: 42) IDISIELNKAKSDLEESKEWIRRSNQKLDSIGNWH

[0101]The peptide of SEQ ID NO:31 is derived from the F1 region of HPIV-3 and was identified in U.S. Pat. Nos. 6,103,236 and 6,020,459 using the search motifs described as corresponding to DP107 (i.e., "DP107-like"). The peptides of SEQ ID NO:52 and SEQ ID NO:58 each have amino acid sequences contained within the peptide of SEQ ID NO:30 and each has been shown to exhibit anti-HPIV-3 activity, in particular, inhibiting fusion and syncytia formation between HPIV-3-infected Hep2 cells and uninfected CV-1W cells at concentrations of less than 1 μg/ml.

[0102]The peptide of SEQ ID NO:32 is also derived from the F1 region of HPIV-3 and was identified in U.S. Pat. Nos. 6,103,236 and 6,020,459 using the search motifs described as corresponding to DP178 (i.e., "DP178-like"). The peptides of SEQ ID NO:35 and SEQ ID NO:38 to SEQ ID NO:42 each have amino acid sequences contained within the peptide of SEQ ID NO:32 and each also has been shown to exhibit anti-HPIV-3 activity, in particular, inhibiting fusion and syncytia formation between HPIV-3-infected Hep2 cells and uninfected CV-1W cells at concentrations of less than 1 μg/ml.

[0103]C. Anti-MeV Peptides

[0104]Anti-MeV peptides are DP178 and/or DP107 analogs identified from corresponding peptide sequences in measles virus (MeV) which have further been identified to inhibit viral infection by the measles virus. Such peptides of particular interest include the peptides of Table 19 and peptides of SEQ ID NO:74 to SEQ ID NO:86. Of particular interest are the peptides listed below.

TABLE-US-00009 HRIDLGPPISLERLDVGTNLGNAIAKLEAKELLE (SEQ ID NO: 77) IDLGPPISLERLDVGTNLGNAIAKLEAKELLESS (SEQ ID NO: 79) LGPPISLERLDVGTNLGNAIAKLEAKELLESSDQ (SEQ ID NO: 81) PISLERLDVGTNLGNAIAKLEAKELLESSDQILR (SEQ ID NO: 84)

Sequences derived from measles virus were identified in U.S. Pat. Nos. 6,103,236 and 6,020,459 using the search motifs described as corresponding to DP178 (i.e., "DP178-like"). The peptides of SEQ ID NO:77, SEQ ID NO:79, SEQ ID NO:81 and SEQ ID NO:83 each have amino acid sequences so identified, and each has been shown to exhibit anti-MeV activity, in particular, inhibiting fusion and syncytia formation between MeV-infected Hep2 and uninfected Vero cells at concentrations of less than 1 μg/ml.

[0105]D. Anti-SIV Peptides

[0106]Anti-SIV peptides are DP178 and/or DP107 analogs identified from corresponding peptide sequences in SIV which have further been identified to inhibit viral infection by SIV. Such peptides of interest include the peptides of Table 18 and peptides of SEQ ID NO:63 to SEQ ID NO:73. Of particular interest are the following peptides:

TABLE-US-00010 (SEQ ID NO: 64) WQEWERKVDFLEENITALLEEAQIQQEKNMYELQK (SEQ ID NO: 65) QEWERKVDFLEENITALLEEAQIQQEKNMYELQKL (SEQ ID NO: 66) EWERKVDFLEENITALLEEAQIQQEKNMYELQKLN (SEQ ID NO: 67) WERKVDFLEENITALLEEAQIQQEKNMYELQKLNS (SEQ ID NO: 68) ERKVDFLEENITALLEEAQIQQEKNMYELQKLNSW (SEQ ID NO: 69) RKVDFLEENITALLEEAQIQQEKNMYELQKLNSWD (SEQ ID NO: 70) KVDFLEENITALLEEAQIQQEKNMYELQKLNSWDV (SEQ ID NO: 71) VDFLEENITALLEEAQIQQEKNMYELQKLNSWDVF (SEQ ID NO: 72) DFLEENITALLEEAQIQQEKNMYELQKLNSWDVFG (SEQ ID NO: 73) FLEENITALLEEAQIQQEKNMYELQKLNSWDVFGN

Sequences derived from SIV transmembrane fusion protein were identified in U.S. Pat. Nos. 6,103,236 and 6,020,459 using the search motifs described as corresponding to DP178 (i.e., "DP178-like"). The peptides of SEQ ID NO:64 to SEQ ID NO:73 each have amino acid sequences so identified, and each has been shown to exhibit potent anti-SIV activity as crude peptides.

4. Modification of Anti-Viral and Antifusogenic Peptides

[0107]The invention contemplates modifying peptides that exhibit anti-viral and/or antifusogenic activity, including such modifications of DP-107 and DP-178 and analogs thereof. Such modified peptides can react with the available reactive functionalities on blood components via covalent linkages. The invention also relates to such modifications, such combinations with blood components, and methods for their use. These methods include extending the effective therapeutic life of the conjugated anti-viral peptides derivatives as compared to administration of the unconjugated peptides to a patient. The modified peptides are of a type designated as a DAC (Drug Affinity Complex) which comprises the anti-viral peptide molecule and a linking group together with a chemically reactive group capable of reaction with a reactive functionality of a mobile blood protein. By reaction with the blood component or protein the modified peptide, or DAC, may be delivered via the blood to appropriate sites or receptors.

[0108]To form covalent bonds with functionalities on the protein, one may use as a reactive group a wide variety of active carboxyl groups, particularly esters, where the hydroxyl moiety is physiologically acceptable at the levels required to modify the peptide. While a number of different hydroxyl groups may be employed in these reactive groups, the most convenient would be N-hydroxysuccinimide or (NHS), N-hydroxy-sulfosuccinimide (sulfo-NHS). In preferred embodiments of this invention, the functionality on the protein will be a thiol group and the reactive group will be a maleimido-containing group such as gamma-maleimide-butyralamide (GMBA) or maleimidopropionic acid (MPA)

[0109]Primary amines are the principal targets for NHS esters. Accessible α-amine groups present on the N-termini of proteins react with NHS esters. However, α-amino groups on a protein may not be desirable or available for the NHS coupling. While five amino acids have nitrogen in their side chains, only the ε-amine of lysine reacts significantly with NHS esters. An amide bond is formed when the NHS ester conjugation reaction reacts with primary amines releasing N-hydroxysuccinimide as demonstrated in the schematic below.

[0110]In the preferred embodiments of this invention, the functional group on this protein will be a thiol group and the chemically reactive group will be a maleimido-containing group such as MPA or GMBA (gamma-maleimide-butyralamide). The maleimido group is most selective for sulfhydryl groups on peptides when the pH of the reaction mixture is kept between 6.5 and 7.4. At pH 7.0, the rate of reaction of maleimido groups with sulfhydryls is 1000-fold faster than with amines. A stable thioether linkage between the maleimido group and the sulfhydryl is formed which cannot be cleaved under physiological conditions, as demonstrated in the following schematic.

[0111]A. Specific Labeling.

[0112]Preferably, the modified peptides of this invention are designed to specifically react with thiol groups on mobile blood proteins. Such reaction is preferably established by covalent bonding of the peptide modified with a maleimide link (e.g. prepared from GMBS, MPA or other maleimides) to a thiol group on a mobile blood protein such as serum albumin or IgG.

[0113]Under certain circumstances, specific labeling with maleimides offers several advantages over non-specific labeling of mobile proteins with groups such as NHS and sulfo-NHS. Thiol groups are less abundant in vivo than amino groups. Therefore, the maleimide-modified peptides of this invention, i.e., maleimide peptides, will covalently bond to fewer proteins. For example, in albumin (the most abundant blood protein) there is only a single thiol group. Thus, peptide-maleimide-albumin conjugates will tend to comprise approximately a 1:1 molar ratio of peptide to albumin. In addition to albumin, IgG molecules (class II) also have free thiols. Since IgG molecules and serum albumin make up the majority of the soluble protein in blood they also make up the majority of the free thiol groups in blood that are available to covalently bond to maleimide-modified peptides.

[0114]Further, even among free thiol-containing blood proteins, including IgGs, specific labeling with maleimides leads to the preferential formation of peptide-maleimide-albumin conjugates, due to the unique characteristics of albumin itself. The single free thiol group of albumin, highly conserved among species, is located at amino acid residue 34 (Cys34). It has been demonstrated recently that the Cys34 of albumin has increased reactivity relative to free thiols on other free thiol-containing proteins. This is due in part to the very low pK value of 5.5 for the Cys34 of albumin. This is much lower than typical pK values for cysteine residues in general, which are typically about 8. Due to this low pK, under normal physiological conditions Cys34 of albumin is predominantly in the ionized form, which dramatically increases its reactivity. In addition to the low pK value of Cys34, another factor which enhances the reactivity of Cys34 is its location, which is in a crevice close to the surface of one loop of region V of albumin. This location makes Cys34 very available to ligands of all kinds, and is an important factor in Cys34's biological role as free radical trap and free thiol scavenger. These properties make Cys34 highly reactive with maleimide-peptides, and the reaction rate acceleration can be as much as 1000-fold relative to rates of reaction of maleimide-peptides with other free-thiol containing proteins.

[0115]Another advantage of peptide-maleimide-albumin conjugates is the reproducibility associated with the 1:1 loading of peptide to albumin specifically at Cys34. Other techniques, such as glutaraldehyde, DCC, EDC and other chemical activations of, e.g, free amines, lack this selectivity. For example, albumin contains 52 lysine residues, 25-30 of which are located on the surface of albumin and therefore accessible for conjugation. Activating these lysine residues, or alternatively modifying peptides to couple through these lysine residues, results in a heterogenous population of conjugates. Even if 1:1 molar ratios of peptide to albumin are employed, the yield will consist of multiple conjugation products, some containing 0, 1, 2 or more peptides per albumin, and each having peptides randomly coupled at any one or more of the 25-30 available lysine sites. Given the numerous possible combinations, characterization of the exact composition and nature of each conjugate batch becomes difficult, and batch-to-batch reproducibility is all but impossible, making such conjugates less desirable as a therapeutic. Additionally, while it would seem that conjugation through lysine residues of albumin would at least have the advantage of delivering more therapeutic agent per albumin molecule, studies have shown that a 1:1 ratio of therapeutic agent to albumin is preferred. In an article by Stehle, et al., "The Loading Rate Determines Tumor Targeting properties of Methotrexate-Albumin Conjugates in Rats," Anti-Cancer Drugs, Vol. 8, pp. 677-685 (1988), incorporated herein in its entirety, the authors report that a 1:1 ratio of the anti-cancer methotrexate to albumin conjugated via glutaraldehyde gave the most promising results. These conjugates were preferentially taken up by tumor cells, whereas conjugates bearing 5:1 to 20:1 methotrexate molecules had altered HPLC profiles and were quickly taken up by the liver in vivo. It is postulated that at these higher ratios, conformational changes to albumin diminish its effectiveness as a therapeutic carrier.

[0116]Through controlled administration of maleimide-peptides in vivo, one can control the specific labeling of albumin and IgG in vivo. In typical administrations, 80-90% of the administered maleimide-peptides will label albumin and less than 5% will label IgG. Trace labeling of free thiols such as glutathione will also occur. Such specific labeling is preferred for in vivo use as it permits an accurate calculation of the estimated half-life of the administered agent.

[0117]In addition to providing controlled specific in vivo labeling, maleimide-peptides can provide specific labeling of serum albumin and IgG ex vivo. Such ex vivo labeling involves the addition of maleimide-peptides to blood, serum or saline solution containing serum albumin and/or IgG. Once conjugation has occurred ex vivo with the maleimide-peptides, the blood, serum or saline solution can be readministered to the patient's blood for in vivo treatment.

[0118]In contrast to NHS-peptides, maleimide-peptides are generally quite stable in the presence of aqueous solutions and in the presence of free amines. Since maleimide-peptides will only react with free thiols, protective groups are generally not necessary to prevent the maleimide-peptides from reacting with itself. In addition, the increased stability of the modified peptide permits the use of further purification steps such as HPLC to prepare highly purified products suitable for in vivo use. Lastly, the increased chemical stability provides a product with a longer shelf life.

[0119]B. Non-Specific Labeling.

[0120]The anti-viral peptides of the invention may also be modified for non-specific labeling of blood components. Bonds to amino groups will also be employed, particularly with the formation of amide bonds for non-specific labeling. To form such bonds, one may use as a chemically reactive group a wide variety of active carboxyl groups, particularly esters, where the hydroxyl moiety is physiologically acceptable at the levels required. While a number of different hydroxyl groups may be employed in these linking agents, the most convenient would be N-hydroxysuccinimide (NHS) and N-hydroxy-sulfosuccinimide (sulfo-NHS).

[0121]Other linking agents which may be utilized are described in U.S. Pat. No. 5,612,034, which is hereby incorporated herein.

[0122]The various sites with which the chemically reactive group of the modified peptides may react in vivo include cells, particularly red blood cells (erythrocytes) and platelets, and proteins, such as immunoglobulins, including IgG and IgM, serum albumin, ferritin, steroid binding proteins, transferrin, thyroxin binding protein, α-2-macroglobulin, and the like. Those receptors with which the modified peptides react, which are not long-lived, will generally be eliminated from the human host within about three days. The proteins indicated above (including the proteins of the cells) will remain at least three days, and may remain five days or more (usually not exceeding 60 days, more usually not exceeding 30 days) particularly as to the half life, based on the concentration in the blood.

[0123]For the most part, reaction will be with mobile components in the blood, particularly blood proteins and cells, more particularly blood proteins and erythrocytes. By "mobile" is intended that the component does not have a fixed situs for any extended period of time, generally not exceeding 5 minutes, more usually one minute, although some of the blood component may be relatively stationary for extended periods of time. Initially, there will be a relatively heterogeneous population of functionalized proteins and cells. However, for the most part, the population within a few days will vary substantially from the initial population, depending upon the half-life of the functionalized proteins in the blood stream. Therefore, usually within about three days or more, IgG will become the predominant functionalized protein in the blood stream.

[0124]Usually, by day 5 post-administration, IgG, serum albumin and erythrocytes will be at least about 60 mole %, usually at least about 75 mole %, of the conjugated components in blood, with IgG, IgM (to a substantially lesser extent) and serum albumin being at least about 50 mole %, usually at least about 75 mole %, more usually at least about 80 mole %, of the non-cellular conjugated components.

[0125]The desired conjugates of non-specific modified peptides to blood components may be prepared in vivo by administration of the modified peptides to the patient, which may be a human or other mammal. The administration may be done in the form of a bolus or introduced slowly over time by infusion using metered flow or the like.

[0126]If desired, the subject conjugates may also be prepared ex vivo by combining blood with modified peptides of the present invention, allowing covalent bonding of the modified peptides to reactive functionalities on blood components and then returning or administering the conjugated blood to the host. Moreover, the above may also be accomplished by first purifying an individual blood component or limited number of components, such as red blood cells, immunoglobulins, serum albumin, or the like, and combining the component or components ex vivo with the chemically reactive modified peptides. The functionalized blood or blood component may then be returned to the host to provide in vivo the subject therapeutically effective conjugates. The blood also may be treated to prevent coagulation during handling ex vivo.

5. Synthesis of Modified Anti-Viral and Anti-Fusogenic Peptides

[0127]A. Peptide Synthesis

[0128]Anti-viral and/or anti-fusogenic peptides according to the present invention may be synthesized by standard methods of solid phase peptide chemistry known to those of ordinary skill in the art. For example, peptides may be synthesized by solid phase chemistry techniques following the procedures described by Steward and Young (Steward, J. M. and Young, J. D., Solid Phase Peptide Synthesis, 2nd Ed., Pierce Chemical Company, Rockford, Ill., (1984) using an Applied Biosystem synthesizer. Similarly, multiple peptide fragments may be synthesized then linked together to form larger peptides. These synthetic peptides can also be made with amino acid substitutions at specific locations.

[0129]For solid phase peptide synthesis, a summary of the many techniques may be found in J. M. Stewart and J. D. Young, Solid Phase Peptide Synthesis, W. H. Freeman Co. (San Francisco), 1963 and J. Meienhofer, Hormonal Proteins and Peptides, vol. 2, p. 46, Academic Press (New York), 1973. For classical solution synthesis see G. Schroder and K. Lupke, The Peptides, Vol. 1, Acacemic Press (New York). In general, these methods comprise the sequential addition of one or more amino acids or suitably protected amino acids to a growing peptide chain. Normally, either the amino or carboxyl group of the first amino acid is protected by a suitable protecting group. The protected or derivatized amino acid is then either attached to an inert solid support or utilized in solution by adding the next amino acid in the sequence having the complimentary (amino or carboxyl) group suitably protected and under conditions suitable for forming the amide linkage. The protecting group is then removed from this newly added amino acid residue and the next amino acid (suitably protected) is added, and so forth.

[0130]After all the desired amino acids have been linked in the proper sequence, any remaining protecting groups (and any solid support) are removed sequentially or concurrently to afford the final polypeptide. By simple modification of this general procedure, it is possible to add more than one amino acid at a time to a growing chain, for example, by coupling (under conditions which do not racemize chiral centers) a protected tripeptide with a properly protected dipeptide to form, after deprotection, a pentapeptide.

[0131]A particularly preferred method of preparing compounds of the present invention involves solid phase peptide synthesis wherein the amino acid α-N-terminal is protected by an acid or base sensitive group. Such protecting groups should have the properties of being stable to the conditions of peptide linkage formation while being readily removable without destruction of the growing peptide chain or racemization of any of the chiral centers contained therein. Suitable protecting groups are 9-fluorenylmethyloxycarbonyl (Fmoc), t-butyloxycarbonyl (Boc), benzyloxycarbonyl (Cbz), biphenylisopropyloxycarbonyl, t-amyloxycarbonyl, isobornyloxycarbonyl, α,α-dimethyl-3,5-dimethoxybenzyloxycarbonyl, o-nitrophenylsulfenyl, 2-cyano-t-butyloxycarbonyl, and the like. The 9-fluorenyl-methyloxycarbonyl (Fmoc) protecting group is particularly preferred for the synthesis of the peptides of the present invention. Other preferred side chain protecting groups are, for side chain amino groups like lysine and arginine, 2,2,5,7,8-pentamethylchroman-6-sulfonyl (pmc), nitro, p-toluenesulfonyl, 4-methoxybenzene-sulfonyl, Cbz, Boc, and adamantyloxycarbonyl; for tyrosine, benzyl, o-bromobenzyloxycarbonyl, 2,6-dichlorobenzyl, isopropyl, t-butyl (t-Bu), cyclohexyl, cyclopenyl and acetyl (Ac); for serine, t-butyl, benzyl and tetrahydropyranyl; for histidine, trityl, benzyl, Cbz, p-toluenesulfonyl and 2,4-dinitrophenyl; for tryptophan, formyl; for asparticacid and glutamic acid, benzyl and t-butyl and for cysteine, triphenylmethyl (trityl).

[0132]In the solid phase peptide synthesis method, the α-C-terminal amino acid is attached to a suitable solid support or resin. Suitable solid supports useful for the above synthesis are those materials which are inert to the reagents and reaction conditions of the stepwise condensation-deprotection reactions, as well as being insoluble in the media used. The preferred solid support for synthesis of α-C-terminal carboxy peptides is 4-hydroxymethylphenoxymethyl-copoly(styrene-1% divinylbenzene). The preferred solid support for α-C-terminal amide peptides is the 4-(2',4'-dimethoxyphenyl-Fmoc-aminomethyl)phenoxyacetamidoethyl resin available from Applied Biosystems (Foster City, Calif.). The α-C-terminal amino acid is coupled to the resin by means of N,N'-dicyclohexylcarbodiimide (DCC), N,N'-diisopropylcarbodiimide (DIC) or O-benzotriazol-1-yl-N,N,N',N'-tetramethyluronium-hexafluorophosphate (HBTU), with or without 4-dimethylaminopyridine (DMAP), 1-hydroxybenzotriazole (HOBT), benzotriazol-1-yloxy-tris(dimethylamino)phosphonium-hexafluorophosphate (BOP) or bis(2-oxo-3-oxazolidinyl)phosphine chloride (BOPCl), mediated coupling for from about 1 to about 24 hours at a temperature of between 10° and 50° C. in a solvent such as dichloromethane or DMF.

[0133]When the solid support is 4-(2',4'-dimethoxyphenyl-Fmoc-aminomethyl)phenoxy-acetamidoethyl resin, the Fmoc group is cleaved with a secondary amine, preferably piperidine, prior to coupling with the α-C-terminal amino acid as described above. The preferred method for coupling to the deprotected 4-(2',4'-dimethoxyphenyl-Fmoc-aminomethyl)phenoxy-acetamidoethyl resin is O-benzotriazol-1-yl-N,N,N',N'-tetramethyluroniumhexafluoro-phosphate (HBTU, 1 equiv.) and 1-hydroxybenzotriazole (HOBT, 1 equiv.) in DMF. The coupling of successive protected amino acids can be carried out in an automatic polypeptide synthesizer as is well known in the art. In a preferred embodiment, the α-N-terminal amino acids of the growing peptide chain are protected with Fmoc. The removal of the Fmoc protecting group from the α-N-terminal side of the growing peptide is accomplished by treatment with a secondary amine, preferably piperidine. Each protected amino acid is then introduced in about 3-fold molar excess, and the coupling is preferably carried out in DMF. The coupling agent is normally O-benzotriazol-1-yl-N,N,N',N'-tetramethyluroniumhexafluorophosphate (HBTU, 1 equiv.) and 1-hydroxybenzotriazole (HOBT, 1 equiv.).

[0134]At the end of the solid phase synthesis, the polypeptide is removed from the resin and deprotected, either in successively or in a single operation. Removal of the polypeptide and deprotection can be accomplished in a single operation by treating the resin-bound polypeptide with a cleavage reagent comprising thioanisole, water, ethanedithiol and trifluoroacetic acid. In cases wherein the α-C-terminal of the polypeptide is an alkylamide, the resin is cleaved by aminolysis with an alkylamine. Alternatively, the peptide may be removed by transesterification, e.g. with methanol, followed by aminolysis or by direct transamidation. The protected peptide may be purified at this point or taken to the next step directly. The removal of the side chain protecting groups is accomplished using the cleavage cocktail described above. The fully deprotected peptide is purified by a sequence of chromatographic steps employing any or all of the following types: ion exchange on a weakly basic resin (acetate form); hydrophobic adsorption chromatography on underivitized polystyrene-divinylbenzene (for example, Amberlite XAD); silica gel adsorption chromatography; ion exchange chromatography on carboxymethylcellulose; partition chromatography, e.g. on Sephadex G-25, LH-20 or countercurrent distribution; high performance liquid chromatography (HPLC), especially reverse-phase HPLC on octyl- or octadecylsilyl-silica bonded phase column packing.

[0135]Molecular weights of these ITPs are determined using Fast Atom Bombardment (FAB) Mass Spectroscopy.

(1) N-Terminal Protective Groups

[0136]As discussed above, the term "N-protecting group" refers to those groups intended to protect the α-N-terminal of an amino acid or peptide or to otherwise protect the amino group of an amino acid or peptide against undesirable reactions during synthetic procedures. Commonly used N-protecting groups are disclosed in Greene, "Protective Groups In Organic Synthesis," (John Wiley & Sons, New York (1981)), which is hereby incorporated by reference. Additionally, protecting groups can be used as pro-drugs which are readily cleaved in vivo, for example, by enzymatic hydrolysis, to release the biologically active parent. α-N-protecting groups comprise loweralkanoyl groups such as formyl, acetyl ("Ac"), propionyl, pivaloyl, t-butylacetyl and the like; other acyl groups include 2-chloroacetyl, 2-bromoacetyl, trifluoroacetyl, trichloroacetyl, phthalyl, o-nitrophenoxyacetyl, -chlorobutyryl, benzoyl, 4-chlorobenzoyl, 4-bromobenzoyl, 4-nitrobenzoyl and the like; sulfonyl groups such as benzenesulfonyl, p-toluenesulfonyl and the like; carbamate forming groups such as benzyloxycarbonyl, p-chlorobenzyloxycarbonyl, p-methoxybenzyloxycarbonyl, p-nitrobenzyloxycarbonyl, 2-nitrobenzyloxycarbonyl, p-bromobenzyloxycarbonyl, 3,4-dimethoxybenzyloxycarbonyl, 3,5-dimethoxybenzyloxycarbonyl, 2,4-dimethoxybenzyloxycarbonyl, 4-ethoxybenzyloxycarbonyl, 2-nitro-4,5-dimethoxybenzyloxycarbonyl, 3,4,5-trimethoxybenzyloxycarbonyl, 1-(p-biphenylyl)-1-methylethoxycarbonyl, α,α-dimethyl-3,5-dimethoxybenzyloxycarbonyl, benzhydryloxycarbonyl, t-butyloxycarbonyl (Boc), diisopropylmethoxycarbonyl, isopropyloxycarbonyl, ethoxycarbonyl, methoxycarbonyl, allyloxycarbonyl, 2,2,2,-trichloroethoxycarbonyl, phenoxycarbonyl, 4-nitrophenoxycarbonyl, fluorenyl-9-methoxycarbonyl, cyclopentyloxycarbonyl, adamantyloxycarbonyl, cyclohexyloxycarbonyl, phenylthiocarbonyl and the like; arylalkyl groups such as benzyl, triphenylmethyl, benzyloxymethyl, 9-fluorenylmethyloxycarbonyl (Fmoc) and the like and silyl groups such as trimethylsilyl and the like.

(2) Carboxy Protective Groups

[0137]As discussed above, the term "carboxy protecting group" refers to a carboxylic acid protecting ester or amide group employed to block or protect the carboxylic acid functionality while the reactions involving other functional sites of the compound are performed. Carboxy protecting groups are disclosed in Greene, "Protective Groups in Organic Synthesis" pp. 152-186 (1981), which is hereby incorporated by reference. Additionally, a carboxy protecting group can be used as a pro-drug whereby the carboxy protecting group can be readily cleaved in vivo, for example by enzymatic hydrolysis, to release the biologically active parent. Such carboxy protecting groups are well known to those skilled in the art, having been extensively used in the protection of carboxyl groups in the penicillin and cephalosporin fields as described in U.S. Pat. Nos. 3,840,556 and 3,719,667, the disclosures of which are hereby incorporated herein by reference. Representative carboxy protecting groups are C1-C8 loweralkyl (e.g., methyl, ethyl or t-butyl and the like); arylalkyl such as phenethyl or benzyl and substituted derivatives thereof such as alkoxybenzyl or nitrobenzyl groups and the like; arylalkenyl such as phenylethenyl and the like; aryl and substituted derivatives thereofsuch as 5-indanyl and the like; dialkylaminoalkyl such as dimethylaminoethyl and the like); alkanoyloxyalkyl groups such as acetoxymethyl, butyryloxymethyl, valeryloxymethyl, isobutyryloxymethyl, isovaleryloxymethyl, 1-(propionyloxy)-1-ethyl, 1-(pivaloyloxyl)-1-ethyl, 1-methyl-1-(propionyloxy)-1-ethyl, pivaloyloxymethyl, propionyloxymethyl and the like; cycloalkanoyloxyalkyl groups such as cyclopropylcarbonyloxymethyl, cyclobutylcarbonyloxymethyl, cyclopentylcarbonyloxymethyl, cyclohexylcarbonyloxymethyl and the like; aroyloxyalkyl such as benzoyloxymethyl, benzoyloxyethyl and the like; arylalkylcarbonyloxyalkyl such as benzylcarbonyloxymethyl, 2-benzylcarbonyloxyethyl and the like; alkoxycarbonylalkyl or cycloalkyloxycarbonylalkyl such as methoxycarbonylmethyl, cyclohexyloxycarbonylmethyl, 1-methoxycarbonyl-1-ethyl and the like; alkoxycarbonyloxyalkyl or cycloalkyloxycarbonyloxyalkyl such as methoxycarbonyloxymethyl, t-butyloxycarbonyloxymethyl, 1-ethoxycarbonyloxy-1-ethyl, 1-cyclohexyloxycarbonyloxy-1-ethyl and the like; aryloxycarbonyloxyalkyl such as 2-(phenoxycarbonyloxy)ethyl, 2-(5-indanyloxycarbonyloxy)ethyl and the like; alkoxyalkylcarbonyloxyalkyl such as 2-(1-methoxy-2-methylpropan-2-oyloxy)ethyl and like; arylalkyloxycarbonyloxyalkyl such as 2-(benzyloxycarbonyloxy)ethyl and the like; arylalkenyloxycarbonyloxyalkyl such as 2-(3-phenylpropen-2-yloxycarbonyloxy)ethyl and the like; alkoxycarbonylaminoalkyl such as t-butyloxycarbonylaminomethyl and the like; alkylaminocarbonylaminoalkyl such as methylaminocarbonylaminomethyl and the like; alkanoylaminoalkyl such as acetylaminomethyl and the like; heterocycliccarbonyloxyalkyl such as 4-methylpiperazinylcarbonyloxymethyl and the like; dialkylaminocarbonylalkyl such as dimethylaminocarbonylmethyl, diethylaminocarbonylmethyl and the like; (5-(loweralkyl)-2-oxo-1,3-dioxolen-4-yl)alkyl such as (5-t-butyl-2-oxo-1,3-dioxolen-4-yl)methyl and the like; and (5-phenyl-2-oxo-1,3-dioxolen-4-yl)alkyl such as (5-phenyl-2-oxo-1,3-dioxolen-4-yl)methyl and the like.

[0138]Representative amide carboxy protecting groups are aminocarbonyl and loweralkylaminocarbonyl groups.

[0139]Preferred carboxy-protected compounds of the invention are compounds wherein the protected carboxy group is a loweralkyl, cycloalkyl or arylalkyl ester, for example, methyl ester, ethyl ester, propyl ester, isopropyl ester, butyl ester, sec-butyl ester, isobutyl ester, amyl ester, isoamyl ester, octyl ester, cyclohexyl ester, phenylethyl ester and the like or an alkanoyloxyalkyl, cycloalkanoyloxyalkyl, aroyloxyalkyl or an arylalkylcarbonyloxyalkyl ester. Preferred amide carboxy protecting groups are loweralkylaminocarbonyl groups. For example, aspartic acid may be protected at the α-C-terminal by an acid labile group (e.g. t-butyl) and protected at the β-C-terminal by a hydrogenation labile group (e.g. benzyl) then deprotected selectively during synthesis.

[0140]B. Peptide Modification

[0141]The manner of producing the modified peptides of the present invention will vary widely, depending upon the nature of the various elements comprising the peptide. The synthetic procedures will be selected so as to be simple, provide for high yields, and allow for a highly purified stable product. Normally, the chemically reactive group will be created at the last stage of the synthesis, for example, with a carboxyl group, esterification to form an active ester. Specific methods for the production of modified peptides of the present invention are described below.

[0142]Specifically, the selected peptide is first assayed for anti-viral activity, and then is modified with the linking group only at either the N-terminus, C-terminus or interior of the peptide. The anti-viral activity of this modified peptide-linking group is then assayed. If the anti-viral activity is not reduced dramatically (i.e., reduced less than 10-fold), then the stability of the modified peptide-linking group is measured by its in vivo lifetime. If the stability is not improved to a desired level, then the peptide is modified at an alternative site, and the procedure is repeated until a desired level of anti-viral and stability is achieved.

[0143]More specifically, each peptide selected to undergo modification with a linker and a reactive entity group will be modified according to the following criteria: if a terminal carboxylic group is available on the peptide and is not critical for the retention of anti-viral activity, and no other sensitive functional group is present on the peptide, then the carboxylic acid will be chosen as attachment point for the linker-reactive group modification. If the terminal carboxylic group is involved in anti-viral activity, or if no carboxylic acids are available, then any other sensitive functional group not critical for the retention of anti-viral activity will be selected as the attachment point for the linker-reactive entity modification. If several sensitive functional groups are available on a a peptide, a combination of protecting groups will be used in such a way that after addition of the linker/reactive entity and deprotection of all the protected sensitive functional groups, retention of anti-viral activity is still obtained. If no sensitive functional groups are available on the peptide, or if a simpler modification route is desired, synthetic efforts will allow for a modification of the original peptide in such a way that retention of anti-viral is maintained. In this case the modification will occur at the opposite end of the peptide

[0144]An NHS derivative may be synthesized from a carboxylic acid in absence of other sensitive functional groups in the peptide. Specifically, such a peptide is reacted with N-hydroxysuccinimide in anhydrous CH2Cl2 and EDC, and the product is purified by chromatography or recrystallized from the appropriate solvent system to give the NHS derivative.

[0145]Alternatively, an NHS derivative may be synthesized from a peptide that contains an amino and/or thiol group and a carboxylic acid. When a free amino or thiol group is present in the molecule, it is preferable to protect these sensitive functional groups prior to perform the addition of the NHS derivative. For instance, if the molecule contains a free amino group, a transformation of the amine into a Fmoc or preferably into a tBoc protected amine is necessary prior to perform the chemistry described above. The amine functionality will not be deprotected after preparation of the NHS derivative. Therefore this method applies only to a compound whose amine group is not required to be freed to induce the desired anti-viral effect. If the amino group needs to be freed to retain the original properties of the molecule, then another type of chemistry described below has to be performed.

[0146]In addition, an NHS derivative may be synthesized from a peptide containing an amino or a thiol group and no carboxylic acid. When the selected molecule contains no carboxylic acid, an array of bifunctional linkers can be used to convert the molecule into a reactive NHS derivative. For instance, ethylene glycol-bis(succinimydylsuccinate) (EGS) and triethylamine dissolved in DMF and added to the free amino containing molecule (with a ratio of 10:1 in favor of EGS) will produce the mono NHS derivative. To produce an NHS derivative from a thiol derivatized molecule, one can use N-[-maleimidobutyryloxy]succinimide ester (GMBS) and triethylamine in DMF. The maleimido group will react with the free thiol and the NHS derivative will be purified from the reaction mixture by chromatography on silica or by HPLC.

[0147]An NHS derivative may also be synthesized from a peptide containing multiple sensitive functional groups. Each case will have to be analyzed and solved in a different manner. However, thanks to the large array of protecting groups and bifunctional linkers that are commercially available, this invention is applicable to any peptide with preferably one chemical step only to modify the peptide (as described above) or two steps (as described above involving prior protection of a sensitive group) or three steps (protection, activation and deprotection). Under exceptional circumstances only, would multiple steps (beyond three steps) synthesis be required to transform a peptide into an active NHS or maleimide derivative.

[0148]A maleimide derivative may also be synthesized from a peptide containing a free amino group and a free carboxylic acid. To produce a maleimide derivative from a amino derivatized molecule, one can use N-[γ-maleimidobutyryloxy]succinimide ester (GMBS) and triethylamine in DMF. The succinimide ester group will react with the free amino and the maleimide derivative will be purified from the reaction mixture by crystallization or by chromatography on silica or by HPLC.

[0149]Finally, a maleimide derivative may be synthesized from a peptide containing multiple other sensitive functional groups and no free carboxylic acids. When the selected molecule contains no carboxylic acid, an array of bifunctional crosslinking reagents can be used to convert the molecule into a reactive NHS derivative. For instance maleimidopropionic acid (MPA) can be coupled to the free amine to produce a maleimide derivative through reaction of the free amine with the carboxylic group of MPA using HBTU/HOBt/DIEA activation in DMF.

[0150]Many other commercially available heterobifunctional crosslinking reagents can alternatively be used when needed. A large number of bifunctional compounds are available for linking to entities. Illustrative reagents include: azidobenzoyl hydrazide, N-[4-(p-azidosalicylamino)butyl]-3'-[2'-pyridyldithio)propionamide), bis-sulfosuccinimidyl suberate, dimethyl adipimidate, disuccinimidyl tartrate, N-y-maleimidobutyryloxysuccinimide ester, N-hydroxy sulfosuccinimidyl-4-azidobenzoate, N-succinimidyl [4-azidophenyl]-1,3'-dithiopropionate, N-succinimidyl [4-iodoacetyl]aminobenzoate, glutaraldehyde, and succinimidyl 4-[N-maleimidomethyl]cyclohexane-1-carboxylate.

6. Uses of Modified Anti-Viral Peptides

[0151]Modified anti-viral peptides of the invention may be used as a therapeutic agent in the treatment of patients who are suffering from viral infection, and can be administered to patients according to the methods described below and other methods known in the art. Effective therapeutic dosages of the modified peptides may be determined through procedures well known by those in the art and will take into consideration any concerns over potential toxicity of the peptide.

[0152]The modified peptides can also be administered prophylactically to previously uninfected individuals. This can be advantageous in cases where an individual has been subjected to a high risk of exposure to a virus, as can occur when individual has been in contact with an infected individual where there is a high risk of viral transmission. This can be expecially advantageous where there is known cure for the virus, such as the HIV virus. As a example, prophylactic administration of a modified anti-HIV peptide would be advantageous in a situation where a health care worker has been exposed to blood from an HIV-infected individual, or in other situations where an individual engaged in high-risk activities that potentially expose that individual to the HIV virus.

7. Administration of Modified Anti-Viral and Anti-Fusogenic Peptides

[0153]Generally, the modified peptides will be administered in a physiologically acceptable medium, e.g. deionized water, phosphate buffered saline (PBS), saline, aqueous ethanol or other alcohol, plasma, proteinaceous solutions, mannitol, aqueous glucose, alcohol, vegetable oil, or the like. Other additives which may be included include buffers, where the media are generally buffered at a pH in the range of about 5 to 10, where the buffer will generally range in concentration from about 50 to 250 mM, salt, where the concentration of salt will generally range from about 5 to 500 mM, physiologically acceptable stabilizers, and the like. The compositions may be lyophilized for convenient storage and transport.

[0154]The subject modified peptides will for the most part be administered parenterally, such as intravenously (IV), intraarterially (IA), intramuscularly (IM), subcutaneously (SC), or the like. Administration may in appropriate situations be by transfusion. In some instances, where reaction of the functional group is relatively slow, administration may be oral, nasal, rectal, transdermal or aerosol, where the nature of the conjugate allows for transfer to the vascular system. Usually a single injection will be employed although more than one injection may be used, if desired. The modified peptides may be administered by any convenient means, including syringe, trocar, catheter, or the like.

[0155]The particular manner of administration will vary depending upon the amount to be administered, whether a single bolus or continuous administration, or the like. Preferably, the administration will be intravascularly, where the site of introduction is not critical to this invention, preferably at a site where there is rapid blood flow, e.g., intravenously, peripheral or central vein. Other routes may find use where the administration is coupled with slow release techniques or a protective matrix. The intent is that the modified peptide be effectively distributed in the blood, so as to be able to react with the blood components. The concentration of the conjugate will vary widely, generally ranging from about 1 pg/ml to 50 mg/ml. The total administered intravascularly will generally be in the range of about 0.1 mg/ml to about 10 mg/ml, more usually about 1 mg/ml to about 5 mg/ml.

[0156]By bonding to long-lived components of the blood, such as immunoglobulin, serum albumin, red blood cells and platelets, a number of advantages ensue. The activity of the peptide is extended for days to weeks. Only one administration need be given during this period of time. Greater specificity can be achieved, since the active compound will be primarily bound to large molecules, where it is less likely to be taken up intracellularly to interfere with other physiological processes.

8. Monitoring the Presence of Modified Peptides

[0157]The blood of the mammalian host may be monitored for the presence of the modified peptide compound one or more times. By taking a portion or sample of the blood of the host, one may determine whether the peptide has become bound to the long-lived blood components in sufficient amount to be therapeutically active and, thereafter, the level of the peptide compound in the blood. If desired, one may also determine to which of the blood components the peptide is bound. This is particularly important when using non-specific modified peptides. For specific maleimide-modified peptides, it is much simpler to calculate the half life of serum albumin and IgG.

[0158]A. Immuno Assays

[0159]Another aspect of this invention relates to methods for determining the concentration of the anti-viral peptides and/or analogs, or their derivatives and conjugates in biological samples (such as blood) using antibodies specific for the peptides, peptide analogs or their derivatives and conjugates, and to the use of such antibodies as a treatment for toxicity potentially associated with such peptides, analogs, and/or their derivatives or conjugates. This is advantageous because the increased stability and life of the peptides in vivo in the patient might lead to novel problems during treatment, including increased possibility for toxicity.

[0160]The use of anti-therapeutic agent antibodies, either monoclonal or polyclonal, having specificity for a particular peptide, peptide analog or derivative thereof, can assist in mediating any such problem. The antibody may be generated or derived from a host immunized with the particular peptide, analog or derivative thereof, or with an immunogenic fragment of the agent, or a synthesized immunogen corresponding to an antigenic determinant of the agent. Preferred antibodies will have high specificity and affinity for native, modified and conjugated forms of the peptide, peptide analog or derivative. Such antibodies can also be labeled with enzymes, fluorochromes, or radiolables.

[0161]Antibodies specific for modified peptides may be produced by using purified peptides for the induction of peptide-specific antibodies. By induction of antibodies, it is intended not only the stimulation of an immune response by injection into animals, but analogous steps in the production of synthetic antibodies or other specific binding molecules such as screening of recombinant immunoglobulin libraries. Both monoclonal and polyclonal antibodies can be produced by procedures well known in the art.

[0162]The anti-peptide antibodies may be used to treat toxicity induced by administration of the modified peptide, analog or derivative thereof, and may be used ex vivo or in vivo. Ex vivo methods would include immuno-dialysis treatment for toxicity employing anti-therapeutic agent antibodies fixed to solid supports. In vivo methods include administration of anti-therapeutic agent antibodies in amounts effective to induce clearance of antibody-agent complexes.

[0163]The antibodies may be used to remove the modified peptides, analogs or derivatives thereof, and conjugates thereof, from a patient's blood ex vivo by contacting the blood with the antibodies under sterile conditions. For example, the antibodies can be fixed or otherwise immobilized on a column matrix and the patient's blood can be removed from the patient and passed over the matrix. The modified peptide, peptide analogs, derivatives or conjugates will bind to the antibodies and the blood containing a low concentration of peptide, analog, derivative or conjugate, then may be returned to the patient's circulatory system. The amount of peptide compound removed can be controlled by adjusting the pressure and flow rate.

[0164]Preferential removal of the peptides, analogs, derivatives and conjugates from the plasma component of a patient's blood can be effected, for example, by the use of a semipermeable membrane, or by otherwise first separating the plasma component from the cellular component by ways known in the art prior to passing the plasma component over a matrix containing the anti-therapeutic antibodies. Alternatively the preferential removal of peptide-conjugated blood cells, including red blood cells, can be effected by collecting and concentrating the blood cells in the patient's blood and contacting those cells with fixed anti-therapeutic antibodies to the exclusion of the serum component of the patient's blood.

[0165]The anti-therapeutic antibodies can be administered in vivo, parenterally, to a patient that has received the peptide, analogs, derivatives or conjugates for treatment. The antibodies will bind peptide compounds and conjugates. Once bound the peptide activity will be hindered if not completely blocked thereby reducing the biologically effective concentration of peptide compound in the patient's bloodstream and minimizing harmful side effects. In addition, the bound antibody--peptide complex will facilitate clearance of the peptide compounds and conjugates from the patient's blood stream.

[0166]The invention having been fully described can be further appreciated and understood with reference to the following non-limiting examples.

EXAMPLE 1

Preparation of a Modified DP178--Synthesis of YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFK(MPA)-NH2

[0167]In this example, DP178 (SEQ ID NO:1) is synthesized and modified to include a linker and maleimide group according to the following synthesis scheme. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, DP178 is a potent inhibitor of HIV-1, and inhibits both cell-induced syncytia formation between HIV-1 infected and uninfected cells and infection of uninfected cells be cell-free HIV-1 virus.

[0168]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Phe-OH, Fmoc-Trp(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Leu-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ala-OH, Fmoc-Trp(Boc)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Met-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH; Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Ser(tBu)-OH, Fmoc-His(Boc)-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Ser(tBu)-OH, Fmoc-Thr(tBu)-OH, Fmoc-Tyr(tBu)-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). At the end of the synthesis. The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 run to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 2

Preparation of a Modified DP107--Synthesis of

TABLE-US-00011 [0169]NNLLRAIEAQQHLLQLTVWQIKQLQARILAVERYLKDQK(MPA)NH2

[0170]In this example, DP107 (SEQ ID NO:2) is synthesized and modified to include a linker and maleimide group according to the following synthesis scheme. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, DP107 exhibits potent antiviral activity against HIV.

[0171]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Leu-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Val-OH, Fmoc-Ala-OH, Fmoc-Leu-OH, Fmoc-Ile-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ala-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Gln(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Val-OH, Fmoc-Thr(tBu)-OH, Fmoc-Leu-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-His(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Ala-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Asn(Trt)-OH, Fmoc-Asn(Trt)-OH,They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). At the end of the synthesis. The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 3

[0172]Preparation of a Modified anti-RSV Peptide (C Terminal)

[0173]In this example, the peptide VITIELSNIKENKCNGAKVKLIKQELDKYKNAV (SEQ ID NO:16) is modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, the native sequence (SEQ ID NO.) inhibits viral infection of respiratory syncytial virus (RSV), including inhibiting fusion and syncytia formation between RSV-infected and uninfected Hep-2 cells.

[0174]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Val-OH, Fmoc-Ala-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH, Fmoc-Cys(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Val-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 4

Preparation of a Modified Anti-RSV Peptide (T-N Terminal)

[0175]In this example, the peptide VITIELSNIKENKCNGAKVKLIKQELDKYKNAV (SEQ ID NO:17), which corresponds to the peptide of SEQ ID NO:16 but where a Cysteine (C) has been substituted for the Methionine (M), residue is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, the native sequence (SEQ ID NO:16) inhibits viral infection of respiratory syncytial virus (RSV), including inhibiting fusion and syncytia formation between RSV-infected and uninfected Hep-2 cells.

[0176]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Val-OH, Fmoc-Ala-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH, Fmoc-Met-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Val-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 5

Preparation of a Modified Anti-RSV Peptide

[0177]In this example, the peptide SEQ ID NO:14 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:14 inhibits viral infection of respiratory syncytial virus (RSV), including inhibiting fusion and syncytia formation between RSV-infected and uninfected Hep-2 cells.

[0178]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH, Fmoc-Cys(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Val-OH, Fmoc-Ser(tBu)-OH, Fmoc-Thr(tBu)-OH, Fmoc-Tyr(tBu)-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 6 (T-143)

Preparation of a Modified Anti-RSV Peptide

[0179]In this example, the peptide SEQ ID NO:15 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:15 inhibits viral infection of respiratory syncytial virus (RSV), including inhibiting fusion and syncytia formation between RSV-infected and uninfected Hep-2 cells.

[0180]Solid phase peptide synthesis of the modified peptide analog on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH, Fmoc-Cys(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Val-OH, Fmoc-Ser(tBu)-OH, Fmoc-Thr(tBu)-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 7

Preparation of a Modified Anti-RSV Peptide (C Terminal)

[0181]In this example, the peptide SEQ ID NO:17), which corresponds to SEQ ID NO:16 with a cysteine (C) substituted for the Methionine (M), is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, the native sequence SEQ ID NO:16. inhibits viral infection of respiratory syncytial virus (RSV), including inhibiting fusion and syncytia formation between RSV-infected and uninfected Hep-2 cells.

[0182]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Val-OH, Fmoc-Ala-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH, Fmoc-Met-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Val-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 8

Preparation of a Modified Anti-RSV Peptide

[0183]In this example, the peptide SEQ ID NO:29. is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:29 inhibits viral infection of respiratory syncytial virus (RSV), including inhibiting fusion and syncytia formation between RSV-infected and uninfected Hep-2 cells.

[0184]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ile-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Leu-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Thr(tBu)-OH, Fmoc-Leu-OH, Fmoc-Val-OH, Fmoc-Ser(tBu)-OH, Fmoc-Val-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Leu-OH, Fmoc-Ser(tBu)-OH, Fmoc-Val-OH, Fmoc-Val-OH, Fmoc-Ala-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Ala-OH, Fmoc-Ile-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3. times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian 30 Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide

EXAMPLE 9 (T-173)

Preparation of a Modified Anti-HPIV Peptide

[0185]In this example, the peptide SEQ ID NO:52. is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:52 inhibits viral infection of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation between HPIV3-infected Hep2 cells and uninfected CV-1W cells.

[0186]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Val-OH, Fmoc-Ser(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Val-OH, Fmoc-Ala-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Thr(tBu)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ile-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ala-OH, Fmoc-Gln(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Val-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 10

Preparation of a Modified Anti-HPIV Peptide

[0187]In this example, the peptide SEQ ID NO:58 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:58 inhibits viral infection of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation between HPIV3-infected Hep2 cells and uninfected CV-1W cells.

[0188]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Val-OH, Fmoc-Ser(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Ala-OH, Fmoc-Val-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Val-OH, Fmoc-Ser(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Val-OH, Fmoc-Ala-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Thr(tBu)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ile-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Arg(Pbf)-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (1 8:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 11

Preparation of a Modified Anti-HPIV Peptide

[0189]In this example, the peptide SEQ ID NO:35 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:35 inhibits viral infection of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation between HPIV3-infected Hep2 cells and uninfected CV-1W cells.

[0190]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ile-OH, Fmoc-Trp(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Ile-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ile-OH, Fmoc-Pro-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Gln(Trt)-OH Fmoc-Ala-OH, Fmoc-Val-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 12

Preparation of a Modified Anti-HPIV Peptide

[0191]In this example, the peptide SEQ ID NO:38 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO: 38 inhibits viral infection of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation between HPIV3-infected Hep2 cells and uninfected CV-1W cells.

[0192]Solid phase peptide synthesis of the modified peptide analog on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ile-OH, Fmoc-Trp(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ile-OH, Fmoc-Pro-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Ala-OH BOC-Lys(Aloc)-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (VN) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 13

Preparation of a Modified Anti-HPIV Peptide

[0193]In this example, the peptide SEQ ID NO:39 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:39 inhibits viral infection of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation between HPIV3-infected Hep2 cells and uninfected CV-1 W cells.

[0194]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Gly-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ile-OH, Fmoc-Trp(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ile-OH, Fmoc-Pro-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 14

Preparation of a Modified Anti-HPIV Peptide

[0195]In this example, the peptide SEQ ID NO:40 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO. inhibits viral infection of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation between HPIV3-infected Hep2 cells and uninfected CV-1W cells.

[0196]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ile-OH, Fmoc-Trp(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ile-OH, Fmoc-Pro-OH, Fmoc-Asp(tBu)-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 15

Preparation of a Modified Anti-HPIV Peptide

[0197]In this example, the peptide SEQ ID NO:41 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:41 inhibits viral infection of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation between HPIV3-infected Hep2 cells and uninfected CV-1W cells.

[0198]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Trp(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ile-OH, Fmoc-Trp(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ile-OH, Fmoc-Pro-OH Boc-Lys(Aloc)-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 16

Preparation of a Modified Anti-HPIV Peptide

[0199]In this example, the peptide SEQ ID NO:42 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:42 inhibits viral infection of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation between HPIV3-infected Hep2 cells and uninfected CV-1W cells.

[0200]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-His(Boc)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ile-OH, Fmoc-Trp(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ile-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC

EXAMPLE 17

Preparation of a Modified Anti-MeV Peptide

[0201]In this example, the peptide SEQ ID NO:77. is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:77 inhibits viral infection of measles virus (MeV), including inhibiting fusion and syncytia formation between MeV-infected and uninfected Vero cells.

[0202]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Ile-OH, Fmoc-Ala-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Leu-OH, Fmoc-Asn(Trt)-OH, Fmoc-Thr(tBu)-OH, Fmoc-Gly-OH, Fmoc-Val-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ile-OH, Fmoc-Pro-OH, Fmoc-Pro-OH, Fmoc-Gly-OH, Fmoc-Leu-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ile-OH, Fmoc-Arg(Pbf)-OH, Fmoc-His(Boc)OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide. (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 18

Preparation of a Modified Anti-MeV Peptide

[0203]In this example, the peptide SEQ ID NO:79 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:79 inhibits viral infection of measles virus (MeV), including inhibiting fusion and syncytia formation between MeV-infected and uninfected Vero cells.

[0204]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Ile-OH, Fmoc-Ala-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Leu-OH, Fmoc-Asn(Trt)-OH, Fmoc-Thr(tBu)-OH, Fmoc-Gly-OH, Fmoc-Val-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ile-OH, Fmoc-Pro-OH, Fmoc-Pro-OH, Fmoc-Gly-OH, Fmoc-Leu-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ile-OH, They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC

EXAMPLE 19

Preparation of a Modified Anti-MeV Peptide

[0205]In this example, the peptide SEQ ID NO:81 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO: 79 inhibits viral infection of measles virus (MeV), including inhibiting fusion and syncytia formation between MeV-infected and uninfected Vero cells.

[0206]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Ile-OH, Fmoc-Ala-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Leu-OH, Fmoc-Asn(Trt)-OH, Fmoc-Thr(tBu)-OH, Fmoc-Gly-OH, Fmoc-Val-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ile-OH, Fmoc-Pro-OH, Fmoc-Pro-OH, Fmoc-Gly-OH, Fmoc-Leu-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (VN) piperidine in N,N-dimethylformrnamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 20

Preparation of a Modified Anti-MeV Peptide

[0207]In this example, the peptide SEQ ID NO:84 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:84 inhibits viral infection of measles virus (MeV), including inhibiting fusion and syncytia formation between MeV-infected and uninfected Vero cells.

[0208]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Leu-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Ile-OH, Fmoc-Ala-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Leu-OH, Fmoc-Asn(Trt)-OH, Fmoc-Thr(tBu)-OH, Fmoc-Gly-OH, Fmoc-Val-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ile-OH, Fmoc-Pro-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 21

Preparation of a Modified Anti-SIV Peptide

[0209]In this example, the peptide SEQ ID NO:64 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:64. exhibits potent antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).

[0210]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Ala-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Phe-OH, Fmoc-Asp(tBu)-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Trp(Boc)-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 22

Preparation of a Modified Anti-SIV Peptide

[0211]In this example, the peptide SEQ ID NO:65 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:65 exhibits potent antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).

[0212]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Ala-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Phe-OH, Fmoc-Asp(tBu)-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (VN) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 23

Preparation of a Modified Anti-SIV Peptide

[0213]In this example, the peptide SEQ ID NO:66 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:66 exhibits potent antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).

[0214]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Ala-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Phe-OH, Fmoc-Asp(tBu)-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Glu(tBu)-OH Boc-Lys(Aloc)-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 24

Preparation of a Modified Anti-SIV Peptide

[0215]In this example, the peptide SEQ ID NO:67 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:67 exhibits potent antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).

[0216]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Ala-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Phe-OH, Fmoc-Asp(tBu)-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Trp(Boc)-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylfQrmarnide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 25

Preparation of a Modified Anti-SIV Peptide

[0217]In this example, the peptide SEQ ID NO:68 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:68 exhibits potent antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).

[0218]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Trp(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Ala-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Phe-OH, Fmoc-Asp(tBu)-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Glu(tBu)-OH Boc-Lys(Aloc)-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 26

Preparation of a Modified Anti-SIV Peptide

[0219]In this example, the peptide SEQ ID NO:69 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:69 exhibits potent antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).

[0220]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Ala-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Phe-OH, Fmoc-Asp(tBu)-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Arg(Pbf)-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 27

Preparation of a Modified Anti-SIV Peptide

[0221]In this example, the peptide SEQ ID NO:70. is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:70 exhibits potent antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).

[0222]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Val-OH, Fmoc-Asp(tBu)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Ala-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Phe-OH, Fmoc-Asp(tBu)-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Boc-Lys(Aloc)-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 28

Preparation of a Modified Anti-SIV Peptide

[0223]In this example, the peptide SEQ ID NO:71 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:71 exhibits potent antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).

[0224]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Phe-OH, Fmoc-Val-OH, Fmoc-Asp(tBu)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Ala-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Phe-OH, Fmoc-Asp(tBu)-OH, Fmoc-Val-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 29

Preparation of a Modified Anti-SIV Peptide

[0225]In this example, the peptide SEQ ID NO:72 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:72 exhibits potent antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).

[0226]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Gly-OH, Fmoc-Phe-OH, Fmoc-Val-OH, Fmoc-Asp(tBu)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Ala-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Phe-OH, Fmoc-Asp(tBu)-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

EXAMPLE 30

Preparation of a Modified Anti-SIV Peptide

[0227]In this example, the peptide SEQ ID NO:73 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459, SEQ ID NO:73 exhibits potent antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).

[0228]Solid phase peptide synthesis of the modified peptide on a 100 μmole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA. The following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Phe-OH, Fmoc-Val-OH, Fmoc-Asp(tBu)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Ala-OH, Fmoc-Thr(tBu)-OH, Fmoc-Ile-OH, Fmoc-Asn(Trt)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Phe-OH. They are dissolved in N,N-dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl-N,N,N',N'-tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA). Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N-dimethylformamide (DMF) for 20 minutes (step 1). The selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh3)4 dissolved in 5 mL of CHCl3:NMM:HOAc (18:1:0.5) for 2 h (Step 2). The resin is then washed with CHCl3 (6×5 mL), 20% HOAc in DCM (6×5 mL), DCM (6×5 mL), and DMF (6×5 mL). The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et2O (Step 4). The product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H2O (A) and 0.045% TFA in CH3CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10μ phenyl-hexyl, 21 mm×25 cm column and UV detector (Varian Dynamax UVD II) at λ214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.

[0229]While certain embodiments of the invention have been described and exemplified, those having ordinary skill in the art will understand that the invention is not intended to be limited to the specifics of any of these embodiments, but is rather defined by the accompanying claims.

TABLE-US-00012 TABLE 2 DP178 CARBOXY TRUNCATIONS YTS YTSL YTSLI YTSLIH YTSLIHS YTSLIHSL YTSLIHSLI YTSLIHSLIE YTSLIHSLIEE YTSLIHSLIEES YTSLIHSLIEESQ YTSLIHSLIEESQN YTSLIHSLIEESQNQ YTSLIHSLIEESQNQQ YTSLIHSLIEESQNQQE YTSLIHSLIEESQNQQEK YTSLIHSLIEESQNQQEKN YTSLIHSLIEESQNQQEKNE YTSLIHSLIEESQNQQEKNEQ YTSLIHSLIEESQNQQEKNEQE YTSLIHSLIEESQNQQEKNEQEL YTSLIHSLIEESQNQQEKNEQELL YTSLIHSLIEESQNQQEKNEQELLE YTSLIHSLIEESQNQQEKNEQELLEL YTSLIHSLIEESQNQQEKNEQELLELD YTSLIHSLIEESQNQQEKNEQELLELDK YTSLIHSLIEESQNQQEKNEQELLELDKW YTSLIHSLIEESQNQQEKNEQELLELDKWA YTSLIHSLIEESQNQQEKNEQELLELDKWAS YTSLIHSLIEESQNQQEKNEQELLELDKWASL YTSLIHSLIEESQNQQEKNEQELLELDKWASLW YTSLIHSLIEESQNQQEKNEQELLELDKWASLWN YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNW YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

[0230]The one letter amino acid code of Table 1 is used.

TABLE-US-00013 TABLE 3 DP178 AMINO TRUNCATIONS NWF WNWF LWNWF SLWNWF ASLWNWF WASLWNWF KWASLWNWF DKWASLWNWF LDKWASLWNWF ELDKWASLWNWF LELDKWASLWNWF LLELDKWASLWNWF ELLELDKWASLWNWF QELLELDKWASLWNWF EQELLELDKWASLWNWF NEQELLELDKWASLWNWF KNEQELLELDKWASLWNWF EKNEQELLELDKWASLWNWF QEKNEQELLELDKWASLWNWF QQEKNEQELLELDKWASLWNWF NQQEKNEQELLELDKWASLWNWF QNQQEKNEQELLELDKWASLWNWF SQNQQEKNEQELLELDKWASLWNWF ESQNQQEKNEQELLELDKWASLWNWF EESQNQQEKNEQELLELDKWASLWNWF IEESQNQQEKNEQELLELDKWASLWNWF LIEESQNQQEKNEQELLELDKWASLWNWF SLIEESQNQQEKNEQELLELDKWASLWNWF HSLIEESQNQQEKNEQELLELDKWASLWNWF IHSLIEESQNQQEKNEQELLELDKWASLWNWF LIHSLIEESQNQQEKNEQELLELDKWASLWNWF SLIHSLIEESQNQQEKNEQELLELDKWASLWNWF TSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

[0231]The one letter amino acid code of Table 1 is used.

TABLE-US-00014 TABLE 4 DP107 CARBOXY TRUNCATIONS NNL NNLL NNLLR NNLLRA NNLLRAI NNLLRAIE NNLLRAIEA NNLLRAIEAQ NNLLRAIEAQQ NNLLRAIEAQQH NNLLRAIEAQQHL NNLLRAIEAQQHLL NNLLRAIEAQQHLLQ NNLLRAIEAQQHLLQL NNLLRAIEAQQHLLQLT NNLLRAIEAQQHLLQLTV NNLLRAIEAQQHLLQLTVW NNLLRAIEAQQHLLQLTVWQ NNLLRAIEAQQHLLQLTVWQI NNLLRAIEAQQHLLQLTVWQIK NNLLRAIEAQQHLLQLTVWQIKQ NNLLRAIEAQQHLLQLTVWQIKQL NNLLRAIEAQQHLLQLTVWQIKQLQ NNLLRAIEAQQHLLQLTVWQIKQLQA NNLLRAIEAQQHLLQLTVWQIKQLQAR NNLLRAIEAQQHLLQLTVWQIKQLQARI NNLLRAIEAQQHLLQLTVWQIKQLQARIL NNLLRAIEAQQHLLQLTVWQIKQLQARILA NNLLRAIEAQQHLLQLTVWQIKQLQARILAV NNLLRAIEAQQHLLQLTVWQIKQLQARILAVE NNLLRAIEAQQHLLQLTVWQIKQLQARILAVER NNLLRAIEAQQHLLQLTVWQIKQLQARILAVERY NNLLRAIEAQQHLLQLTVWQIKQLQARILAVERYL NNLLRAIEAQQHLLQLTVWQIKQLQARILAVERYLK NNLLRAIEAQQHLLQLTVWQIKQLQARILAVERYLKD NNLLRAIEAQQHLLQLTVWQIKQLQARILAVERYLKDQ

[0232]The one letter amino acid code of Table 1 is used.

TABLE-US-00015 TABLE 5 DP107 AMINO TRUNCATIONS KDQ LKDQ YLKDQ RYLKDQ ERYLKDQ VERYLKDQ AVERYLKDQ LAVERYLKDQ ILAVERYLKDQ RILAVERYLKDQ ARILAVERYLKDQ QARILAVERYLKDQ LQARILAVERYLKDQ QLQARILAVERYLKDQ KQLQARILAVERYLKDQ IKQLQARILAVERYLKDQ QIKQLQARILAVERYLKDQ WQIKQLQARILAVERYLKDQ VWQIKQLQARILAVERYLKDQ TVWQIKQLQARILAVERYLKDQ LTVWQIKQLQARILAVERYLKDQ QLTVWQIKQLQARILAVERYLKDQ LQLTVWQIKQLQARILAVERYLKDQ LLQLTVWQIKQLQARILAVERYLKDQ HLLQLTVWQIKQLQARILAVERYLKDQ QHLLQLTVWQIKQLQARILAVERYLKDQ QQHLLQLTVWQIKQLQARILAVERYLKDQ AQQHLLQLTVWQIKQLQARILAVERYLKDQ EAQQHLLQLTVWQIKQLQARILAVERYLKDQ IEAQQHLLQLTVWQIKQLQARILAVERYLKDQ AIEAQQHLLQLTVWQIKQLQARILAVERYLKDQ RAIEAQQHLLQLTVWQIKQLQARILAVERYLKDQ LRAIEAQQHLLQLTVWQIKQLQARILAVERYLKDQ LLRAIEAQQHLLQLTVWQIKQLQARILAVERYLKDQ NLLRAIEAQQHLLQLTVWQIKQLQARILAVERYLKDQ NNLLRAIEAQQHLLQLTVWQIKQLQARILAVERYLKDQ

[0233]The one letter amino acid code of Table 1 is used.

TABLE-US-00016 TABLE 6 HIV-2NIHZDP178 analog carboxy truncations. LEA LEAN LEANI LEANIS LEANISQ LEANISQS LEANISQSL LEANISQSLE LEANISQSLEQ LEANISQSLEQA LEANISQSLEQAQ LEANISQSLEQAQI LEANISQSLEQAQIQ LEANISQSLEQAQIQQ LEANISQSLEQAQIQQE LEANISQSLEQAQIQQEK LEANISQSLEQAQIQQEKN LEANISQSLEQAQIQQEKNM LEANISQSLEQAQIQQEKNMY LEANISQSLEQAQIQQEKNMYE LEANISQSLEQAQIQQEKNMYEL LEANISQSLEQAQIQQEKNMYELQ LEANISQSLEQAQIQQEKNMYELQK LEANISQSLEQAQIQQEKNMYELQKL LEANISQSLEQAQIQQEKNMYELQKLN LEANISQSLEQAQIQQEKNMYELQKLNS LEANISQSLEQAQIQQEKNMYELQKLNSW LEANISQSLEQAQIQQEKNMYELQKLNSWD LEANISQSLEQAQIQQEKNMYELQKLNSWDV LEANISQSLEQAQIQQEKNMYELQKLNSWDVF LEANISQSLEQAQIQQEKNMYELQKLNSWDVFT LEANISQSLEQAQIQQEKNMYELQKLNSWDVFTN LEANISQSLEQAQIQQEKNMYELQKLNSWDVFTNW LEANISQSLEQAQIQQEKNMYELQKLNSWDVFTNWL

[0234]The one letter amino acid code of Table 1 is used.

TABLE-US-00017 TABLE 7 HIV-2NIHZ DP178 analog amino truncations. NWL TNWL FTNWL VFTNWL DVFTNWL WDVFTNWL SWDVFTNWL NSWDVFTNWL LNSWDVFTNWL KLNSWDVFTNWL QKLNSWDVFTNWL LQKLNSWDVFTNWL ELQKLNSWDVFTNWL YELQKLNSWDVFTNWL MYELQKLNSWDVFTNWL NMYELQKLNSWDVFTNWL KNMYELQKLNSWDVFTNWL EKNMYELQKLNSWDVFTNWL QEKNMYELQKLNSWDVFTNWL QQEKNMYELQKLNSWDVFTNWL IQQEKNMYELQKLNSWDVFTNWL QIQQEKNMYELQKLNSWDVFTNWL AQIQQEKNMYELQKLNSWDVFTNWL QAQIQQEKNMYELQKLNSWDVFTNWL EQAQIQQEKNMYELQKLNSWDVFTNWL LEQAQIQQEKNMYELQKLNSWDVFTNWL SLEQAQIQQEKNMYELQKLNSWDVFTNWL QSLEQAQIQQEKNMYELQKLNSWDVFTNWL SQSLEQAQIQQEKNMYELQKLNSWDVFTNWL ISQSLEQAQIQQEKNMYELQKLNSWDVFTNWL NISQSLEQAQIQQEKNMYELQKLNSWDVFTNWL ANISQSLEQAQIQQEKNMYELQKLNSWDVFTNWL EANISQSLEQAQIQQEKNMYELQKLNSWDVFTNWL LEANISQSLEQAQIQQEKNMYELQKLNSWDVFTNWL

[0235]The one letter amino acid code of Table 1 is used.

TABLE-US-00018 TABLE 8 RESPIRATORY SYNCYTIAL VIRUS (RSV) DP107 F2 REGION ANALOG CARBOXY TRUNCATIONS YTS YTSV YTSVI YTSVIT YTSVITI YTSVITIE YTSVITIEL YTSVITIELS YTSVITIELSN YTSVITIELSNI YTSVITIELSNIK YTSVITIELSNIKE YTSVITIELSNIKEN YTSVITIELSNIKENK YTSVITIELSNIKENKC YTSVITIELSNIKENKCN YTSVITIELSNIKENKCNG YTSVITIELSNIKENKCNGT YTSVITIELSNIKENKCNGTD YTSVITIELSNIKENKCNGTDA YTSVITIELSNIKENKCNGTDAK YTSVITIELSNIKENKCNGTDAKV YTSVITIELSNIKENKCNGTDAKVK YTSVITIELSNIKENKCNGTDAKVKL YTSVITIELSNIKENKCNGTDAKVKLI YTSVITIELSNIKENKCNGTDAKVKLIK YTSVITIELSNIKENKCNGTDAKVKLIKQ YTSVITIELSNIKENKCNGTDAKVKLIKQE YTSVITIELSNIKENKCNGTDAKVKLIKQEL YTSVITIELSNIKENKCNGTDAKVKLIKQELD YTSVITIELSNIKENKCNGTDAKVKLIKQELDK YTSVITIELSNIKENKCNGTDAKVKLIKQELDKY YTSVITIELSNIKENKCNGTDAKVKLIKQELDKYK YTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKN YTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNA YTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAV YTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVT YTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTE YTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTEL YTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQ YTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQL YTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLL YTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLM YTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQ YTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQS YTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQST

[0236]The one letter amino acid code of Table 1 is used.

TABLE-US-00019 TABLE 9 RESPIRATORY SYNCYTIAL VIRUS (RSV) DP107 F2 REGION ANALOG AMINO TRUNCATIONS QST MQST LMQST LLMQST QLLMQST LQLLMQST ELQLLMQST TELQLLMQST VTELQLLMQST AVTELQLLMQST NAVTELQLLMQST KNAVTELQLLMQST YKNAVTELQLLMQST KYKNAVTELQLLMQST DKYKNAVTELQLLMQST LDKYKNAVTELQLLMQST ELDKYKNAVTELQLLMQST QELDKYKNAVTELQLLMQST KQELDKYKNAVTELQLLMQST IKQELDKYKNAVTELQLLMQST LIKQELDKYKNAVTELQLLMQST KLIKQELDKYKNAVTELQLLMQST VKLIKQELDKYKNAVTELQLLMQST KVKLIKQELDKYKNAVTELQLLMQST AKVKLIKQELDKYKNAVTELQLLMQST DAKVKLIKQELDKYKNAVTELQLLMQST TDAKVKLIKQELDKYKNAVTELQLLMQST GTDAKVKLIKQELDKYKNAVTELQLLMQST NGTDAKVKLIKQELDKYKNAVTELQLLMQST CNGTDAKVKLIKQELDKYKNAVTELQLLMQST KCNGTDAKVKLIKQELDKYKNAVTELQLLMQST NKCNGTDAKVKLIKQELDKYKNAVTELQLLMQST KENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQST IKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQST NIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQST SNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQST LSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQST ELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQST IELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQST TIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQST ITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQST VITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQST SVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQST TSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQST

[0237]The one letter amino acid code of Table 1 is used.

TABLE-US-00020 TABLE 10 RESPIRATORY SYNCYTIAL VIRUS (RSV) F1 DP178 REGION ANALOG CARBOXY TRUNCATIONS FYD FYDP FYDPL FYDPLV FYDPLVF FYDPLVFP FYDPLVFPS FYDPLVFPSD FYDPLVFPSDE FYDPLVFPSDEF FYDPLVFPSDEFD FYDPLVFPSDEFDA FYDPLVFPSDEFDAS FYDPLVFPSDEFDASI FYDPLVFPSDEFDASIS FYDPLVFPSDEFDASISQ FYDPLVFPSDEFDASISQV FYDPLVFPSDEFDASISQVN FYDPLVFPSDEFDASISQVNE FYDPLVFPSDEFDASISQVNEK FYDPLVFPSDEFDASISQVNEKI FYDPLVFPSDEFDASISQVNEKIN FYDPLVFPSDEFDASISQVNEKINQ FYDPLVFPSDEFDASISQVNEKINQS FYDPLVFPSDEFDASISQVNEKINQSL FYDPLVFPSDEFDASISQVNEKINQSLA FYDPLVFPSDEFDASISQVNEKINQSLAF FYDPLVFPSDEFDASISQVNEKINQSLAFI FYDPLVFPSDEFDASISQVNEKINQSLAFIR FYDPLVFPSDEFDASISQVNEKINQSLAFIRK FYDPLVFPSDEFDASISQVNEKINQSLAFIRKS FYDPLVFPSDEFDASISQVNEKINQSLAFIRKSD FYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDE FYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDEL FYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELL

[0238]The one letter amino acid code of Table 1 is used.

TABLE-US-00021 TABLE 11 RESPIRATORY SYNCYTIAL VIRUS (RSV) F1 DP178 REGION ANALOG AMINO TRUNCATIONS DELL SDELL KSDELL RKSDELL IRKSDELL FIRKSDELL AFIRKSDELL LAFIRKSDELL SLAFIRKSDELL QSLAFIRKSDELL NQSLAFIRKSDELL INQSLAFIRKSDELL KINQSLAFIRKSDELL EKINQSLAFIRKSDELL NEKINQSLAFIRKSDELL VNEKINQSLAFIRKSDELL QVNEKINQSLAFIRKSDELL SQVNEKINQSLAFIRKSDELL ISQVNEKINQSLAFIRKSDELL SISQVNEKINQSLAFIRKSDELL ASISQVNEKINQSLAFIRKSDELL DASISQVNEKINQSLAFIRKSDELL FDASISQVNEKINQSLAFIRKSDELL EFDASISQVNEKINQSLAFIRKSDELL DEFDASISQVNEKINQSLAFIRKSDELL SDEFDASISQVNEKINQSLAFIRKSDELL PSDEFDASISQVNEKINQSLAFIRKSDELL FPSDEFDASISQVNEKINQSLAFIRKSDELL VFPSDEFDASISQVNEKINQSLAFIRKSDELL LVFPSDEFDASISQVNEKINQSLAFIRKSDELL PLVFPSDEFDASISQVNEKINQSLAFIRKSDELL DPLVFPSDEFDASISQVNEKINQSLAFIRKSDELL YDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELL

[0239]The one letter amino acid code of Table 1 is used.

TABLE-US-00022 TABLE 12 HUMAN PARAINFLUENZA VIRUS 3 (HPV3) F1 REGION DP178 ANALOG CARBOXY TRUNCATIONS ITL ITLN ITLNN ITLNNS ITLNNSV ITLNNSVA ITLNNSVAL ITLNNSVALD ITLNNSVALDP ITLNNSVALDPI ITLNNSVALDPID ITLNNSVALDPIDI ITLNNSVALDPIDIS ITLNNSVALDPIDISI ITLNNSVALDPIDISIE ITLNNSVALDPIDISIEL ITLNNSVALDPIDISIELN ITLNNSVALDPIDISIELNK ITLNNSVALDPIDISIELNKA ITLNNSVALDPIDISIELNKAK ITLNNSVALDPIDISIELNKAKS ITLNNSVALDPIDISIELNKAKSD ITLNNSVALDPIDISIELNKAKSDL ITLNNSVALDPIDISIELNKAKSDLE ITLNNSVALDPIDISIELNKAKSDLEE ITLNNSVALDPIDISIELNKAKSDLEES ITLNNSVALDPIDISIELNKAKSDLEESK ITLNNSVALDPIDISIELNKAKSDLEESKE ITLNNSVALDPIDISIELNKAKSDLEESKEW ITLNNSVALDPIDISIELNKAKSDLEESKEWI ITLNNSVALDPIDISIELNKAKSDLEESKEWIR ITLNNSVALDPIDISIELNKAKSDLEESKEWIRR ITLNNSVALDPIDISIELNKAKSDLEESKEWIRRS

[0240]The one letter amino acid code of Table 1 is used.

TABLE-US-00023 TABLE 13 HUMAN PARAINFLUENZA VIRUS 3 (HPV3) F1 REGION DP178 ANALOG AMINO TRUNCATIONS RRS IRRS WIRRS EWIRRS KEWIRRS SKEWIRRS ESKEWIRRS EESKEWIRRS LEESKEWIRRS DLEESKEWIRRS SDLEESKEWIRRS KSDLEESKEWIRRS AKSDLEESKEWIRRS KAKSDLEESKEWIRRS NKAKSDLEESKEWIRRS LNKAKSDLEESKEWIRRS ELNKAKSDLEESKEWIRRS IELNKAKSDLEESKEWIRRS SIELNKAKSDLEESKEWIRRS ISIELNKAKSDLEESKEWIRRS DISIELNKAKSDLEESKEWIRRS IDISIELNKAKSDLEESKEWIRRS PIDISIELNKAKSDLEESKEWIRRS DPIDISIELNKAKSDLEESKEWIRRS LDPIDISIELNKAKSDLEESKEWIRRS ALDPIDISLELNKAKSDLEESKEWIRRS VALDPIDISIELNKAKSDLEESKEWIRRS SVALDPIDISIELNKAKSDLEESKEWIRRS NSVALDPIDISIELNKAKSDLEESKEWIRRS NNSVALDPIDISIELNKAKSDLEESKEWIRRS LNNSVALDPIDISIELNKAKSDLEESKEWIRRS TLNNSVALDPIDISIELNKAKSDLEESKEWIRRS

[0241]The one letter amino acid code of Table 1 is used.

TABLE-US-00024 TABLE 14 HUMAN PARAINFLUENZA VIRUS 3 (HPV3) F1 REGION DP107 ANALOG CARBOXY TRUNCATIONS ALG ALGV ALGVA ALGVAT ALGVATS ALGVATSA ALGVATSAQ ALGVATSAQI ALGVATSAQIT ALGVATSAQITA ALGVATSAQITAA ALGVATSAQITAAV ALGVATSAQITAAVA ALGVATSAQITAAVAL ALGVATSAQITAAVALV ALGVATSAQITAAVALVE ALGVATSAQITAAVALVEA ALGVATSAQITAAVALVEAK ALGVATSAQITAAVALVEAKQ ALGVATSAQITAAVALVEAKQA ALGVATSAQITAAVALVEAKQAR ALGVATSAQITAAVALVEAKQARS ALGVATSAQITAAVALVEAKQARSD ALGVATSAQITAAVALVEAKQARSDI ALGVATSAQITAAVALVEAKQARSDIE ALGVATSAQITAAVALVEAKQARSDIEK ALGVATSAQITAAVALVEAKQARSDIEKL ALGVATSAQITAAVALVEAKQARSDIEKLK ALGVATSAQITAAVALVEAKQARSDIEKLKE ALGVATSAQITAAVALVEAKQARSDIEKLKEA ALGVATSAQITAAVALVEAKQARSDIEKLKEAI ALGVATSAQITAAVALVEAKQARSDIEKLKEAIR

[0242]The one letter amino acid code of Table 1 is used.

TABLE-US-00025 TABLE 15 HUMAN PARAINFLUENZA VIRUS 3 (HPV3) F1 REGION DP107 ANALOG AMINO TRUNCATIONS IRD AIRD EAIRD KEAIRD LKEAIRD KLKEAIRD EKLKEAIRD IEKLKEAIRD DIEKLKEAIRD SDIEKLKEAIRD RSDIEKLKEAIRD ARSDIEKLKEAIRD QARSDIEKLKEAIRD KQARSDIEKLKEAIRD AKQARSDIEKLKEAIRD EAKQARSDIEKLKEAIRD VEAKQARSDIEKLKEAIRD LVEAKQARSDIEKIKEAIRD ALVEAKQARSDIEKLKEAIRD VALVEAKQARSDIEKLKEAIRD AVALVEAKQARSDIEKLKEAIRD AAVALVEAKQARSDIEKLKEAIRD TAAVALVEAKQARSDIEKLKEAIRD ITAAVALVEAKQARSDIEKLKEAIRD QITAAVALVEAKQARSDIEKLKEAIRD AQITAAVALVEAKQARSDIEKLKEAIRD SAQITAAVALVEAKQARSDIEKLKEAIRD TSAQITAAVALVEAKQARSDIEKLKEAIRD ATSAQITAAVALVEAKQARSDLEKLKEAIRD VATSAQITAAVALVEAKQARSDIEKLKEAIRD GVATSAQITAAVALVEAKQARSDIEKLKEAIRD LGVATSAQITAAVALVEAKQARSDIEKLKEAIRD

[0243]The one letter amino acid code of Table 1 is used.

TABLE-US-00026 TABLE 16 ANTI-RESPIRATORY SYNCYTIAL VIRUS (RSV) PEPTIDES TSVITIELSNIKENKCNGTDAKVKLIKQELDKYKN SVITIELSNIKENKCNGTDAKVKLIKQELDKYKNA VITIELSNIKENKCNGTDAKVKLIKQELDKYKNAV VAVSKVLHLEGEVNKIALLSTNKAVVSLSNGVS AVSKVLHLEGEVNKIALLSTNKAVVSLSNGVSV VSKVLHLEGEVNKIALLSTNKAVVSLSNGVSVL SKVLHLEGEVNKIALLSTNKAVVSLSNGVSVLT KVLHLEGEVNKIALLSTNKAVVSLSNGVSVLTS LEGEVNKIALLSTNKAVVSLSNGVSVLTSKVLD GEVNKIALLSTNKAVVSLSNGVSVLTSKVLDLK EVNKIALLSTNKAVVSLSNGVSVLTSKVLDLKN VNKIALLSTNKAVVSLSNGVSVLTSKVLDLKNY NKIALLSTNKAVVSLSNGVSVLTSKVLDLKNYI KIALLSTNKAVVSLSNGVSVLTSKVLDLKNYID IALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDK ALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQ VAVSKVLHLEGEVNKIALLSTNKAVVSLSNGVS AVSKVLHLEGEVNKIALLSTNKAVVSLSNGVSV VSKVLHLEGEVNKIALLSTNKAVVSLSNGVSVL SKVLHLEGEVNKIALLSTNKAVVSLSNGVSVLT KVLHLEGEVNKIALLSTNKAVVSLSNGVSVLTS LEGEVNKIALLSTNKAVVSLSNGVSVLTSKVLD GEVNKIALLSTNKAVVSLSNGVSVLTSKVLDLK EVNKIALLSTNKAVVSLSNGVSVLTSKVLDLKN VNKIALLSTNKAVVSLSNGVSVLTSKVLDLKNY NKIALLSTNKAVVSLSNGVSVLTSKVLDLKNYI KIALLSTNKAVVSLSNGVSVLTSKVLDLKNYID IALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDK ALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQ

[0244]The one letter amino acid code of Table 1 is used.

TABLE-US-00027 TABLE 17 ANTI-HUMAN PARAINFLUENZA VIRUS 3 (HPV3) PEPTIDES TLNNSVALDPIDISIELNKAKSDLEESKEWIRRSN LNNSVALDPIDISIELNKAKSDLEESKEWIRRSNQ NNSVALDPIDISIELNKAKSDLEESKEWIRRSNQK NSVALDPIDISIELNKAKSDLEESKEWIRRSNQKL SVALDPIDISIELNKAKSDLEESKEWIRRSNQKLD VALDPIDISIELNKAKSDLEESKEWIRRSNQKLDS ALDPIDISIELNKAKSDLEESKEWIRRSNQKLDSI LDPIDISIELNKAKSDLEESKEWIRRSNQKLDSIG DPIDISIELNKAKSDLEESKEWIRRSNQKLDSIGN PIDISIELNKAKSDLEESKEWIRRSNQKLDSIGNW IDISIELNKAKSDLEESKEWIRRSNQKLDSIGNWH DISIELNKAKSDLEESKEWIRRSNQKLDSIGNWHQ ISIELNKAKSDLEESKEWIRRSNQKLDSIGNWHQS SIELNKAKSDLEESKEWIRRSNQKLDSIGNWHQSS IELNKAKSDLEESKEWIRRSNQKLDSIGNWHQSST ELNKAKSDLEESKEWIRRSNQKLDSIGNWHQSSTT TAAVALVEAKQARSDIEKLKEAIRDTNKAVQSVQS AVALVEAKQARSDIEKLKEAIRDTNKAVQSVQSSI LVEAKQARSDIEKLKEAIRDTNKAVQSVQSSIGNL VEAKQARSDIEKLKEAIRDTNKAVQSVQSSIGNLI EAKQARSDIEKLKEAIRDTNKAVQSVQSSIGNLIV AKQARSDIEKLKEAIRDTNKAVQSVQSSIGNLIVA KQARSDIEKLKEAIRDTNKAVQSVQSSIGNLIVAI QARSDIEKLKEAIRDTNKAVQSVQSSIGNLIVAIK ARSDIEKLKEAIRDTNKAVQSVQSSIGNLIVAIKS RSDIEKLKEAIRDTNKAVQSVQSSIGNLIVAIKSV SDIEKLKEAIRDTNKAVQSVQSSIGNLIVAIKSVQ KLKEAIRDTNKAVQSVQSSIGNLIVAIKSVQDYVN LKEAIRDTNKAVQSVQSSIGNLIVAIKSVQDYVNK AIRDTNKAVQSVQSSIGNLIVAIKSVQDYVNKEIV

[0245]The one letter amino acid code of Table 1 is used.

TABLE-US-00028 TABLE 18 ANTI-SIMIAN IMMUNODEFICIENCY VIRUS (SIV) PEPTIDES WQEWERKVDFLEENITALLEEAQIQQEKNMYELQK QEWERKVDFLEENITALLEEAQIQQEKNMYELQKL EWERKVDFLEENITALLEEAQIQQEKNMYELQKLN WERKVDFLEENITALLEEAQIQQEKNMYELQKLNS ERKVDFLEENITALLEEAQIQQEKNMYELQKLNSW RKVDFLEENITALLEEAQIQQEKNMYELQKLNSWD KVDFLEENITALLEEAQIQQEKNMYELQKLNSWDV VDFLEENITALLEEAQIQQEKNMYELQKLNSWDVF DFLEENITALLEEAQIQQEKNMYELQKLNSWDVFG FLEENITALLEEAQIQQEKNMYELQKLNSWDVFGN

[0246]The one letter amino acid code of Table 1 is used.

TABLE-US-00029 TABLE 19 ANTI-MEASLES VIRUS (MEV) PEPTIDES LHRIDLGPPISLERLDVGTNLGNAIAKLEAKELL HRIDLGPPISLERLDVGTNLGNAIAKLEAKELLE RIDLGPPISLERLDVGTNLGNAIAKLEAKELLES IDLGPPISLERLDVGTNLGNAIAKLEAKELLESS DLGPPISLERLDVGTNLGNAIAKLEAKELLESSD LGPPISLERLDVGTNLGNAIAKLEAKELLESSDQ GPPISLERLDVGTNLGNAIAKLEAKELLESSDQI PPISLERLDVGTNLGNAIAKLEAKELLESSDQIL PISLERLDVGTNLGNAIAKLEAKELLESSDQILR SLERLDVGTNLGNAIAKLEAKELLESSDQILRSM LERLDVGTNLGNAIAKLEAKELLESSDQILRSMK

[0247]The one letter amino acid code of Table 1 is used.

Sequence CWU 1 SEQUENCE LISTING <160> NUMBER OF SEQ ID NOS: 545 <210> SEQ ID NO 1 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 1 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 20 25 30 Trp Asn Trp Phe 35 <210> SEQ ID NO 2 <211> LENGTH: 38 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 2 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu 20 25 30 Arg Tyr Leu Lys Asp Gln 35 <210> SEQ ID NO 3 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 3 Tyr Thr Asn Thr Ile Tyr Thr Leu Leu Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 20 25 30 Trp Asn Trp Phe 35 <210> SEQ ID NO 4 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 4 Tyr Thr Gly Ile Ile Tyr Asn Leu Leu Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Asn Leu 20 25 30 Trp Asn Trp Phe 35 <210> SEQ ID NO 5 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 5 Tyr Thr Ser Leu Ile Tyr Ser Leu Leu Glu Lys Ser Gln Thr Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 20 25 30 Trp Asn Trp Phe 35 <210> SEQ ID NO 6 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 6 Leu Glu Ala Asn Ile Ser Lys Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp Ile Phe 20 25 30 Gly Asn Trp Phe 35 <210> SEQ ID NO 7 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 7 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp Val Phe 20 25 30 Thr Asn Trp Leu 35 <210> SEQ ID NO 8 <211> LENGTH: 41 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 8 Cys Gly Gly Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu 1 5 10 15 Leu Gln Leu Thr Val Trp Gly Ile Lys Gln Leu Gln Ala Arg Ile Leu 20 25 30 Ala Val Glu Arg Tyr Leu Lys Asp Gln 35 40 <210> SEQ ID NO 9 <211> LENGTH: 38 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 9 Gln Gln Leu Leu Asp Val Val Lys Arg Gln Gln Glu Met Leu Arg Leu 1 5 10 15 Thr Val Trp Gly Thr Lys Asn Leu Gln Ala Arg Val Thr Ala Ile Glu 20 25 30 Lys Tyr Leu Lys Asp Gln 35 <210> SEQ ID NO 10 <211> LENGTH: 46 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 10 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp Lys Tyr 20 25 30 Lys Asn Ala Val Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 35 40 45 <210> SEQ ID NO 11 <211> LENGTH: 54 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 11 Ala Ser Gly Val Ala Val Ser Lys Val Leu His Leu Glu Gly Glu Val 1 5 10 15 Asn Lys Ile Ala Leu Leu Ser Thr Asn Lys Ala Val Val Ser Leu Ser 20 25 30 Asn Gly Val Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr 35 40 45 Ile Asp Lys Gln Leu Leu 50 <210> SEQ ID NO 12 <211> LENGTH: 53 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 12 Gly Glu Pro Ile Ile Asn Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp 1 5 10 15 Glu Phe Asp Ala Ser Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser 20 25 30 Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu His Asn Val Asn Ala 35 40 45 Gly Lys Ser Thr Thr 50 <210> SEQ ID NO 13 <211> LENGTH: 48 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 13 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp 20 25 30 Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 35 40 45 <210> SEQ ID NO 14 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 14 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp Lys 20 25 30 Tyr Lys <210> SEQ ID NO 15 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 15 Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys Cys 1 5 10 15 Asn Gly Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp Lys Tyr 20 25 30 Lys Asn <210> SEQ ID NO 16 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 16 Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys Cys Asn Gly 1 5 10 15 Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp Lys Tyr Lys Asn 20 25 30 Ala Val <210> SEQ ID NO 17 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 17 Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys Met Asn Gly 1 5 10 15 Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp Lys Tyr Lys Asn 20 25 30 Ala Val <210> SEQ ID NO 18 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 18 Val Ala Val Ser Lys Val Leu His Leu Glu Gly Glu Val Asn Lys Ile 1 5 10 15 Ala Leu Leu Ser Thr Asn Lys Ala Val Val Ser Leu Ser Asn Gly Val 20 25 30 Ser <210> SEQ ID NO 19 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 19 Ala Val Ser Lys Val Leu His Leu Glu Gly Glu Val Asn Lys Ile Ala 1 5 10 15 Leu Leu Ser Thr Asn Lys Ala Val Val Ser Leu Ser Asn Gly Val Ser 20 25 30 Val <210> SEQ ID NO 20 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 20 Val Ser Lys Val Leu His Leu Glu Gly Glu Val Asn Lys Ile Ala Leu 1 5 10 15 Leu Ser Thr Asn Lys Ala Val Val Ser Leu Ser Asn Gly Val Ser Val 20 25 30 Leu <210> SEQ ID NO 21 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 21 Ser Lys Val Leu His Leu Glu Gly Glu Val Asn Lys Ile Ala Leu Leu 1 5 10 15 Ser Thr Asn Lys Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu 20 25 30 Thr <210> SEQ ID NO 22 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 22 Lys Val Leu His Leu Glu Gly Glu Val Asn Lys Ile Ala Leu Leu Ser 1 5 10 15 Thr Asn Lys Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu Thr 20 25 30 Ser <210> SEQ ID NO 23 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 23 Leu Glu Gly Glu Val Asn Lys Ile Ala Leu Leu Ser Thr Asn Lys Ala 1 5 10 15 Val Val Ser Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val Leu 20 25 30 Asp <210> SEQ ID NO 24 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 24 Gly Glu Val Asn Lys Ile Ala Leu Leu Ser Thr Asn Lys Ala Val Val 1 5 10 15 Ser Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val Leu Asp Leu 20 25 30 Lys <210> SEQ ID NO 25 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 25 Glu Val Asn Lys Ile Ala Leu Leu Ser Thr Asn Lys Ala Val Val Ser 1 5 10 15 Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys 20 25 30 Asn <210> SEQ ID NO 26 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 26 Val Asn Lys Ile Ala Leu Leu Ser Thr Asn Lys Ala Val Val Ser Leu 1 5 10 15 Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn 20 25 30 Tyr <210> SEQ ID NO 27 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 27 Asn Lys Ile Ala Leu Leu Ser Thr Asn Lys Ala Val Val Ser Leu Ser 1 5 10 15 Asn Gly Val Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr 20 25 30 Ile <210> SEQ ID NO 28 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 28 Lys Ile Ala Leu Leu Ser Thr Asn Lys Ala Val Val Ser Leu Ser Asn 1 5 10 15 Gly Val Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr Ile 20 25 30 Asp <210> SEQ ID NO 29 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 29 Ile Ala Leu Leu Ser Thr Asn Lys Ala Val Val Ser Leu Ser Asn Gly 1 5 10 15 Val Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr Ile Asp 20 25 30 Lys <210> SEQ ID NO 30 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 30 Ala Leu Leu Ser Thr Asn Lys Ala Val Val Ser Leu Ser Asn Gly Val 1 5 10 15 Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr Ile Asp Lys 20 25 30 Gln <210> SEQ ID NO 31 <211> LENGTH: 70 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 31 Gly Thr Ile Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala 1 5 10 15 Val Ala Leu Val Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu 20 25 30 Lys Glu Ala Ile Arg Asp Thr Asn Lys Ala Val Gln Ser Val Gln Ser 35 40 45 Ser Ile Gly Asn Leu Ile Val Ala Ile Lys Ser Val Gln Asp Tyr Val 50 55 60 Asn Lys Glu Ile Val Pro 65 70 <210> SEQ ID NO 32 <211> LENGTH: 56 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 32 Tyr Thr Pro Asn Asp Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro 1 5 10 15 Ile Asp Ile Ser Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu 20 25 30 Ser Lys Glu Trp Ile Arg Arg Ser Asn Gln Lys Leu Asp Ser Ile Gly 35 40 45 Asn Trp His Gln Ser Ser Thr Thr 50 55 <210> SEQ ID NO 33 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 33 Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser Ile Glu 1 5 10 15 Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu Trp Ile Arg 20 25 30 Arg Ser Asn 35 <210> SEQ ID NO 34 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 34 Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser Ile Glu Leu 1 5 10 15 Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu Trp Ile Arg Arg 20 25 30 Ser Asn Gln 35 <210> SEQ ID NO 35 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 35 Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser Ile Glu Leu Asn 1 5 10 15 Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu Trp Ile Arg Arg Ser 20 25 30 Asn Gln Lys 35 <210> SEQ ID NO 36 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 36 Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser Ile Glu Leu Asn Lys 1 5 10 15 Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu Trp Ile Arg Arg Ser Asn 20 25 30 Gln Lys Leu 35 <210> SEQ ID NO 37 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 37 Ser Val Ala Leu Asp Pro Ile Asp Ile Ser Ile Glu Leu Asn Lys Ala 1 5 10 15 Lys Ser Asp Leu Glu Glu Ser Lys Glu Trp Ile Arg Arg Ser Asn Gln 20 25 30 Lys Leu Asp 35 <210> SEQ ID NO 38 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 38 Val Ala Leu Asp Pro Ile Asp Ile Ser Ile Glu Leu Asn Lys Ala Lys 1 5 10 15 Ser Asp Leu Glu Glu Ser Lys Glu Trp Ile Arg Arg Ser Asn Gln Lys 20 25 30 Leu Asp Ser 35 <210> SEQ ID NO 39 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 39 Ala Leu Asp Pro Ile Asp Ile Ser Ile Glu Leu Asn Lys Ala Lys Ser 1 5 10 15 Asp Leu Glu Glu Ser Lys Glu Trp Ile Arg Arg Ser Asn Gln Lys Leu 20 25 30 Asp Ser Ile 35 <210> SEQ ID NO 40 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 40 Leu Asp Pro Ile Asp Ile Ser Ile Glu Leu Asn Lys Ala Lys Ser Asp 1 5 10 15 Leu Glu Glu Ser Lys Glu Trp Ile Arg Arg Ser Asn Gln Lys Leu Asp 20 25 30 Ser Ile Gly 35 <210> SEQ ID NO 41 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 41 Asp Pro Ile Asp Ile Ser Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu 1 5 10 15 Glu Glu Ser Lys Glu Trp Ile Arg Arg Ser Asn Gln Lys Leu Asp Ser 20 25 30 Ile Gly Asn 35 <210> SEQ ID NO 42 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 42 Pro Ile Asp Ile Ser Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu 1 5 10 15 Glu Ser Lys Glu Trp Ile Arg Arg Ser Asn Gln Lys Leu Asp Ser Ile 20 25 30 Gly Asn Trp 35 <210> SEQ ID NO 43 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 43 Ile Asp Ile Ser Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu 1 5 10 15 Ser Lys Glu Trp Ile Arg Arg Ser Asn Gln Lys Leu Asp Ser Ile Gly 20 25 30 Asn Trp His 35 <210> SEQ ID NO 44 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 44 Asp Ile Ser Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser 1 5 10 15 Lys Glu Trp Ile Arg Arg Ser Asn Gln Lys Leu Asp Ser Ile Gly Asn 20 25 30 Trp His Gln 35 <210> SEQ ID NO 45 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 45 Ile Ser Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys 1 5 10 15 Glu Trp Ile Arg Arg Ser Asn Gln Lys Leu Asp Ser Ile Gly Asn Trp 20 25 30 His Gln Ser 35 <210> SEQ ID NO 46 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 46 Ser Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu 1 5 10 15 Trp Ile Arg Arg Ser Asn Gln Lys Leu Asp Ser Ile Gly Asn Trp His 20 25 30 Gln Ser Ser 35 <210> SEQ ID NO 47 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 47 Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu Trp 1 5 10 15 Ile Arg Arg Ser Asn Gln Lys Leu Asp Ser Ile Gly Asn Trp His Gln 20 25 30 Ser Ser Thr 35 <210> SEQ ID NO 48 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 48 Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu Trp Ile 1 5 10 15 Arg Arg Ser Asn Gln Lys Leu Asp Ser Ile Gly Asn Trp His Gln Ser 20 25 30 Ser Thr Thr 35 <210> SEQ ID NO 49 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 49 Thr Ala Ala Val Ala Leu Val Glu Ala Lys Gln Ala Arg Ser Asp Ile 1 5 10 15 Glu Lys Leu Lys Glu Ala Ile Arg Asp Thr Asn Lys Ala Val Gln Ser 20 25 30 Val Gln Ser 35 <210> SEQ ID NO 50 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 50 Ala Val Ala Leu Val Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys 1 5 10 15 Leu Lys Glu Ala Ile Arg Asp Thr Asn Lys Ala Val Gln Ser Val Gln 20 25 30 Ser Ser Ile 35 <210> SEQ ID NO 51 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 51 Leu Val Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys Glu 1 5 10 15 Ala Ile Arg Asp Thr Asn Lys Ala Val Gln Ser Val Gln Ser Ser Ile 20 25 30 Gly Asn Leu 35 <210> SEQ ID NO 52 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 52 Val Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys Glu Ala 1 5 10 15 Ile Arg Asp Thr Asn Lys Ala Val Gln Ser Val Gln Ser Ser Ile Gly 20 25 30 Asn Leu Ile 35 <210> SEQ ID NO 53 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 53 Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys Glu Ala Ile 1 5 10 15 Arg Asp Thr Asn Lys Ala Val Gln Ser Val Gln Ser Ser Ile Gly Asn 20 25 30 Leu Ile Val 35 <210> SEQ ID NO 54 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 54 Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys Glu Ala Ile Arg 1 5 10 15 Asp Thr Asn Lys Ala Val Gln Ser Val Gln Ser Ser Ile Gly Asn Leu 20 25 30 Ile Val Ala 35 <210> SEQ ID NO 55 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 55 Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys Glu Ala Ile Arg Asp 1 5 10 15 Thr Asn Lys Ala Val Gln Ser Val Gln Ser Ser Ile Gly Asn Leu Ile 20 25 30 Val Ala Ile 35 <210> SEQ ID NO 56 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 56 Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys Glu Ala Ile Arg Asp Thr 1 5 10 15 Asn Lys Ala Val Gln Ser Val Gln Ser Ser Ile Gly Asn Leu Ile Val 20 25 30 Ala Ile Lys 35 <210> SEQ ID NO 57 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 57 Ala Arg Ser Asp Ile Glu Lys Leu Lys Glu Ala Ile Arg Asp Thr Asn 1 5 10 15 Lys Ala Val Gln Ser Val Gln Ser Ser Ile Gly Asn Leu Ile Val Ala 20 25 30 Ile Lys Ser 35 <210> SEQ ID NO 58 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 58 Arg Ser Asp Ile Glu Lys Leu Lys Glu Ala Ile Arg Asp Thr Asn Lys 1 5 10 15 Ala Val Gln Ser Val Gln Ser Ser Ile Gly Asn Leu Ile Val Ala Ile 20 25 30 Lys Ser Val 35 <210> SEQ ID NO 59 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 59 Ser Asp Ile Glu Lys Leu Lys Glu Ala Ile Arg Asp Thr Asn Lys Ala 1 5 10 15 Val Gln Ser Val Gln Ser Ser Ile Gly Asn Leu Ile Val Ala Ile Lys 20 25 30 Ser Val Gln 35 <210> SEQ ID NO 60 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 60 Lys Leu Lys Glu Ala Ile Arg Asp Thr Asn Lys Ala Val Gln Ser Val 1 5 10 15 Gln Ser Ser Ile Gly Asn Leu Ile Val Ala Ile Lys Ser Val Gln Asp 20 25 30 Tyr Val Asn 35 <210> SEQ ID NO 61 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 61 Leu Lys Glu Ala Ile Arg Asp Thr Asn Lys Ala Val Gln Ser Val Gln 1 5 10 15 Ser Ser Ile Gly Asn Leu Ile Val Ala Ile Lys Ser Val Gln Asp Tyr 20 25 30 Val Asn Lys 35 <210> SEQ ID NO 62 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 62 Ala Ile Arg Asp Thr Asn Lys Ala Val Gln Ser Val Gln Ser Ser Ile 1 5 10 15 Gly Asn Leu Ile Val Ala Ile Lys Ser Val Gln Asp Tyr Val Asn Lys 20 25 30 Glu Ile Val 35 <210> SEQ ID NO 63 <211> LENGTH: 47 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 63 Thr Trp Gln Glu Trp Glu Arg Lys Val Asp Phe Leu Glu Glu Asn Ile 1 5 10 15 Thr Ala Leu Leu Glu Glu Ala Gln Ile Gln Gln Glu Lys Asn Met Tyr 20 25 30 Glu Leu Gln Lys Leu Asn Ser Trp Asp Val Phe Gly Asn Trp Phe 35 40 45 <210> SEQ ID NO 64 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 64 Trp Gln Glu Trp Glu Arg Lys Val Asp Phe Leu Glu Glu Asn Ile Thr 1 5 10 15 Ala Leu Leu Glu Glu Ala Gln Ile Gln Gln Glu Lys Asn Met Tyr Glu 20 25 30 Leu Gln Lys 35 <210> SEQ ID NO 65 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 65 Gln Glu Trp Glu Arg Lys Val Asp Phe Leu Glu Glu Asn Ile Thr Ala 1 5 10 15 Leu Leu Glu Glu Ala Gln Ile Gln Gln Glu Lys Asn Met Tyr Glu Leu 20 25 30 Gln Lys Leu 35 <210> SEQ ID NO 66 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 66 Glu Trp Glu Arg Lys Val Asp Phe Leu Glu Glu Asn Ile Thr Ala Leu 1 5 10 15 Leu Glu Glu Ala Gln Ile Gln Gln Glu Lys Asn Met Tyr Glu Leu Gln 20 25 30 Lys Leu Asn 35 <210> SEQ ID NO 67 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 67 Trp Glu Arg Lys Val Asp Phe Leu Glu Glu Asn Ile Thr Ala Leu Leu 1 5 10 15 Glu Glu Ala Gln Ile Gln Gln Glu Lys Asn Met Tyr Glu Leu Gln Lys 20 25 30 Leu Asn Ser 35 <210> SEQ ID NO 68 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 68 Glu Arg Lys Val Asp Phe Leu Glu Glu Asn Ile Thr Ala Leu Leu Glu 1 5 10 15 Glu Ala Gln Ile Gln Gln Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu 20 25 30 Asn Ser Trp 35 <210> SEQ ID NO 69 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 69 Arg Lys Val Asp Phe Leu Glu Glu Asn Ile Thr Ala Leu Leu Glu Glu 1 5 10 15 Ala Gln Ile Gln Gln Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn 20 25 30 Ser Trp Asp 35 <210> SEQ ID NO 70 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 70 Lys Val Asp Phe Leu Glu Glu Asn Ile Thr Ala Leu Leu Glu Glu Ala 1 5 10 15 Gln Ile Gln Gln Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser 20 25 30 Trp Asp Val 35 <210> SEQ ID NO 71 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 71 Val Asp Phe Leu Glu Glu Asn Ile Thr Ala Leu Leu Glu Glu Ala Gln 1 5 10 15 Ile Gln Gln Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp 20 25 30 Asp Val Phe 35 <210> SEQ ID NO 72 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 72 Asp Phe Leu Glu Glu Asn Ile Thr Ala Leu Leu Glu Glu Ala Gln Ile 1 5 10 15 Gln Gln Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp 20 25 30 Val Phe Gly 35 <210> SEQ ID NO 73 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 73 Phe Leu Glu Glu Asn Ile Thr Ala Leu Leu Glu Glu Ala Gln Ile Gln 1 5 10 15 Gln Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp Val 20 25 30 Phe Gly Asn 35 <210> SEQ ID NO 74 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 74 Pro Asp Ala Val Tyr Leu His Arg Ile Asp Leu Gly Pro Pro Ile Ser 1 5 10 15 Leu Glu Arg Leu Asp Val Gly Thr Asn Leu Gly Asn Ala Ile Ala Lys 20 25 30 Leu Glu Asp 35 <210> SEQ ID NO 75 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 75 Leu Glu Arg Leu Asp Val Gly Thr Asn Leu Gly Asn Ala Ile Ala Lys 1 5 10 15 Leu Glu Ala Lys Glu Leu Leu Glu Ser Ser Asp Gln Ile Leu Arg Ser 20 25 30 Met Lys <210> SEQ ID NO 76 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 76 Leu His Arg Ile Asp Leu Gly Pro Pro Ile Ser Leu Glu Arg Leu Asp 1 5 10 15 Val Gly Thr Asn Leu Gly Asn Ala Ile Ala Lys Leu Glu Ala Lys Glu 20 25 30 Leu Leu <210> SEQ ID NO 77 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 77 His Arg Ile Asp Leu Gly Pro Pro Ile Ser Leu Glu Arg Leu Asp Val 1 5 10 15 Gly Thr Asn Leu Gly Asn Ala Ile Ala Lys Leu Glu Ala Lys Glu Leu 20 25 30 Leu Glu <210> SEQ ID NO 78 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 78 Arg Ile Asp Leu Gly Pro Pro Ile Ser Leu Glu Arg Leu Asp Val Gly 1 5 10 15 Thr Asn Leu Gly Asn Ala Ile Ala Lys Leu Glu Ala Lys Glu Leu Leu 20 25 30 Glu Ser <210> SEQ ID NO 79 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 79 Ile Asp Leu Gly Pro Pro Ile Ser Leu Glu Arg Leu Asp Val Gly Thr 1 5 10 15 Asn Leu Gly Asn Ala Ile Ala Lys Leu Glu Ala Lys Glu Leu Leu Glu 20 25 30 Ser Ser <210> SEQ ID NO 80 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 80 Asp Leu Gly Pro Pro Ile Ser Leu Glu Arg Leu Asp Val Gly Thr Asn 1 5 10 15 Leu Gly Asn Ala Ile Ala Lys Leu Glu Ala Lys Glu Leu Leu Glu Ser 20 25 30 Ser Asp <210> SEQ ID NO 81 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 81 Leu Gly Pro Pro Ile Ser Leu Glu Arg Leu Asp Val Gly Thr Asn Leu 1 5 10 15 Gly Asn Ala Ile Ala Lys Leu Glu Ala Lys Glu Leu Leu Glu Ser Ser 20 25 30 Asp Gln <210> SEQ ID NO 82 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 82 Gly Pro Pro Ile Ser Leu Glu Arg Leu Asp Val Gly Thr Asn Leu Gly 1 5 10 15 Asn Ala Ile Ala Lys Leu Glu Ala Lys Glu Leu Leu Glu Ser Ser Asp 20 25 30 Gln Ile <210> SEQ ID NO 83 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 83 Pro Pro Ile Ser Leu Glu Arg Leu Asp Val Gly Thr Asn Leu Gly Asn 1 5 10 15 Ala Ile Ala Lys Leu Glu Ala Lys Glu Leu Leu Glu Ser Ser Asp Gln 20 25 30 Ile Leu <210> SEQ ID NO 84 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 84 Pro Ile Ser Leu Glu Arg Leu Asp Val Gly Thr Asn Leu Gly Asn Ala 1 5 10 15 Ile Ala Lys Leu Glu Ala Lys Glu Leu Leu Glu Ser Ser Asp Gln Ile 20 25 30 Leu Arg <210> SEQ ID NO 85 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 85 Ser Leu Glu Arg Leu Asp Val Gly Thr Asn Leu Gly Asn Ala Ile Ala 1 5 10 15 Lys Leu Glu Ala Lys Glu Leu Leu Glu Ser Ser Asp Gln Ile Leu Arg 20 25 30 Ser Met <210> SEQ ID NO 86 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 86 Leu Glu Arg Leu Asp Val Gly Thr Asn Leu Gly Asn Ala Ile Ala Lys 1 5 10 15 Leu Glu Ala Lys Glu Leu Leu Glu Ser Ser Asp Gln Ile Leu Arg Ser 20 25 30 Met Lys <210> SEQ ID NO 87 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 87 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 20 25 30 Trp Asn Trp 35 <210> SEQ ID NO 88 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 88 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 20 25 30 Trp Asn <210> SEQ ID NO 89 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 89 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 20 25 30 Trp <210> SEQ ID NO 90 <211> LENGTH: 32 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 90 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 20 25 30 <210> SEQ ID NO 91 <211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 91 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser 20 25 30 <210> SEQ ID NO 92 <211> LENGTH: 30 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 92 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala 20 25 30 <210> SEQ ID NO 93 <211> LENGTH: 29 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 93 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp 20 25 <210> SEQ ID NO 94 <211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 94 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys 20 25 <210> SEQ ID NO 95 <211> LENGTH: 27 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 95 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp 20 25 <210> SEQ ID NO 96 <211> LENGTH: 26 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 96 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu 20 25 <210> SEQ ID NO 97 <211> LENGTH: 25 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 97 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu 20 25 <210> SEQ ID NO 98 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 98 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu 20 <210> SEQ ID NO 99 <211> LENGTH: 23 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 99 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu 20 <210> SEQ ID NO 100 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 100 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu 20 <210> SEQ ID NO 101 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 101 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln 20 <210> SEQ ID NO 102 <211> LENGTH: 20 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 102 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu 20 <210> SEQ ID NO 103 <211> LENGTH: 19 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 103 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn <210> SEQ ID NO 104 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 104 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys <210> SEQ ID NO 105 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 105 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu <210> SEQ ID NO 106 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 106 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 <210> SEQ ID NO 107 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 107 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln 1 5 10 15 <210> SEQ ID NO 108 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 108 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn 1 5 10 <210> SEQ ID NO 109 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 109 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln 1 5 10 <210> SEQ ID NO 110 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 110 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser 1 5 10 <210> SEQ ID NO 111 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 111 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu Glu 1 5 10 <210> SEQ ID NO 112 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 112 Tyr Thr Ser Leu Ile His Ser Leu Ile Glu 1 5 10 <210> SEQ ID NO 113 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 113 Tyr Thr Ser Leu Ile His Ser Leu Ile 1 5 <210> SEQ ID NO 114 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 114 Tyr Thr Ser Leu Ile His Ser Leu 1 5 <210> SEQ ID NO 115 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 115 Tyr Thr Ser Leu Ile His Ser 1 5 <210> SEQ ID NO 116 <211> LENGTH: 6 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 116 Tyr Thr Ser Leu Ile His 1 5 <210> SEQ ID NO 117 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 117 Thr Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 20 25 30 Trp Asn Trp Phe 35 <210> SEQ ID NO 118 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 118 Ser Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 15 20 25 30 Trp Asn Trp Phe <210> SEQ ID NO 119 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 119 Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 15 20 25 Trp Asn Trp Phe 30 <210> SEQ ID NO 120 <211> LENGTH: 32 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 120 Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 15 20 25 Trp Asn Trp Phe 30 <210> SEQ ID NO 121 <211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 121 His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 15 20 25 Trp Asn Trp Phe 30 <210> SEQ ID NO 122 <211> LENGTH: 30 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 122 Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 15 20 25 Trp Asn Trp Phe 30 <210> SEQ ID NO 123 <211> LENGTH: 29 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 123 Leu Ile Glu Glu Ser Gln Asn Gln Gln Glu Lys Asn Glu Gln Glu 1 5 10 15 Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu Trp Asn Trp Phe 20 25 <210> SEQ ID NO 124 <211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 124 Ile Glu Glu Ser Gln Asn Gln Gln Glu Lys Asn Glu Gln Glu 1 5 10 Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu Trp Asn Trp Phe 15 20 25 <210> SEQ ID NO 125 <211> LENGTH: 27 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 125 Glu Glu Ser Gln Asn Gln Gln Glu Lys Asn Glu Gln Glu 1 5 10 Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu Trp Asn Trp Phe 15 20 25 <210> SEQ ID NO 126 <211> LENGTH: 26 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 126 Glu Ser Gln Asn Gln Gln Glu Lys Asn Glu Gln Glu 1 5 10 Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu Trp Asn Trp Phe 15 20 25 <210> SEQ ID NO 127 <211> LENGTH: 25 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 127 Ser Gln Asn Gln Gln Glu Lys Asn Glu Gln Glu 1 5 10 Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu Trp Asn Trp Phe 15 20 25 <210> SEQ ID NO 128 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 128 Gln Asn Gln Gln Glu Lys Asn Glu Gln Glu 1 5 10 Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu Trp Asn Trp Phe 15 20 <210> SEQ ID NO 129 <211> LENGTH: 23 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 129 Asn Gln Gln Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys 1 5 10 15 Trp Ala Ser Leu Trp Asn Trp Phe 20 <210> SEQ ID NO 130 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 130 Gln Gln Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp 1 5 10 15 Ala Ser Leu Trp Asn Trp Phe 20 <210> SEQ ID NO 131 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 131 Gln Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala 1 5 10 15 Ser Leu Trp Asn Trp Phe 20 <210> SEQ ID NO 132 <211> LENGTH: 20 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 132 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser 1 5 10 15 Leu Trp Asn Trp Phe 20 <210> SEQ ID NO 133 <211> LENGTH: 19 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 133 Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 1 5 10 15 Trp Asn Trp Phe <210> SEQ ID NO 134 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 134 Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser 1 5 10 Leu Trp Asn Trp Phe 15 <210> SEQ ID NO 135 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 135 Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser 1 5 10 Leu Trp Asn Trp Phe 15 <210> SEQ ID NO 136 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 136 Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu Trp Asn Trp Phe 1 5 10 15 <210> SEQ ID NO 137 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 137 Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu Trp Asn Trp Phe 1 5 10 15 <210> SEQ ID NO 138 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 138 Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu Trp Asn Trp Phe 1 5 10 <210> SEQ ID NO 139 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 139 Leu Glu Leu Asp Lys Trp Ala Ser Leu Trp Asn Trp Phe 1 5 10 <210> SEQ ID NO 140 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 140 Glu Leu Asp Lys Trp Ala Ser Leu Trp Asn Trp Phe 1 5 10 <210> SEQ ID NO 141 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 141 Leu Asp Lys Trp Ala Ser Leu Trp Asn Trp Phe 1 5 10 <210> SEQ ID NO 142 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 142 Asp Lys Trp Ala Ser Leu Trp Asn Trp Phe 1 5 10 <210> SEQ ID NO 143 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 143 Lys Trp Ala Ser Leu Trp Asn Trp Phe 1 5 <210> SEQ ID NO 144 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 144 Trp Ala Ser Leu Trp Asn Trp Phe 1 5 <210> SEQ ID NO 145 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 145 Ala Ser Leu Trp Asn Trp Phe 1 5 <210> SEQ ID NO 146 <211> LENGTH: 6 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 146 Ser Leu Trp Asn Trp Phe 1 5 <210> SEQ ID NO 147 <211> LENGTH: 37 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 147 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu 20 25 30 Arg Tyr Leu Lys Asp 35 <210> SEQ ID NO 148 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 148 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu 20 25 30 Arg Tyr Leu Lys 35 <210> SEQ ID NO 149 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 149 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu 20 25 30 Arg Tyr Leu 35 <210> SEQ ID NO 150 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 150 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu 20 25 30 Arg Tyr <210> SEQ ID NO 151 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 151 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu 20 25 30 Arg <210> SEQ ID NO 152 <211> LENGTH: 32 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 152 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu 20 25 30 <210> SEQ ID NO 153 <211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 153 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val 20 25 30 <210> SEQ ID NO 154 <211> LENGTH: 30 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 154 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala 20 25 30 <210> SEQ ID NO 155 <211> LENGTH: 29 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 155 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu 20 25 <210> SEQ ID NO 156 <211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 156 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile 20 25 <210> SEQ ID NO 157 <211> LENGTH: 27 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 157 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg 20 25 <210> SEQ ID NO 158 <211> LENGTH: 26 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 158 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln Leu Gln Ala 20 25 <210> SEQ ID NO 159 <211> LENGTH: 25 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 159 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln Leu Gln 20 25 <210> SEQ ID NO 160 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 160 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln Leu 20 <210> SEQ ID NO 161 <211> LENGTH: 23 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 161 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln 20 <210> SEQ ID NO 162 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 162 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys 20 <210> SEQ ID NO 163 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 163 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile 20 <210> SEQ ID NO 164 <211> LENGTH: 20 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 164 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln 20 <210> SEQ ID NO 165 <211> LENGTH: 19 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 165 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp <210> SEQ ID NO 166 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 166 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val <210> SEQ ID NO 167 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 167 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr <210> SEQ ID NO 168 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 168 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 <210> SEQ ID NO 169 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 169 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln 1 5 10 15 <210> SEQ ID NO 170 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 170 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu 1 5 10 <210> SEQ ID NO 171 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 171 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu 1 5 10 <210> SEQ ID NO 172 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 172 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His 1 5 10 <210> SEQ ID NO 173 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 173 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln 1 5 10 <210> SEQ ID NO 174 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 174 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln 1 5 10 <210> SEQ ID NO 175 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 175 Asn Asn Leu Leu Arg Ala Ile Glu Ala 1 5 <210> SEQ ID NO 176 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 176 Asn Asn Leu Leu Arg Ala Ile Glu 1 5 <210> SEQ ID NO 177 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 177 Asn Asn Leu Leu Arg Ala Ile 1 5 <210> SEQ ID NO 178 <211> LENGTH: 6 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 178 Asn Asn Leu Leu Arg Ala 1 5 <210> SEQ ID NO 179 <211> LENGTH: 37 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 179 Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu 20 25 30 Arg Tyr Leu Lys Asp Gln 35 <210> SEQ ID NO 180 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 180 Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu Thr 1 5 10 15 Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu 20 25 30 Arg Tyr Leu Lys Asp Gln 35 <210> SEQ ID NO 181 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 181 Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu Thr Val 1 5 10 15 Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu Arg 20 25 30 Tyr Leu Lys Asp Gln 35 <210> SEQ ID NO 182 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 182 Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu Thr Val Trp 1 5 10 15 Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu Arg Tyr 20 25 30 Leu Lys Asp Gln <210> SEQ ID NO 183 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 183 Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu Thr Val Trp Gln 1 5 10 15 Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu Arg Tyr Leu 20 25 30 Lys Asp Gln <210> SEQ ID NO 184 <211> LENGTH: 32 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 184 Ile Glu Ala Gln Gln His Leu Leu Gln Leu Thr Val Trp Gln Ile 1 5 10 15 Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu Arg Tyr Leu Lys 20 25 30 Asp Gln <210> SEQ ID NO 185 <211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 185 Glu Ala Gln Gln His Leu Leu Gln Leu Thr Val Trp Gln Ile Lys 1 5 10 15 Gln Leu Gln Ala Arg Ile Leu Ala Val Glu Arg Tyr Leu Lys Asp 20 25 30 Gln <210> SEQ ID NO 186 <211> LENGTH: 30 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 186 Ala Gln Gln His Leu Leu Gln Leu Thr Val Trp Gln Ile Lys Gln 1 5 10 15 Leu Gln Ala Arg Ile Leu Ala Val Glu Arg Tyr Leu Lys Asp Gln 20 25 30 <210> SEQ ID NO 187 <211> LENGTH: 29 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 187 Gln Gln His Leu Leu Gln Leu Thr Val Trp Gln Ile Lys Gln Leu 1 5 10 15 Gln Ala Arg Ile Leu Ala Val Glu Arg Tyr Leu Lys Asp Gln 20 25 <210> SEQ ID NO 188 <211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 188 Gln His Leu Leu Gln Leu Thr Val Trp Gln Ile Lys Gln Leu Gln 1 5 10 15 Ala Arg Ile Leu Ala Val Glu Arg Tyr Leu Lys Asp Gln 20 25 <210> SEQ ID NO 189 <211> LENGTH: 27 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 189 His Leu Leu Gln Leu Thr Val Trp Gln Ile Lys Gln Leu Gln Ala 1 5 10 15 Arg Ile Leu Ala Val Glu Arg Tyr Leu Lys Asp Gln 20 25 <210> SEQ ID NO 190 <211> LENGTH: 26 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 190 Leu Leu Gln Leu Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg 1 5 10 15 Ile Leu Ala Val Glu Arg Tyr Leu Lys Asp Gln 20 25 <210> SEQ ID NO 191 <211> LENGTH: 25 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 191 Leu Gln Leu Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile 1 5 10 15 Leu Ala Val Glu Arg Tyr Leu Lys Asp Gln 20 25 <210> SEQ ID NO 192 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 192 Gln Leu Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu 1 5 10 15 Ala Val Glu Arg Tyr Leu Lys Asp Gln 20 <210> SEQ ID NO 193 <211> LENGTH: 23 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 193 Leu Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala 1 5 10 15 Val Glu Arg Tyr Leu Lys Asp Gln 20 <210> SEQ ID NO 194 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 194 Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val 1 5 10 15 Glu Arg Tyr Leu Lys Asp Gln 20 <210> SEQ ID NO 195 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 195 Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu 1 5 10 15 Arg Tyr Leu Lys Asp Gln 20 <210> SEQ ID NO 196 <211> LENGTH: 20 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 196 Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu Arg 1 5 10 15 Tyr Leu Lys Asp Gln 20 <210> SEQ ID NO 197 <211> LENGTH: 19 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 197 Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu Arg Tyr 1 5 10 15 Leu Lys Asp Gln <210> SEQ ID NO 198 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 198 Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu Arg Tyr Leu 1 5 10 15 Lys Asp Gln <210> SEQ ID NO 199 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 199 Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu Arg Tyr Leu Lys 1 5 10 15 Asp Gln <210> SEQ ID NO 200 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 200 Gln Leu Gln Ala Arg Ile Leu Ala Val Glu Arg Tyr Leu Lys Asp Gln 1 5 10 15 <210> SEQ ID NO 201 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 201 Leu Gln Ala Arg Ile Leu Ala Val Glu Arg Tyr Leu Lys Asp Gln 1 5 10 15 <210> SEQ ID NO 202 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 202 Gln Ala Arg Ile Leu Ala Val Glu Arg Tyr Leu Lys Asp Gln 1 5 10 <210> SEQ ID NO 203 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 203 Ala Arg Ile Leu Ala Val Glu Arg Tyr Leu Lys Asp Gln 1 5 10 <210> SEQ ID NO 204 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 204 Arg Ile Leu Ala Val Glu Arg Tyr Leu Lys Asp Gln 1 5 10 <210> SEQ ID NO 205 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 205 Ile Leu Ala Val Glu Arg Tyr Leu Lys Asp Gln 1 5 10 <210> SEQ ID NO 206 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 206 Leu Ala Val Glu Arg Tyr Leu Lys Asp Gln 1 5 10 <210> SEQ ID NO 207 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 207 Ala Val Glu Arg Tyr Leu Lys Asp Gln 1 5 <210> SEQ ID NO 208 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 208 Val Glu Arg Tyr Leu Lys Asp Gln 1 5 <210> SEQ ID NO 209 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 209 Glu Arg Tyr Leu Lys Asp Gln 1 5 <210> SEQ ID NO 210 <211> LENGTH: 6 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 210 Arg Tyr Leu Lys Asp Gln 1 5 <210> SEQ ID NO 211 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 211 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp Val Phe 20 25 30 Thr Asn Trp 35 <210> SEQ ID NO 212 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 212 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp Val Phe 20 25 30 Thr Asn <210> SEQ ID NO 213 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 213 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp Val Phe 20 25 30 Thr <210> SEQ ID NO 214 <211> LENGTH: 32 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 214 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp Val Phe 20 25 30 <210> SEQ ID NO 215 <211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 215 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp Val 20 25 30 <210> SEQ ID NO 216 <211> LENGTH: 30 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 216 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp 20 25 30 <210> SEQ ID NO 217 <211> LENGTH: 29 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 217 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp 20 25 <210> SEQ ID NO 218 <211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 218 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser 20 25 <210> SEQ ID NO 219 <211> LENGTH: 27 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 219 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn 20 25 <210> SEQ ID NO 220 <211> LENGTH: 26 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 220 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu 20 25 <210> SEQ ID NO 221 <211> LENGTH: 25 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 221 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys Asn Met Tyr Glu Leu Gln Lys 20 25 <210> SEQ ID NO 222 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 222 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys Asn Met Tyr Glu Leu Gln 20 <210> SEQ ID NO 223 <211> LENGTH: 23 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 223 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys Asn Met Tyr Glu Leu 20 <210> SEQ ID NO 224 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 224 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys Asn Met Tyr Glu 20 <210> SEQ ID NO 225 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 225 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys Asn Met Tyr 20 <210> SEQ ID NO 226 <211> LENGTH: 20 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 226 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys Asn Met 20 <210> SEQ ID NO 227 <211> LENGTH: 19 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 227 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys Asn <210> SEQ ID NO 228 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 228 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys <210> SEQ ID NO 229 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 229 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu <210> SEQ ID NO 230 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 230 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 <210> SEQ ID NO 231 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 231 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln 1 5 10 15 <210> SEQ ID NO 232 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 232 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile 1 5 10 <210> SEQ ID NO 233 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 233 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln 1 5 10 <210> SEQ ID NO 234 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 234 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala 1 5 10 <210> SEQ ID NO 235 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 235 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln 1 5 10 <210> SEQ ID NO 236 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 236 Leu Glu Ala Asn Ile Ser Gln Ser Leu Glu 1 5 10 <210> SEQ ID NO 237 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 237 Leu Glu Ala Asn Ile Ser Gln Ser Leu 1 5 <210> SEQ ID NO 238 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 238 Leu Glu Ala Asn Ile Ser Gln Ser 1 5 <210> SEQ ID NO 239 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 239 Leu Glu Ala Asn Ile Ser Gln 1 5 <210> SEQ ID NO 240 <211> LENGTH: 6 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 240 Leu Glu Ala Asn Ile Ser 1 5 <210> SEQ ID NO 241 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 241 Glu Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln 1 5 10 15 Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp Val Phe 20 25 30 Thr Asn Trp Leu 35 <210> SEQ ID NO 242 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 242 Ala Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln Glu 1 5 10 15 Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp Val Phe 20 25 30 Thr Asn Trp Leu <210> SEQ ID NO 243 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 243 Asn Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln Glu Lys 1 5 10 15 Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp Val Phe Thr 20 25 30 Asn Trp Leu <210> SEQ ID NO 244 <211> LENGTH: 32 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 244 Ile Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln Glu Lys Asn 1 5 10 15 Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp Val Phe Thr Asn 20 25 30 Trp Leu <210> SEQ ID NO 245 <211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 245 Ser Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln Glu Lys Asn Met 1 5 10 15 Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp Val Phe Thr Asn Trp 20 25 30 Leu <210> SEQ ID NO 246 <211> LENGTH: 30 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 246 Gln Ser Leu Glu Gln Ala Gln Ile Gln Gln Glu Lys Asn Met Tyr 1 5 10 15 Glu Leu Gln Lys Leu Asn Ser Trp Asp Val Phe Thr Asn Trp Leu 20 25 30 <210> SEQ ID NO 247 <211> LENGTH: 29 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 247 Ser Leu Glu Gln Ala Gln Ile Gln Gln Glu Lys Asn Met Tyr Glu 1 5 10 15 Leu Gln Lys Leu Asn Ser Trp Asp Val Phe Thr Asn Trp Leu 20 25 <210> SEQ ID NO 248 <211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 248 Leu Glu Gln Ala Gln Ile Gln Gln Glu Lys Asn Met Tyr Glu Leu 1 5 10 15 Gln Lys Leu Asn Ser Trp Asp Val Phe Thr Asn Trp Leu 20 25 <210> SEQ ID NO 249 <211> LENGTH: 27 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 249 Glu Gln Ala Gln Ile Gln Gln Glu Lys Asn Met Tyr Glu Leu Gln 1 5 10 15 Lys Leu Asn Ser Trp Asp Val Phe Thr Asn Trp Leu 20 25 <210> SEQ ID NO 250 <211> LENGTH: 26 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 250 Gln Ala Gln Ile Gln Gln Glu Lys Asn Met Tyr Glu Leu Gln Lys 1 5 10 15 Leu Asn Ser Trp Asp Val Phe Thr Asn Trp Leu 20 25 <210> SEQ ID NO 251 <211> LENGTH: 25 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 251 Ala Gln Ile Gln Gln Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu 1 5 10 15 Asn Ser Trp Asp Val Phe Thr Asn Trp Leu 20 25 <210> SEQ ID NO 252 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 252 Gln Ile Gln Gln Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn 1 5 10 15 Ser Trp Asp Val Phe Thr Asn Trp Leu 20 <210> SEQ ID NO 253 <211> LENGTH: 23 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 253 Ile Gln Gln Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser 1 5 10 15 Trp Asp Val Phe Thr Asn Trp Leu 20 <210> SEQ ID NO 254 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 254 Gln Gln Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp 1 5 10 15 Asp Val Phe Thr Asn Trp Leu 20 <210> SEQ ID NO 255 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 255 Gln Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp 1 5 10 15 Val Phe Thr Asn Trp Leu 20 <210> SEQ ID NO 256 <211> LENGTH: 20 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 256 Glu Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp Val 1 5 10 15 Phe Thr Asn Trp Leu 20 <210> SEQ ID NO 257 <211> LENGTH: 19 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 257 Lys Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp Val Phe 1 5 10 15 Thr Asn Trp Leu <210> SEQ ID NO 258 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 258 Asn Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp Val Phe Thr 1 5 10 15 Asn Trp Leu <210> SEQ ID NO 259 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 259 Met Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp Val Phe Thr Asn 1 5 10 15 Trp Leu <210> SEQ ID NO 260 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 260 Tyr Glu Leu Gln Lys Leu Asn Ser Trp Asp Val Phe Thr Asn Trp Leu 1 5 10 15 <210> SEQ ID NO 261 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 261 Glu Leu Gln Lys Leu Asn Ser Trp Asp Val Phe Thr Asn Trp Leu 1 5 10 15 <210> SEQ ID NO 262 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 262 Leu Gln Lys Leu Asn Ser Trp Asp Val Phe Thr Asn Trp Leu 1 5 10 <210> SEQ ID NO 263 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 263 Gln Lys Leu Asn Ser Trp Asp Val Phe Thr Asn Trp Leu 1 5 10 <210> SEQ ID NO 264 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 264 Lys Leu Asn Ser Trp Asp Val Phe Thr Asn Trp Leu 1 5 10 <210> SEQ ID NO 265 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 265 Leu Asn Ser Trp Asp Val Phe Thr Asn Trp Leu 1 5 10 <210> SEQ ID NO 266 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 266 Asn Ser Trp Asp Val Phe Thr Asn Trp Leu 1 5 10 <210> SEQ ID NO 267 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 267 Ser Trp Asp Val Phe Thr Asn Trp Leu 1 5 <210> SEQ ID NO 268 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 268 Trp Asp Val Phe Thr Asn Trp Leu 1 5 <210> SEQ ID NO 269 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 269 Asp Val Phe Thr Asn Trp Leu 1 5 <210> SEQ ID NO 270 <211> LENGTH: 6 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 270 Val Phe Thr Asn Trp Leu 1 5 <210> SEQ ID NO 271 <211> LENGTH: 47 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 271 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp 20 25 30 Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu Met Gln Ser 35 40 45 <210> SEQ ID NO 272 <211> LENGTH: 46 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 272 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp 20 25 30 Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu Met Gln 35 40 45 <210> SEQ ID NO 273 <211> LENGTH: 45 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 273 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp 20 25 30 Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu Met 35 40 45 <210> SEQ ID NO 274 <211> LENGTH: 44 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 274 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp 20 25 30 Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu 35 40 <210> SEQ ID NO 275 <211> LENGTH: 43 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 275 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp 20 25 30 Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu 35 40 <210> SEQ ID NO 276 <211> LENGTH: 42 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 276 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp 20 25 30 Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln 35 40 <210> SEQ ID NO 277 <211> LENGTH: 41 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 277 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp 20 25 30 Lys Tyr Lys Asn Ala Val Thr Glu Leu 35 40 <210> SEQ ID NO 278 <211> LENGTH: 40 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 278 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp 20 25 30 Lys Tyr Lys Asn Ala Val Thr Glu 35 40 <210> SEQ ID NO 279 <211> LENGTH: 39 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 279 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp 20 25 30 Lys Tyr Lys Asn Ala Val Thr 35 <210> SEQ ID NO 280 <211> LENGTH: 38 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 280 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp 20 25 30 Lys Tyr Lys Asn Ala Val 35 <210> SEQ ID NO 281 <211> LENGTH: 37 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 281 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp 20 25 30 Lys Tyr Lys Asn Ala 35 <210> SEQ ID NO 282 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 282 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp 20 25 30 Lys Tyr Lys Asn 35 <210> SEQ ID NO 283 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 283 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp 20 25 30 Lys Tyr Lys 35 <210> SEQ ID NO 284 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 284 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp 20 25 30 Lys Tyr <210> SEQ ID NO 285 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 285 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp 20 25 30 Lys <210> SEQ ID NO 286 <211> LENGTH: 32 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 286 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp 20 25 30 <210> SEQ ID NO 287 <211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 287 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu 20 25 30 <210> SEQ ID NO 288 <211> LENGTH: 30 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 288 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu 20 25 30 <210> SEQ ID NO 289 <211> LENGTH: 29 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 289 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln 20 25 <210> SEQ ID NO 290 <211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 290 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys 20 25 <210> SEQ ID NO 291 <211> LENGTH: 27 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 291 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile 20 25 <210> SEQ ID NO 292 <211> LENGTH: 26 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 292 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu 20 25 <210> SEQ ID NO 293 <211> LENGTH: 25 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 293 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys 20 25 <210> SEQ ID NO 294 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 294 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val 20 <210> SEQ ID NO 295 <211> LENGTH: 23 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 295 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys 20 <210> SEQ ID NO 296 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 296 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala 20 <210> SEQ ID NO 297 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 297 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp 20 <210> SEQ ID NO 298 <211> LENGTH: 20 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 298 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr 20 <210> SEQ ID NO 299 <211> LENGTH: 19 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 299 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly <210> SEQ ID NO 300 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 300 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn <210> SEQ ID NO 301 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 301 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys <210> SEQ ID NO 302 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 302 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 <210> SEQ ID NO 303 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 303 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn 1 5 10 15 <210> SEQ ID NO 304 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 304 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu 1 5 10 <210> SEQ ID NO 305 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 305 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys 1 5 10 <210> SEQ ID NO 306 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 306 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 1 5 10 <210> SEQ ID NO 307 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 307 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn 1 5 10 <210> SEQ ID NO 308 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 308 Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser 1 5 10 <210> SEQ ID NO 309 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 309 Tyr Thr Ser Val Ile Thr Ile Glu Leu 1 5 <210> SEQ ID NO 310 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 310 Tyr Thr Ser Val Ile Thr Ile Glu 1 5 <210> SEQ ID NO 311 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 311 Tyr Thr Ser Val Ile Thr Ile 1 5 <210> SEQ ID NO 312 <211> LENGTH: 6 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 312 Tyr Thr Ser Val Ile Thr 1 5 <210> SEQ ID NO 313 <211> LENGTH: 47 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 313 Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys 1 5 10 15 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp 20 25 30 Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 35 40 45 <210> SEQ ID NO 314 <211> LENGTH: 46 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 314 Ser Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys Cys 1 5 10 15 Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp 20 25 30 Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 35 40 45 <210> SEQ ID NO 315 <211> LENGTH: 45 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 315 Val Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys Cys Asn 1 5 10 15 Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp Lys 20 25 30 Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 35 40 45 <210> SEQ ID NO 316 <211> LENGTH: 44 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 316 Ile Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys Cys Asn Gly 1 5 10 15 Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp Lys Tyr 20 25 30 Lys Asn Ala Val Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 35 40 <210> SEQ ID NO 317 <211> LENGTH: 43 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 317 Thr Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys Cys Asn Gly Thr 1 5 10 15 Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp Lys Tyr Lys 20 25 30 Asn Ala Val Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 35 40 <210> SEQ ID NO 318 <211> LENGTH: 42 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 318 Ile Glu Leu Ser Asn Ile Lys Glu Asn Lys Cys Asn Gly Thr Asp 1 5 10 15 Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp Lys Tyr Lys Asn 20 25 30 Ala Val Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 35 40 <210> SEQ ID NO 319 <211> LENGTH: 41 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 319 Glu Leu Ser Asn Ile Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala 1 5 10 15 Lys Val Lys Leu Ile Lys Gln Glu Leu Asp Lys Tyr Lys Asn Ala 20 25 30 Val Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 35 40 <210> SEQ ID NO 320 <211> LENGTH: 40 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 320 Leu Ser Asn Ile Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys 1 5 10 15 Val Lys Leu Ile Lys Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val 20 25 30 Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 35 40 <210> SEQ ID NO 321 <211> LENGTH: 39 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 321 Ser Asn Ile Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val 1 5 10 15 Lys Leu Ile Lys Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr 20 25 30 Glu Leu Gln Leu Leu Met Gln Ser Thr 35 <210> SEQ ID NO 322 <211> LENGTH: 38 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 322 Asn Ile Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val Lys 1 5 10 15 Leu Ile Lys Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu 20 25 30 Leu Gln Leu Leu Met Gln Ser Thr 35 <210> SEQ ID NO 323 <211> LENGTH: 37 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 323 Ile Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val Lys Leu 1 5 10 15 Ile Lys Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu 20 25 30 Gln Leu Leu Met Gln Ser Thr 35 <210> SEQ ID NO 324 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 324 Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile 1 5 10 15 Lys Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln 20 25 30 Leu Leu Met Gln Ser Thr 35 <210> SEQ ID NO 325 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 325 Asn Lys Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln 1 5 10 15 Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu 20 25 30 Met Gln Ser Thr <210> SEQ ID NO 326 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 326 Lys Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu 1 5 10 15 Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu Met 20 25 30 Gln Ser Thr <210> SEQ ID NO 327 <211> LENGTH: 32 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 327 Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu 1 5 10 15 Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu Met Gln 20 25 30 Ser Thr <210> SEQ ID NO 328 <211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 328 Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp 1 5 10 15 Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu Met Gln Ser 20 25 30 Thr <210> SEQ ID NO 329 <211> LENGTH: 30 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 329 Gly Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp Lys 1 5 10 15 Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 20 25 30 <210> SEQ ID NO 330 <211> LENGTH: 29 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 330 Thr Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp Lys Tyr 1 5 10 15 Lys Asn Ala Val Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 20 25 <210> SEQ ID NO 331 <211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 331 Asp Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp Lys Tyr Lys 1 5 10 15 Asn Ala Val Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 20 25 <210> SEQ ID NO 332 <211> LENGTH: 27 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 332 Ala Lys Val Lys Leu Ile Lys Gln Glu Leu Asp Lys Tyr Lys Asn 1 5 10 15 Ala Val Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 20 25 <210> SEQ ID NO 333 <211> LENGTH: 26 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 333 Lys Val Lys Leu Ile Lys Gln Glu Leu Asp Lys Tyr Lys Asn Ala 1 5 10 15 Val Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 20 25 <210> SEQ ID NO 334 <211> LENGTH: 25 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 334 Val Lys Leu Ile Lys Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val 1 5 10 15 Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 20 25 <210> SEQ ID NO 335 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 335 Lys Leu Ile Lys Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr 1 5 10 15 Glu Leu Gln Leu Leu Met Gln Ser Thr 20 <210> SEQ ID NO 336 <211> LENGTH: 23 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 336 Leu Ile Lys Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu 1 5 10 15 Leu Gln Leu Leu Met Gln Ser Thr 20 <210> SEQ ID NO 337 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 337 Ile Lys Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu 1 5 10 15 Gln Leu Leu Met Gln Ser Thr 20 <210> SEQ ID NO 338 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 338 Lys Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln 1 5 10 15 Leu Leu Met Gln Ser Thr 20 <210> SEQ ID NO 339 <211> LENGTH: 20 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 339 Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu 1 5 10 15 Leu Met Gln Ser Thr 20 <210> SEQ ID NO 340 <211> LENGTH: 19 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 340 Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu 1 5 10 15 Met Gln Ser Thr <210> SEQ ID NO 341 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 341 Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu Met 1 5 10 15 Gln Ser Thr <210> SEQ ID NO 342 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 342 Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu Met Gln 1 5 10 15 Ser Thr <210> SEQ ID NO 343 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 343 Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 1 5 10 15 <210> SEQ ID NO 344 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 344 Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 1 5 10 15 <210> SEQ ID NO 345 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 345 Lys Asn Ala Val Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 1 5 10 <210> SEQ ID NO 346 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 346 Asn Ala Val Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 1 5 10 <210> SEQ ID NO 347 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 347 Ala Val Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 1 5 10 <210> SEQ ID NO 348 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 348 Val Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 1 5 10 <210> SEQ ID NO 349 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 349 Thr Glu Leu Gln Leu Leu Met Gln Ser Thr 1 5 10 <210> SEQ ID NO 350 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 350 Glu Leu Gln Leu Leu Met Gln Ser Thr 1 5 <210> SEQ ID NO 351 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 351 Leu Gln Leu Leu Met Gln Ser Thr 1 5 <210> SEQ ID NO 352 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 352 Gln Leu Leu Met Gln Ser Thr 1 5 <210> SEQ ID NO 353 <211> LENGTH: 6 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 353 Leu Leu Met Gln Ser Thr 1 5 <210> SEQ ID NO 354 <211> LENGTH: 37 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 354 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile 20 25 30 Arg Lys Ser Asp Glu Leu Leu 35 <210> SEQ ID NO 355 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 355 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile 20 25 30 Arg Lys Ser Asp Glu Leu 35 <210> SEQ ID NO 356 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 356 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile 20 25 30 Arg Lys Ser Asp Glu 35 <210> SEQ ID NO 357 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 357 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile 20 25 30 Arg Lys Ser Asp <210> SEQ ID NO 358 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 358 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile 20 25 30 Arg Lys Ser <210> SEQ ID NO 359 <211> LENGTH: 32 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 359 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile 20 25 30 Arg Lys <210> SEQ ID NO 360 <211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 360 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile 20 25 30 Arg <210> SEQ ID NO 361 <211> LENGTH: 30 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 361 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile 20 25 30 <210> SEQ ID NO 362 <211> LENGTH: 29 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 362 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe 20 25 <210> SEQ ID NO 363 <211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 363 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu Ala 20 25 <210> SEQ ID NO 364 <211> LENGTH: 27 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 364 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu 20 25 <210> SEQ ID NO 365 <211> LENGTH: 26 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 365 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser 20 25 <210> SEQ ID NO 366 <211> LENGTH: 25 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 366 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser Gln Val Asn Glu Lys Ile Asn Gln 20 25 <210> SEQ ID NO 367 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 367 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser Gln Val Asn Glu Lys Ile Asn 20 <210> SEQ ID NO 368 <211> LENGTH: 23 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 368 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser Gln Val Asn Glu Lys Ile 20 <210> SEQ ID NO 369 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 369 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser Gln Val Asn Glu Lys 20 <210> SEQ ID NO 370 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 370 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser Gln Val Asn Glu 20 <210> SEQ ID NO 371 <211> LENGTH: 20 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 371 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser Gln Val Asn 20 <210> SEQ ID NO 372 <211> LENGTH: 19 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 372 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser Gln Val <210> SEQ ID NO 373 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 373 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser Gln <210> SEQ ID NO 374 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 374 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile Ser <210> SEQ ID NO 375 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 375 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 Ile <210> SEQ ID NO 376 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 376 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser 1 5 10 15 <210> SEQ ID NO 377 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 377 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala 1 5 10 <210> SEQ ID NO 378 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 378 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp 1 5 10 <210> SEQ ID NO 379 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 379 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe 1 5 10 <210> SEQ ID NO 380 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 380 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu 1 5 10 <210> SEQ ID NO 381 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 381 Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp 1 5 10 <210> SEQ ID NO 382 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 382 Phe Tyr Asp Pro Leu Val Phe Pro Ser 1 5 <210> SEQ ID NO 383 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 383 Phe Tyr Asp Pro Leu Val Phe Pro 1 5 <210> SEQ ID NO 384 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 384 Phe Tyr Asp Pro Leu Val Phe 1 5 <210> SEQ ID NO 385 <211> LENGTH: 6 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 385 Phe Tyr Asp Pro Leu Val 1 5 <210> SEQ ID NO 386 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 386 Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile 1 5 10 15 Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg 20 25 30 Lys Ser Asp Glu Leu Leu 35 <210> SEQ ID NO 387 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 387 Asp Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser 1 5 10 15 Gln Val Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys 20 25 30 Ser Asp Glu Leu Leu 35 <210> SEQ ID NO 388 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 388 Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln 1 5 10 15 Val Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys Ser 20 25 30 Asp Glu Leu Leu <210> SEQ ID NO 389 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 389 Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val 1 5 10 15 Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp 20 25 30 Glu Leu Leu <210> SEQ ID NO 390 <211> LENGTH: 32 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 390 Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn 1 5 10 15 Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu 20 25 30 Leu Leu <210> SEQ ID NO 391 <211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 391 Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn Glu 1 5 10 15 Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu 20 25 30 <210> SEQ ID NO 392 <211> LENGTH: 30 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 392 Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn Glu Lys 1 5 10 15 Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu 20 25 30 <210> SEQ ID NO 393 <211> LENGTH: 29 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 393 Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn Glu Lys Ile 1 5 10 15 Asn Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu 20 25 <210> SEQ ID NO 394 <211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 394 Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn Glu Lys Ile Asn 1 5 10 15 Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu 20 25 <210> SEQ ID NO 395 <211> LENGTH: 27 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 395 Glu Phe Asp Ala Ser Ile Ser Gln Val Asn Glu Lys Ile Asn Gln 1 5 10 15 Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu 20 25 <210> SEQ ID NO 396 <211> LENGTH: 26 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 396 Phe Asp Ala Ser Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser 1 5 10 15 Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu 20 25 <210> SEQ ID NO 397 <211> LENGTH: 25 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 397 Asp Ala Ser Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu 1 5 10 15 Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu 20 25 <210> SEQ ID NO 398 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 398 Ala Ser Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu Ala 1 5 10 15 Phe Ile Arg Lys Ser Asp Glu Leu Leu 20 <210> SEQ ID NO 399 <211> LENGTH: 23 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 399 Ser Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe 1 5 10 15 Ile Arg Lys Ser Asp Glu Leu Leu 20 <210> SEQ ID NO 400 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 400 Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile 1 5 10 15 Arg Lys Ser Asp Glu Leu Leu 20 <210> SEQ ID NO 401 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 401 Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg 1 5 10 15 Lys Ser Asp Glu Leu Leu 20 <210> SEQ ID NO 402 <211> LENGTH: 20 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 402 Gln Val Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys 1 5 10 15 Ser Asp Glu Leu Leu 20 <210> SEQ ID NO 403 <211> LENGTH: 19 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 403 Val Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys Ser 1 5 10 15 Asp Glu Leu Leu <210> SEQ ID NO 404 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 404 Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp 1 5 10 15 Glu Leu Leu <210> SEQ ID NO 405 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 405 Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu 1 5 10 15 Leu Leu <210> SEQ ID NO 406 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 406 Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu 1 5 10 15 <210> SEQ ID NO 407 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 407 Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu 1 5 10 15 <210> SEQ ID NO 408 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 408 Asn Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu 1 5 10 <210> SEQ ID NO 409 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 409 Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu 1 5 10 <210> SEQ ID NO 410 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 410 Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu 1 5 10 <210> SEQ ID NO 411 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 411 Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu 1 5 10 <210> SEQ ID NO 412 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 412 Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu 1 5 10 <210> SEQ ID NO 413 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 413 Phe Ile Arg Lys Ser Asp Glu Leu Leu 1 5 <210> SEQ ID NO 414 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 414 Ile Arg Lys Ser Asp Glu Leu Leu 1 5 <210> SEQ ID NO 415 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 415 Arg Lys Ser Asp Glu Leu Leu 1 5 <210> SEQ ID NO 416 <211> LENGTH: 6 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 416 Lys Ser Asp Glu Leu Leu 1 5 <210> SEQ ID NO 417 <211> LENGTH: 35 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 417 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu 20 25 30 Trp Ile Arg Arg Ser 35 <210> SEQ ID NO 418 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 418 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu 20 25 30 Trp Ile Arg Arg <210> SEQ ID NO 419 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 419 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu 20 25 30 Trp Ile Arg <210> SEQ ID NO 420 <211> LENGTH: 32 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 420 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu 20 25 30 Trp Ile <210> SEQ ID NO 421 <211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 421 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu 20 25 30 Trp <210> SEQ ID NO 422 <211> LENGTH: 30 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 422 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu 20 25 30 <210> SEQ ID NO 423 <211> LENGTH: 29 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 423 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys 20 25 <210> SEQ ID NO 424 <211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 424 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser 20 25 <210> SEQ ID NO 425 <211> LENGTH: 27 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 425 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu 20 25 <210> SEQ ID NO 426 <211> LENGTH: 26 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 426 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu 20 25 <210> SEQ ID NO 427 <211> LENGTH: 25 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 427 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu 20 25 <210> SEQ ID NO 428 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 428 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 Ile Glu Leu Asn Lys Ala Lys Ser Asp 20 <210> SEQ ID NO 429 <211> LENGTH: 23 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 429 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 Ile Glu Leu Asn Lys Ala Lys Ser 20 <210> SEQ ID NO 430 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 430 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 Ile Glu Leu Asn Lys Ala Lys 20 <210> SEQ ID NO 431 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 431 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 Ile Glu Leu Asn Lys Ala 20 <210> SEQ ID NO 432 <211> LENGTH: 20 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 432 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 Ile Glu Leu Asn Lys 20 <210> SEQ ID NO 433 <211> LENGTH: 19 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 433 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 Ile Glu Leu Asn <210> SEQ ID NO 434 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 434 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 Ile Glu Leu <210> SEQ ID NO 435 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 435 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 Ile Glu <210> SEQ ID NO 436 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 436 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 Ile <210> SEQ ID NO 437 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 437 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser 1 5 10 15 <210> SEQ ID NO 438 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 438 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile 1 5 10 <210> SEQ ID NO 439 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 439 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp 1 5 10 <210> SEQ ID NO 440 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 440 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile 1 5 10 <210> SEQ ID NO 441 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 441 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp Pro 1 5 10 <210> SEQ ID NO 442 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 442 Ile Thr Leu Asn Asn Ser Val Ala Leu Asp 1 5 10 <210> SEQ ID NO 443 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 443 Ile Thr Leu Asn Asn Ser Val Ala Leu 1 5 <210> SEQ ID NO 444 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 444 Ile Thr Leu Asn Asn Ser Val Ala 1 5 <210> SEQ ID NO 445 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 445 Ile Thr Leu Asn Asn Ser Val 1 5 <210> SEQ ID NO 446 <211> LENGTH: 6 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 446 Ile Thr Leu Asn Asn Ser 1 5 <210> SEQ ID NO 447 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 447 Thr Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser Ile 1 5 10 15 Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu Trp 20 25 30 Ile Arg Arg Ser <210> SEQ ID NO 448 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 448 Leu Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser Ile Glu 1 5 10 15 Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu Trp Ile 20 25 30 Arg Arg Ser <210> SEQ ID NO 449 <211> LENGTH: 32 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 449 Asn Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser Ile Glu Leu 1 5 10 15 Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu Trp Ile Arg 20 25 30 Arg Ser <210> SEQ ID NO 450 <211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 450 Asn Ser Val Ala Leu Asp Pro Ile Asp Ile Ser Ile Glu Leu Asn 1 5 10 15 Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu Trp Ile Arg Arg 20 25 30 Ser <210> SEQ ID NO 451 <211> LENGTH: 30 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 451 Ser Val Ala Leu Asp Pro Ile Asp Ile Ser Ile Glu Leu Asn Lys 1 5 10 15 Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu Trp Ile Arg Arg Ser 20 25 30 <210> SEQ ID NO 452 <211> LENGTH: 29 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 452 Val Ala Leu Asp Pro Ile Asp Ile Ser Ile Glu Leu Asn Lys Ala 1 5 10 15 Lys Ser Asp Leu Glu Glu Ser Lys Glu Trp Ile Arg Arg Ser 20 25 <210> SEQ ID NO 453 <211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 453 Ala Leu Asp Pro Ile Asp Ile Ser Ile Glu Leu Asn Lys Ala Lys 1 5 10 15 Ser Asp Leu Glu Glu Ser Lys Glu Trp Ile Arg Arg Ser 20 25 <210> SEQ ID NO 454 <211> LENGTH: 27 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 454 Leu Asp Pro Ile Asp Ile Ser Ile Glu Leu Asn Lys Ala Lys Ser 1 5 10 15 Asp Leu Glu Glu Ser Lys Glu Trp Ile Arg Arg Ser 20 25 <210> SEQ ID NO 455 <211> LENGTH: 26 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 455 Asp Pro Ile Asp Ile Ser Ile Glu Leu Asn Lys Ala Lys Ser Asp 1 5 10 15 Leu Glu Glu Ser Lys Glu Trp Ile Arg Arg Ser 20 25 <210> SEQ ID NO 456 <211> LENGTH: 25 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 456 Pro Ile Asp Ile Ser Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu 1 5 10 15 Glu Glu Ser Lys Glu Trp Ile Arg Arg Ser 20 25 <210> SEQ ID NO 457 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 457 Ile Asp Ile Ser Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu 1 5 10 15 Glu Ser Lys Glu Trp Ile Arg Arg Ser 20 <210> SEQ ID NO 458 <211> LENGTH: 23 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 458 Asp Ile Ser Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu 1 5 10 15 Ser Lys Glu Trp Ile Arg Arg Ser 20 <210> SEQ ID NO 459 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 459 Ile Ser Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser 1 5 10 15 Lys Glu Trp Ile Arg Arg Ser 20 <210> SEQ ID NO 460 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 460 Ser Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys 1 5 10 15 Glu Trp Ile Arg Arg Ser 20 <210> SEQ ID NO 461 <211> LENGTH: 20 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 461 Ile Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu 1 5 10 15 Trp Ile Arg Arg Ser 20 <210> SEQ ID NO 462 <211> LENGTH: 19 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 462 Glu Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu Trp 1 5 10 15 Ile Arg Arg Ser <210> SEQ ID NO 463 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 463 Leu Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu Trp Ile 1 5 10 15 Arg Arg Ser <210> SEQ ID NO 464 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 464 Asn Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu Trp Ile Arg 1 5 10 15 Arg Ser <210> SEQ ID NO 465 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 465 Lys Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu Trp Ile Arg Arg Ser 1 5 10 15 <210> SEQ ID NO 466 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 466 Ala Lys Ser Asp Leu Glu Glu Ser Lys Glu Trp Ile Arg Arg Ser 1 5 10 15 <210> SEQ ID NO 467 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 467 Lys Ser Asp Leu Glu Glu Ser Lys Glu Trp Ile Arg Arg Ser 1 5 10 <210> SEQ ID NO 468 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 468 Ser Asp Leu Glu Glu Ser Lys Glu Trp Ile Arg Arg Ser 1 5 10 <210> SEQ ID NO 469 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 469 Asp Leu Glu Glu Ser Lys Glu Trp Ile Arg Arg Ser 1 5 10 <210> SEQ ID NO 470 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 470 Leu Glu Glu Ser Lys Glu Trp Ile Arg Arg Ser 1 5 10 <210> SEQ ID NO 471 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 471 Glu Glu Ser Lys Glu Trp Ile Arg Arg Ser 1 5 10 <210> SEQ ID NO 472 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 472 Glu Ser Lys Glu Trp Ile Arg Arg Ser 1 5 <210> SEQ ID NO 473 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 473 Ser Lys Glu Trp Ile Arg Arg Ser 1 5 <210> SEQ ID NO 474 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 474 Lys Glu Trp Ile Arg Arg Ser 1 5 <210> SEQ ID NO 475 <211> LENGTH: 6 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 475 Glu Trp Ile Arg Arg Ser 1 5 <210> SEQ ID NO 476 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 476 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala 1 5 10 15 Leu Val Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys 20 25 30 Glu Ala Ile Arg <210> SEQ ID NO 477 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 477 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala 1 5 10 15 Leu Val Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys 20 25 30 Glu Ala Ile <210> SEQ ID NO 478 <211> LENGTH: 32 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 478 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala 1 5 10 15 Leu Val Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys 20 25 30 Glu Ala <210> SEQ ID NO 479 <211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 479 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala 1 5 10 15 Leu Val Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys 20 25 30 Glu <210> SEQ ID NO 480 <211> LENGTH: 30 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 480 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala 1 5 10 15 Leu Val Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys 20 25 30 <210> SEQ ID NO 481 <211> LENGTH: 29 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 481 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala 1 5 10 15 Leu Val Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu 20 25 <210> SEQ ID NO 482 <211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 482 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala 1 5 10 15 Leu Val Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys 20 25 <210> SEQ ID NO 483 <211> LENGTH: 27 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 483 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala 1 5 10 15 Leu Val Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu 20 25 <210> SEQ ID NO 484 <211> LENGTH: 26 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 484 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala 1 5 10 15 Leu Val Glu Ala Lys Gln Ala Arg Ser Asp Ile 20 25 <210> SEQ ID NO 485 <211> LENGTH: 25 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 485 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala 1 5 10 15 Leu Val Glu Ala Lys Gln Ala Arg Ser Asp 20 25 <210> SEQ ID NO 486 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 486 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala 1 5 10 15 Leu Val Glu Ala Lys Gln Ala Arg Ser 20 <210> SEQ ID NO 487 <211> LENGTH: 23 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 487 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala 1 5 10 15 Leu Val Glu Ala Lys Gln Ala Arg 20 <210> SEQ ID NO 488 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 488 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala 1 5 10 15 Leu Val Glu Ala Lys Gln Ala 20 <210> SEQ ID NO 489 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 489 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala 1 5 10 15 Leu Val Glu Ala Lys Gln 20 <210> SEQ ID NO 490 <211> LENGTH: 20 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 490 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala 1 5 10 15 Leu Val Glu Ala Lys 20 <210> SEQ ID NO 491 <211> LENGTH: 19 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 491 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala 1 5 10 15 Leu Val Glu Ala <210> SEQ ID NO 492 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 492 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala 1 5 10 15 Leu Val Glu <210> SEQ ID NO 493 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 493 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala 1 5 10 15 Leu Val <210> SEQ ID NO 494 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 494 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala 1 5 10 15 Leu <210> SEQ ID NO 495 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 495 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala 1 5 10 15 <210> SEQ ID NO 496 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 496 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val 1 5 10 <210> SEQ ID NO 497 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 497 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala 1 5 10 <210> SEQ ID NO 498 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 498 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala 1 5 10 <210> SEQ ID NO 499 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 499 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile Thr 1 5 10 <210> SEQ ID NO 500 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 500 Ala Leu Gly Val Ala Thr Ser Ala Gln Ile 1 5 10 <210> SEQ ID NO 501 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 501 Ala Leu Gly Val Ala Thr Ser Ala Gln 1 5 <210> SEQ ID NO 502 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 502 Ala Leu Gly Val Ala Thr Ser Ala 1 5 <210> SEQ ID NO 503 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 503 Ala Leu Gly Val Ala Thr Ser 1 5 <210> SEQ ID NO 504 <211> LENGTH: 6 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 504 Ala Leu Gly Val Ala Thr 1 5 <210> SEQ ID NO 505 <211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 505 Leu Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala Leu 1 5 10 15 Val Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys Glu 20 25 30 Ala Ile Arg Asp <210> SEQ ID NO 506 <211> LENGTH: 33 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 506 Gly Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala Leu Val 1 5 10 15 Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys Glu Ala 20 25 30 Ile Arg Asp <210> SEQ ID NO 507 <211> LENGTH: 32 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 507 Val Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala Leu Val Glu 1 5 10 15 Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys Glu Ala Ile 20 25 30 Arg Asp <210> SEQ ID NO 508 <211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 508 Ala Thr Ser Ala Gln Ile Thr Ala Ala Val Ala Leu Val Glu Ala 1 5 10 15 Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys Glu Ala Ile Arg Asp 20 25 30 <210> SEQ ID NO 509 <211> LENGTH: 30 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 509 Thr Ser Ala Gln Ile Thr Ala Ala Val Ala Leu Val Glu Ala Lys 1 5 10 15 Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys Glu Ala Ile Arg Asp 20 25 30 <210> SEQ ID NO 510 <211> LENGTH: 29 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 510 Ser Ala Gln Ile Thr Ala Ala Val Ala Leu Val Glu Ala Lys Gln 1 5 10 15 Ala Arg Ser Asp Ile Glu Lys Leu Lys Glu Ala Ile Arg Asp 20 25 <210> SEQ ID NO 511 <211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 511 Ala Gln Ile Thr Ala Ala Val Ala Leu Val Glu Ala Lys Gln Ala 1 5 10 15 Arg Ser Asp Ile Glu Lys Leu Lys Glu Ala Ile Arg Asp 20 25 <210> SEQ ID NO 512 <211> LENGTH: 27 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 512 Gln Ile Thr Ala Ala Val Ala Leu Val Glu Ala Lys Gln Ala Arg 1 5 10 15 Ser Asp Ile Glu Lys Leu Lys Glu Ala Ile Arg Asp 20 25 <210> SEQ ID NO 513 <211> LENGTH: 26 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 513 Ile Thr Ala Ala Val Ala Leu Val Glu Ala Lys Gln Ala Arg Ser 1 5 10 15 Asp Ile Glu Lys Leu Lys Glu Ala Ile Arg Asp 20 25 <210> SEQ ID NO 514 <211> LENGTH: 25 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 514 Thr Ala Ala Val Ala Leu Val Glu Ala Lys Gln Ala Arg Ser Asp 1 5 10 15 Ile Glu Lys Leu Lys Glu Ala Ile Arg Asp 20 25 <210> SEQ ID NO 515 <211> LENGTH: 24 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 515 Ala Ala Val Ala Leu Val Glu Ala Lys Gln Ala Arg Ser Asp Ile 1 5 10 15 Glu Lys Leu Lys Glu Ala Ile Arg Asp 20 <210> SEQ ID NO 516 <211> LENGTH: 23 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 516 Ala Val Ala Leu Val Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu 1 5 10 15 Lys Leu Lys Glu Ala Ile Arg Asp 20 <210> SEQ ID NO 517 <211> LENGTH: 22 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 517 Val Ala Leu Val Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys 1 5 10 15 Leu Lys Glu Ala Ile Arg Asp 20 <210> SEQ ID NO 518 <211> LENGTH: 21 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 518 Ala Leu Val Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu 1 5 10 15 Lys Glu Ala Ile Arg Asp 20 <210> SEQ ID NO 519 <211> LENGTH: 20 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 519 Leu Val Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys 1 5 10 15 Glu Ala Ile Arg Asp 20 <210> SEQ ID NO 520 <211> LENGTH: 19 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 520 Val Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys Glu 1 5 10 15 Ala Ile Arg Asp <210> SEQ ID NO 521 <211> LENGTH: 18 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 521 Glu Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys Glu Ala 1 5 10 15 Ile Arg Asp <210> SEQ ID NO 522 <211> LENGTH: 17 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 522 Ala Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys Glu Ala Ile 1 5 10 15 Arg Asp <210> SEQ ID NO 523 <211> LENGTH: 16 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 523 Lys Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys Glu Ala Ile Arg Asp 1 5 10 15 <210> SEQ ID NO 524 <211> LENGTH: 15 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 524 Gln Ala Arg Ser Asp Ile Glu Lys Leu Lys Glu Ala Ile Arg Asp 1 5 10 15 <210> SEQ ID NO 525 <211> LENGTH: 14 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 525 Ala Arg Ser Asp Ile Glu Lys Leu Lys Glu Ala Ile Arg Asp 1 5 10 <210> SEQ ID NO 526 <211> LENGTH: 13 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 526 Arg Ser Asp Ile Glu Lys Leu Lys Glu Ala Ile Arg Asp 1 5 10 <210> SEQ ID NO 527 <211> LENGTH: 12 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 527 Ser Asp Ile Glu Lys Leu Lys Glu Ala Ile Arg Asp 1 5 10 <210> SEQ ID NO 528 <211> LENGTH: 11 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 528 Asp Ile Glu Lys Leu Lys Glu Ala Ile Arg Asp 1 5 10 <210> SEQ ID NO 529 <211> LENGTH: 10 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 529 Ile Glu Lys Leu Lys Glu Ala Ile Arg Asp 1 5 10 <210> SEQ ID NO 530 <211> LENGTH: 9 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 530 Glu Lys Leu Lys Glu Ala Ile Arg Asp 1 5 <210> SEQ ID NO 531 <211> LENGTH: 8 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 531 Lys Leu Lys Glu Ala Ile Arg Asp 1 5 <210> SEQ ID NO 532 <211> LENGTH: 7 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 532 Leu Lys Glu Ala Ile Arg Asp 1 5 <210> SEQ ID NO 533 <211> LENGTH: 6 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 533 Lys Glu Ala Ile Arg Asp 1 5 <210> SEQ ID NO 534 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 534 Tyr Thr Gly Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 20 25 30 Trp Asn Trp Phe 35 <210> SEQ ID NO 535 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 535 Tyr Thr Asn Leu Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 20 25 30 Trp Asn Trp Phe 35 <210> SEQ ID NO 536 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 536 Tyr Thr Ser Ile Ile His Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 20 25 30 Trp Asn Trp Phe 35 <210> SEQ ID NO 537 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 537 Tyr Thr Ser Leu Ile Tyr Ser Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 20 25 30 Trp Asn Trp Phe 35 <210> SEQ ID NO 538 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 538 Tyr Thr Ser Leu Ile His Arg Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 20 25 30 Trp Asn Trp Phe 35 <210> SEQ ID NO 539 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 539 Tyr Thr Ser Leu Ile His Asn Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 20 25 30 Trp Asn Trp Phe 35 <210> SEQ ID NO 540 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 540 Tyr Thr Ser Leu Ile His Thr Leu Ile Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 20 25 30 Trp Asn Trp Phe 35 <210> SEQ ID NO 541 <211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 541 Tyr Thr Ser Leu Ile His Ser Leu Leu Glu Glu Ser Gln Asn Gln Gln 1 5 10 15 Glu Lys Asn Glu Gln Glu Leu Leu Glu Leu Asp Lys Trp Ala Ser Leu 20 25 30 Trp Asn Trp Phe 35 <210> SEQ ID NO 542 <211> LENGTH: 38 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 542 Ser Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu 20 25 30 Arg Tyr Leu Lys Asp Gln 35 <210> SEQ ID NO 543 <211> LENGTH: 38 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 543 Asn Asn Leu Leu Arg Ala Ile Asp Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu 20 25 30 Arg Tyr Leu Lys Asp Gln 35 <210> SEQ ID NO 544 <211> LENGTH: 38 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 544 Asn Asn Leu Leu Arg Ala Ile Gln Ala Gln Gln His Leu Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu 20 25 30 Arg Tyr Leu Lys Asp Gln 35 <210> SEQ ID NO 545 <211> LENGTH: 38 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Description of Artificial Sequence: synthetic peptide <400> SEQUENCE: 545 Asn Asn Leu Leu Arg Ala Ile Glu Ala Gln Gln His Met Leu Gln Leu 1 5 10 15 Thr Val Trp Gln Ile Lys Gln Leu Gln Ala Arg Ile Leu Ala Val Glu 20 25 30 Arg Tyr Leu Lys Asp Gln 35


Patent applications by Dominique P. Bridon, Outremont CA

Patent applications by Nissab Boudjellab, Dorval CA

Patent applications by Peter G. Milner, Los Altos Hills, CA US

Patent applications by Conjuchem Biotechnologies, Inc.

Patent applications in class CONJUGATE OR COMPLEX OF MONOCLONAL OR POLYCLONAL ANTIBODY, IMMUNOGLOBULIN, OR FRAGMENT THEREOF WITH NONIMMUNOGLOBULIN MATERIAL

Patent applications in all subclasses CONJUGATE OR COMPLEX OF MONOCLONAL OR POLYCLONAL ANTIBODY, IMMUNOGLOBULIN, OR FRAGMENT THEREOF WITH NONIMMUNOGLOBULIN MATERIAL


User Contributions:

Comment about this patent or add new information about this topic:

CAPTCHA
Similar patent applications:
DateTitle
2012-02-16Stable solid formulations of gc-c receptor agonist polypeptides suitable for oral administration
2012-02-16Intergenic regions as insertion sites in the genome of modified vaccinia virus ankara (mva)
2012-01-19Rna sequence-specific mediators of rna interference
2012-02-16Tetrahydrothiazolopyridine inhibitors of phosphatidylinositol 3-kinase
2011-12-22Cyclopropyl fused indolobenzazepine hcv ns5b inhibitors
New patent applications in this class:
DateTitle
2013-05-16Novel long-acting glucagon conjugate and pharmaceutical composition comprising the same for the prevention and treatment of obesity
2013-05-16Sequence of stro-1 antibody variable region
2013-05-09Delivery proteins
2013-04-25Human antibody drug conjugates against tissue factor
2013-04-25Receptor tyrosine kinase-like orphan receptor 1 (ror1) single chain fv antibody fragment conjugates and methods of use thereof
New patent applications from these inventors:
DateTitle
2011-11-03Methods for treating atrial fibrillation and reducing stroke rate in atrial fibrillation patients
2011-06-16Methods for treating atrial fibrillation
2011-06-09Methods for stroke reduction in atrial fibrillation patients
2011-03-24Long lasting anti-angiogenic peptides
2009-12-17Long lasting glucagon-like peptide 2 (glp-2) for the treatment of gastrointestinal diseases and disorders
Top Inventors for class "Drug, bio-affecting and body treating compositions"
RankInventor's name
1David M. Goldenberg
2Lowell L. Wood, Jr.
3Roderick A. Hyde
4Yat Sun Or
5Elizabeth A. Sweeney